Cahiers de RECITS

Commentaires

Transcription

Cahiers de RECITS
#AHIERS DE 2%#)43
.€ ß$% "%,&/24-/.4"b,)!2$
Cahiers du laboratoire RECITS (UTBM)
Laboratoire de Recherches et Études sur le Changement Industriel,
Technologique et Sociétal (RECITS, EA 3897)
90 010 Belfort cedex.
5HVSRQVDEOHVFLHQWLÀTXH5REHUW%(/27
7pO
)D[
&RXUULHOUREHUWEHORW#XWEPIU
5pGDFWHXUHQFKHI/DXUHQW+(<%(5*(5
&RXUULHOODXUHQWKH\EHUJHU#XWEPIU
Ce laboratoire de recherche en sciences humaines et sociales s’inscrit dans
XQHYRORQWpGHUHQIRUFHUODGLPHQVLRQ©+XPDQLWpVªGHO·87%0WDQWDX
niveau de l’enseignement que celui de la recherche.
Il a pour vocation de développer la dimension humaniste de la formation
de l’ingénieur, notamment par une démarche d’aide à la compréhension
de la complexité des phénomènes technologiques par leurs implications
économiques et sociales.
6DGpPDUFKHFRQVLVWH
. à penser la technologie comme un fait social et culturel,
. à penser ce fait dans sa complexité et sa contextualité,
. à situer le phénomène à l’intersection de l’économie, du politique et du
VFLHQWLÀTXH
Les axes de recherche retenus en rapport avec les compétences apportées
SDUOHVHQVHLJQDQWVFKHUFKHXUVVRQW
SROLWLTXHVLQGXVWULHOOHVORJLTXHVDFWHXUVWHUULWRLUHVLQQRYDWLRQ
. histoire et mémoire des entreprises, patrimoine.
. représentations de la technique.
&DKLHUVGH5(&,76,661
5pGDFWLRQXQLYHUVLWpGHWHFKQRORJLHGH%HOIRUW0RQWEpOLDUG
UTBM, site de Sevenans, rue du château, 90 010 Belfort cedex
Carine Bourgeois
7pO
Cahiers de
RECITS
n° 7
Recherches et Études sur le Changement Industriel,
Technologique et Sociétal, Université de technologie
de Belfort-Montbéliard (UTBM)
Cahiers du laboratoire RECITS (UTBM), EA n° 3897
Laboratoire de Recherches et Études sur le Changement Industriel,
Technologique et Sociétal (RECITS)
90010 Belfort cedex.
5HVSRQVDEOHVFLHQWLÀTXH5REHUW%HORW
7pO
5pGDFWHXUHQFKHI/DXUHQW+H\EHUJHU
&RXUULHOODXUHQWKH\EHUJHU#XWEPIU
‹8QLYHUVLWpGHWHFKQRORJLHGH%HOIRUW0RQWEpOLDUG
,611 Partie I
Culture et
formation
technique
#OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES ,ES COMPTES RENDUS DES OUVRIERS ITALIENS
AUX EXPOSITIONS UNIVERSELLES UNE SOURCE
POUR L´mTUDE DE LA CULTURE TECHNIQUE
ET PROFESSIONNELLE ENTRE LE 8)8E ET LE 88E SInCLE
!NNA 0ELLEGRINO
D
ANS LA SECONDE MOITIÉ DU XIXE SIÈCLE,
les expositions internationales représentent un moment privilégié pour la promotion
et la valorisation d’idées et de conceptions liées au monde
de l’industrie et du travail. Elles réalisent, selon des études récentes, un
network de relations et de communications d’une importance fondamenWDOHVXUOHSODQVFLHQWLÀTXHWHFKQRORJLTXHHWLQGXVWULHODLQVLTXHVXUOH
plan politique et social. Parallèlement, elles constituent le grand théâtre
RVHFpOqEUHQWOHV©IDVWHVGXSURJUqVªHWRV·DIÀUPHDYHFIRUFHXQHVpULH
de valeurs et de modèles liés au nouveau monde de l’industrie et de la
technologie12QDORQJWHPSVVRQJpTXHOHVSURWDJRQLVWHVHWGHVWLQDWDLUHV
GHFHPHVVDJHpWDLHQWOHVFODVVHVERXUJHRLVHVOHVFODVVHVPR\HQQHVLQYLWpHVFRPPHVSHFWDWULFHVGHVQRXYHDX[V\PEROHVGHODUHOLJLRQGXSURJUqV
PDLVUpFHPPHQWO·KLVWRULRJUDSKLHDSRVpOHSUREOqPHGHVGLIIpUHQWVW\SHV
3UR LES EXPOSITIONS UNIVERSELLES EN GmNmRAL 0AUL 'REENHALGH %PHEMERAL VISTAS THE EXPOSITIONS UNIVERSELLES
'REAT %XHIBITIONS AND 7ORLD´S &AIRS -ANCHESTER -ANCHESTER 5NIVERSITY 0RESS DU MoME
AUTEUR ,E LIVRE DES EXPOSITIONS UNIVERSELLES 0ARIS bDITION DES ARTS DmCORATIFS (ERSHER ,INDA
!IMONE #ARLO /LMO ,E %SPOSIZIONI 5NIVERSALI 4URIN "RIGITTE 3CHROEDER'UDEHUS !NNE 2AS
MUSSEN ,ES FASTES DU PROGRnS ,E GUIDE DES %XPOSITIONS UNIVERSELLES 0ARIS &LAMMARION 2OBERT
7 2YDELL .ANCY % 'WINN DIR &AIR 2EPRESENTATION 7ORLD´S &AIRS AND THE -ODERN 7ORLD !MSTERDAM 65 5NI
VERSITY 0RESS 3UR LES EXPOSITIONS COMME PHmNOMnNES PRmCURSEURS DES PROCESSUS DE COMMUNICATION ET
DE GLOBALISATION !LEXANDER #4 'EPPERT -ASSIMO "AIONI %SPOSIZIONI IN %UROPA FRA /TTO E .OVECENTO 3PAZI OR
GANIZZAZIONE RAPPRESENTAZIONI NUMmRO MONOGRAPHIQUE DE -EMORIA E 2ICERCA !LBERTO !BRUZZESE
,ESSICO DELLA COMUNICAZIONE 2OME -ELTEMI P !RMAND -ATTELART ,´INVENTION DE LA COMMUNI
CATION 0ARIS ,A $mCOUVERTE P 0ETER 3LOTERDIJK ,E PALAIS DE CRISTAL g L´INTmRIEUR DU CAPITALISME
PLANmTAIRE 0ARIS -AREN 3ELL %DITEURS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA G·©DSSURSULDWLRQªHWGH©UpFHSWLRQªGXSKpQRPqQHSDUOHVGLIIpUHQWHV
FODVVHVVRFLDOHVjSDUWLUGHVFODVVHVGLULJHDQWHVTXLRUJDQLVDLHQWG·XQSRLQW
de vue bureaucratique, administratif et juridique chaque événement, aux
SURGXFWHXUVTXLH[SRVDLHQWMXVTX·DX[IUDFWLRQVQXPpULTXHPHQWVLJQLÀFDWLYHVGHVFODVVHVODERULHXVHVLQYLWpHVj\SUHQGUHSDUWFKRLVLHVHWVpOHFWLRQnées par des commissions spécialement constituées à cet effet.
Cette participation produisait des documents qui sont parvenus jusqu’à
nous. La phase préparatoire de l’excursion impliquait en effet non seulement les institutions promotrices mais aussi les ouvriers eux-mêmes sur
XQHSpULRGHGHWHPSVDVVH]ORQJXH1RXVSUHQGURQVLFLHQFRQVLGpUDWLRQ
deux formes de documentation produites par ces événements. La première
concerne les demandes de participation présentées par les ouvriers. Les
travailleurs, en effet, devaient formuler une demande où ils étaient tenus
GH IRXUQLU HQ SOXV GHV GRQQpHV G·pWDW FLYLO OHV FHUWLÀFDWLRQV UHODWLYHV j
OHXU©GHJUpG·LQVWUXFWLRQªDLQVLTXHWRXWWLWUHjPrPHGHSURXYHUOHXU
KDELOHWp HW OHXU TXDOLÀFDWLRQ SURIHVVLRQQHOOHV /D GRFXPHQWDWLRQ UHTXLVH
sur le degré d’instruction technique atteint était l’un des critères essentiels
sur lequel se basait le jugement des commissions. Bien que soumise à une
appréciation en partie subjective, la documentation produite donne une
indication assez précise du niveau de culture générale, technique et professionnelle des travailleurs en question. La deuxième concerne les rapports
pFULWVGHVRXYULHUVjODÀQGHODYLVLWH/HVRXYULHUVGHYDLHQWSUpVHQWHUj
O·LVVXHGHOHXUYR\DJHXQFRPSWHUHQGXpFULWVXUODYLVLWHDFFRPSOLH'pMjj
l’époque, ces comptes rendus ont connu une certaine diffusion et sont enWUpVGHGLYHUVHVIDoRQVGDQVOHGLVFRXUV©SXEOLFªVXUOHVH[SRVLWLRQV2EMHW
G·H[DPHQGHODSDUWGHMXU\VVSpFLDX[GHSUL[HWHQPDLQWHVRFFDVLRQVGH
publications, ils partageaient cependant le même destin que celui de l’ensemble de la presse écrite sur les expositions, à savoir une vie éphémère,
liée à l’événement temporaire et par nature sans cesse en évolution et sans
cesse dépassé ; ils étaient donc destinés à tomber rapidement dans l’oubli.
Récemment, cette documentation a fait l’objet d’un regain d’attention
sur le plan historiographique. Il s’agit d’une source originale et précieuse, car elle ouvre une fenêtre nouvelle sur les caractéristiques sociales et
%N PARTICULIER SUR LE CONCEPT DE RmCEPTION VOIR !LBERTO !BRUZZESE &ORME ESTETICHE E SOCIETg DI MASSA !RTE
E PUBBLICO NELL´ETg DEL CAPITALISMO -ARSILIO 6ENICE P ET 0IETER VAN 7ESEMAEL !RCHITECTURE OF
INSTRUCTION AND DELIGHT ! SOCIO HISTORICAL ANALYSIS OF 7ORLD %XHIBITIONS AS A DIDACTIC PHENOMENON 2OTTERDAM 0UBLISHERS P ,A VERSION LA PLUS RmCENTE DE CETTE APPROCHE A mTm PRODUITE EN
&RANCE GRhCE AUX TRAVAUX DE -ADELEINE 2EBmRIOUX ¦ ,ES OUVRIERS ET LES EXPOSITIONS UNIVERSELLES DE 0ARIS AU
XIXE SInCLE § DANS ,E LIVRE DES EXPOSITIONS UNIVERSELLES OP CIT P DU MoME AUTEUR ¦ -ISE EN SCnNE ET
VULGARISATION L´EXPOSITION UNIVERSELLE DE § DANS ,E MOUVEMENT SOCIAL OCTOBREDmCEMBRE ET
EN PARTICULIER L´ESSAI INTRODUCTIF ¦ !U TOURNANT DES EXPOS § P NUMmRO SPmCIAL DE ,A REVUE DE L´mCONOMIE
SOCIALE 8)8 CONSACRm AU THnME ,ES EXPOSITIONS UNIVERSELLES g 0ARIS 3UR L´EXPOSITION PARISIENNE DE ET
SUR LA POLITIQUE D´INCLUSION DE CLASSES POPULAIRES 6OLKER "ARTH ¦ $ISPLAYING NORMALISATION4HE 0ARIS UNIVERSAL
EXHIBITION OF § DANS *OURNAL OF HISTORICAL SOCIOLOGY P # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES culturelles des classes laborieuses, fournissant des informations sur l’instruction générale, la culture technique et la formation professionnelle. En
ce qui concerne les rapports écrits par les ouvriers eux-mêmes, qui sont
FHX[DQDO\VpVMXVTX·jSUpVHQWSDUO·KLVWRULRJUDSKLHLOV·DJLWG·XQHGHVUDUHVIRUPHVGLVSRQLEOHVG·pFULWXUHSRSXODLUHG·HQUHJLVWUHPHQW©G·HQEDVª
de la culture et du langage des travailleurs3.
/·pWXGH GH FHV PDWpULDX[ FRPSRUWH WRXWHIRLV GH VpULHXVHV GLIÀFXOWpV
au-delà des traits communs et au-delà des différences et des particularités
LQGLYLGXHOOHV ,O IDXW WHQLU FRPSWH GX IDLW TXH FHV VRXUFHV UHÁqWHQW XQH
combinaison à la fois différente et originale de plusieurs éléments, comme
OHW\SHGHFRPPDQGLWDLUHO·RFFDVLRQGHO·H[SRVLWLRQRXHQFRUHODFXOWXUH
VSpFLÀTXHGHVRXYULHUV
$%58 #!3 $´b45$% ,%3 &,/2%.4).3 %4 ,%3 -),!.!)3
&!#% !5 0(b./-È.% $%3 %80/3)4)/.3
1RXV DQDO\VHURQV LFL OD GRFXPHQWDWLRQ UHODWLYH j FHQW WUHQWHWURLV
RXYULHUVÁRUHQWLQVHQYR\pVjO·([SRVLWLRQLQWHUQDWLRQDOHGH0LODQHQ
HW FHOOH UHODWLYH j FHQW FLQTXDQWHTXDWUH WUDYDLOOHXUV ORPEDUGV HQYR\pV
j O·([SRVLWLRQ XQLYHUVHOOH GH 3DULV GH /·DQDO\VH VHUD FHQWUpH WRXW
d’abord sur le degré d’instruction générale et professionnelle de ces deux
groupes, à travers la source des demandes que les ouvriers présentaient
aux comités organisateurs pour être choisis ; nous présenterons ensuite
FHUWDLQVPDWpULDX[UHODWLIVDX[GHX[FRUSXVGRFXPHQWDLUHVDÀQGHIDLUH
UHVVRUWLU GHV DIÀQLWpV HW GHV GLYHUJHQFHV VLJQLÀFDWLYHV QRWDPPHQW SDU
rapport au tissu organisationnel et associatif du milieu ouvrier local.
La composition des deux groupes s’avère assez hétérogène. Les
ouvriers milanais appartiennent à un ensemble qui, en Italie, est globalement le plus industrialisé et technologiquement le plus avancé de la
nation ; Milan est le siège de nombre des plus importantes institutions
ª CE TITRE ON DOIT g *ACQUES 2ANCInRE ET 0ATRICK 6AUDAY UN ESSAI PIONNIER #ES AUTEURS ONT PLACm AU CENTRE DE
LEUR RECHERCHE LE THnME DE LA MENTALITm OUVRInRE AINSI QUE DES PROBLnMES PLUS LARGES NOTAMMENT LES CONCEP
TIONS LImES AU GENRE .mANMOINS ILS SE SONT SURTOUT INTmRESSmS AU RAPPORT AVEC LES ¦ PHILOSOPHIES POLITIQUES §
QUI CONTRIBUENT DE MANInRE DmTERMINANTE AUX ATTRIBUTIONS IDENTITAIRES DU MONDE OUVRIER DE L´mPOQUE VOIR
*ACQUES 2ANCInRE ET 0ATRICK 6AUDAY ¦ %N ALLANT g L´EXPO L´OUVRIER SA FEMME ET LES MACHINES § DANS ,ES RmVOLTES
LOGIQUES P #ONCERNANT LE CAS ITALIEN IL Y A AUSSI UNE SmRIE D´mTUDES QUI ABORDENT DES THmMATIQUES
SPmCI½QUES SUR LE RxLE SUBORDONNm ATTRIBUm AUX CLASSES POPULAIRES g L´%XPOSITION ITALIENNE DE PAR EXEM
PLE !NTONIO 0ARISELLA ¦ &UORI DALLA SCENA LE CLASSI POPOLARI E L´%SPOSIZIONE DEL § DANS 'IANNA 0IANTONI
DIR 2OMA 2OME $E ,UCA P CONCERNANT UN CAS INDIVIDUEL !UGUSTA -OLINARI ¦ #RONACA DI
UN´ESPERIENZA MEMORABILE ,A VISITA DI UN OPERAIO GENOVESE ALL´ESPOSIZIONE INTERNAZIONALE DI 4ORINO DEL §
DANS 6ENTESIMO 3ECOLO A ) JANVIERAVRIL P !NNA 0ELLEGRINO /PERAI INTELLETTUALI ,AVORO TECNO
LOGIA E PROGRESSO ALL´%SPOSIZIONE DI -ILANO -ANDURIA ,ACAITA DU MoME AUTEUR ¦ !UX /LYMPIADES
DU PROGRnS LES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES AU 8)8E SInCLE § DANS $OCUMENTS POUR L´HISTOIRE
DES TECHNIQUES DmCEMBRE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA culturelles, politiques et associatives du mouvement des travailleurs. Florence, en revanche, est la capitale italienne des productions de qualité et
de luxe, semi-artisanales, de niche, destinées en grande partie au marché
international. Pourtant, dans les deux cas, les échantillons des ouvriers
HQYR\pVQHVRQWSDVVLGLIIpUHQWVGXSRLQWGHYXHGHODGLVWULEXWLRQGHV
secteurs productifs. Dans le cas lombard, le plus grand contingent est apSRUWpSDUOHVPpFDQLFLHQVHWOHVW\SRJUDSKHVTXLV·pOqYHQWUHVSHFWLYHPHQW
à vingt et dix-huit ; font ensuite partie du groupe seize tisserands, huit
menuisiers, six cordonniers, cinq lithographes, des fabricants d’étuis, des
bronzeurs, des chapeliers, des tailleurs, des maçons et ainsi de suite. Dans
OHFDVÁRUHQWLQSOXVGHDSSDUWLHQWjODFDWpJRULHGHVW\SRJUDSKHVHW
DSSDUHQWpVjODGHX[LqPHSODFHOHVRXYULHUVPpFDQLFLHQVDWWHLJQHQW
GX WRWDO VXLYLV SDU OHV FDWpJRULHV W\SLTXHV GH O·DUWLVDQDW XUEDLQ WHOV OHV
cordonniers, les peaussiers, les tonneliers, etc.
(QGpSLWGHYLOOHVDX[SURÀOVWHFKQLFRpFRQRPLTXHVGLIIpUHQWVOHVSURÀOVVRFLRpFRQRPLTXHVGHVRXYULHUVGH0LODQHW)ORUHQFHVRQWÀQDOHPHQW
DVVH] SURFKHV &HOD SRXUUDLW V·H[SOLTXHU SDU XQ HIIHW GH VpOHFWLRQ OHV
ouvriers les plus sensibilisés à la culture technique – et d’ailleurs aussi aux
enjeux politiques – appartiennent à une élite ouvrière que l’on retrouve
aussi bien à Milan qu’à Florence.
,! &/2-!4)/. 4%#(.)15% $%3 42!6!),,%523
$!.3 ,! 0b2)/$% $% ,! $%58)È-% 2b6/,54)/. ).$5342)%,,%
(QGHKRUVGHOHXUTXDOLÀFDWLRQHWGHOHXUPpWLHUVSpFLÀTXHTXLpWDLHQW
ces ouvriers, quel était leur milieu social d’origine, leur bagage professionnel, leur degré d’instruction ? Quelles écoles, quels cours professionnels
avaient-ils ou non fréquentés ? Bref, quelle était leur culture générale et
professionnelle ?
Les études existantes sur l’instruction technique des travailleurs en
Italie dans la période de la deuxième révolution industrielle ont apporté
de nombreux et importants éléments de connaissance sur les tentatives
accomplies, notamment dans les villes prises en considération, pour développer une culture technico-professionnelle et pour instituer des lieux
et des parcours de formation adéquats'DQVOHFDVPLODQDLVjODÀQGX
6OIR !TTI DEL #OMITATO !RCHIVIO CIVICO DEL #OMUNE DI -ILANO PAR LA SUITE !C-I %SPOSIZIONI E &IERE %SPOSIZIONE
)NTERNAZIONALE IN 0ARIGI ¯ CART 6OIR !LDO 4ONELLI ,´ISTRUZIONE TECNICA E PROFESSIONALE DI 3TATO NELLE STRUTTURE E NEI PROGRAMMI DA #ASATI ½NO AI
NOSTRI GIORNI -ILAN 'IUFFRn #ARLO ,ACAITA )STRUZIONE E 3VILUPPO INDUSTRIALE IN )TALIA &LORENCE
'IUNTI"ARBnRA 3IMONETTA 3OLDANI ¦ ,´ISTRUZIONE TECNICA NELL´)TALIA LIBERALE § DANS 3TUDI
3TORICI GENNAIOMARZO P ,INO 2OSSI DIR #ULTURA ISTRUZIONE E SOCIALISMO NELL´ETg GIOLITTIANA
-ILAN !NGELI # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES VLqFOH O·H[SpULHQFH GH SHUVRQQDJHV FRPPH *LXVHSSH &RORPER &HVDUH6DOGLQLRXG·HQWUHSUHQHXUVLQJpQLHXUVFRPPH*LRYDQ%DWWLVWD3LUHOOL
s’avère fondamentale, comme celle, plus tard, des milieux du Politecnico
de Milan, et d’institutions comme la Società Umanitaria6. Avec ces expériences s’instaure un climat où l’enseignement technique, marqué à l’époque par un essor sensible au niveau national7, trouve un terrain de culture
particulièrement fertile. Aux écoles professionnelles véritables s’ajoutent
des initiatives à différents niveaux qui vont des écoles du soir aux cours de
formation générale pour les ouvriers, des écoles-laboratoires promues et
largement expérimentées par la Société humanitaire en collaboration avec
O·eFROH SRO\WHFKQLTXH GH 0LODQ j XQH YDVWH SURGXFWLRQ pGLWRULDOH GRQW
O·H[SUHVVLRQODSOXVFRQQXHHVWGRQQpHSDUOHVPDQXHOV+RHSOL8, mais qui
comprenait également une vaste gamme de publications de divulgation
VFLHQWLÀTXH&HWHQVHPEOHGHIRUPHVG·LQVWUXFWLRQWHFKQLTXHUHODWLYHPHQW
VWUXFWXUpVHWUDGXLWSDUXQHWUqVODUJHGLIIXVLRQGHFRXUVWHPSRUDLUHVF\cles de conférences, initiatives culturelles et événements liés au climat positiviste et à la revalorisation des sciences appliquées caractéristiques de
ODÀQGXXIXe siècle.
'DQV OH FDV ÁRUHQWLQ FHWWH WHQWDWLYH GH GRQQHU GHV EDVHV LQVWLWXWLRQnelles à la formation de la main-d’œuvre urbaine – composée essentiellement d’ouvriers-artisans, qui se sentent concernés par les forts processus
de restructuration et d’adaptation qui touchent leur activité professionnelle – s’exprime par la création d’instituts, comme celui patronné par le
FRPWH 'HPHWULR )LQRFFKLHWWL GqV GHVWLQp j GHYHQLU O·Istituto d’Arte
cittadino (l’Institut d’Art citadin), auquel s’associe en 1900 la Scuola Professionale Leonardo da Vinci (l’École professionnelle Léonard de Vinci), orientée vers les arts de la mécanique, de l’électrotechnique et du bâtiment.
+RUPLVFHVLQLWLDWLYHVIRUWHPHQWVWUXFWXUpHV)ORUHQFHHVWDXVVLFRQFHUQpH
par la prolifération d’initiatives plus éphémères allant des écoles du soir
aux cours professionnels promus par diverses institutions de la ville ou
par les associations professionnelles et de secours mutuel, aux conférenFHVHWDX[F\FOHVGHOHoRQVGHO·XQLYHUVLWpSRSXODLUH/HVpWXGHVH[LVWDQWHV
FRQÀUPHQWO·pODERUDWLRQHWODÁRUDLVRQjO·pSRTXHGHFHVLQLWLDWLYHVWDQW
VXU OH SODQ SROLWLFRDGPLQLVWUDWLI TXH WHFKQLFRGLVFLSOLQDLUH 2Q D PRLQV
étudié en revanche, les niveaux de participation effective à ces structures
XIXe
6OIR ,´OPERA DELLA 3OCIETg 5MANITARIA DALLA SUA FONDAZIONE A OGGI ) MAGGIO -ILAN ,´5MANITARIA E LA
SUA OPERA -ILAN -ARIA ,ETIZIA $´!UTILIA )L CITTADINO SENZA BUROCRAZIA 3OCIETg UMANITARIA E AMMINISTRA
ZIONE PUBBLICA NELL´)TALIA LIBERALE -ILAN 'IUFFRn ,ES EFFECTIFS INSCRITS AUX mCOLES DE FORMATION TECHNIQUE PASSENT EN EFFET DE EN g EN
ET EN ET DOUBLENT LA DmCENNIE SUIVANTE VOIR #ARLO ,ACAITA )STRUZIONE E 3VILUPPO OP CIT
P #F ,AURA "ARILE ¦ ,A DIVULGAZIONE SCIENTI½CA § DANS 6ALERIO #ASTRONOVO DIR ,A CASSETTA DEGLI
STRUMENTI IDEOLOGIE E MODELLI SOCIALI NELL´INDUSTRIALISMO ITALIANO -ILAN !NGELI P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA de formation et pratiquement rien n’a été dit sur la façon dont cette formaWLRQpWDLWHPSOR\pHWUDQVIRUPpHHWDGDSWpHDXSURFHVVXVGHWUDYDLOHIIHFWLI
au cours de la carrière professionnelle du travailleur. De ce point de vue,
dans les deux cas examinés, la documentation recueillie pour la sélection
des ouvriers constitue un matériel précieux.
%.3%)'.%-%.4 02/&%33)/..%, %4 3/#)!"),)4b
,%3 02/&),3 $%3 /562)%23 ,/-"!2$3 %. Sur les trois cent un ouvriers lombards qui présentent une demande,
deux cent quarante-deux déclarent appartenir à l’une des cent cinquante
associations ouvrières qui sont énumérées dans la source9/DTXDOLÀFDWLRQ
SURIHVVLRQQHOOHHVWpJDOHPHQWH[WUrPHPHQWYDULpHRQWURXYHSOXVGHFHQW
VRL[DQWHIRUPXODWLRQVGLIIpUHQWHVTXLUHQYRLHQWWRXWHIRLVjGHVTXDOLÀFDtions très semblables (par exemple, un peintre doreur à côté d’un doreur
sur verre, un photographe à côté d’un dessinateur photographe, un sculpteur sur bois à côté d’un graveur, etc.). Cette impression de grande dispersion et d’un tissu somme toute encore artisanal est partiellement corrigée
SDUO·H[DPHQGHVÀUPHVGHSURYHQDQFHVHXOVGL[QHXIWUDYDLOOHXUVGpFODrent travailler à leur compte ou à domicile ; d’autres disent appartenir à de
petites activités artisanales ou de services. Pour le reste, les ouvriers proviennent pour la plupart d’entreprises d’une certaine importance, dont
VRL[DQWHVRQWGpÀQLHVFRPPH©)LUPHªFLQTXDQWHVL[FRPPH©eWDEOLVVHPHQW ª HW WUHQWHGHX[ DYHF OH QRP GX SURSULpWDLUH GH O·HQWUHSULVH /D
majeure partie des travailleurs lombards semble exercer leur métier au
VHLQG·XQHVWUXFWXUHTXLUHQYRLHO·LPDJHG·XQHUpDOLWpPL[WHHQGpÀQLWLYH
plus industrielle qu’artisanale. Apparaît en effet une série d’entreprises
connues à Milan comme Tecnomasio, Stigler, Miani e Silvestri, Sonzogno, Treves, Salmoiraghi, Grondona, De AngeliHWG·DXWUHVÀUPHVVLPLODLUHV
Aux ouvriers lombards on ne demandait pas de préciser leur degré
d’instruction mais de présenter les titres professionnels qu’ils jugeaient
XWLOHVSRXUDSSX\HUOHXUGHPDQGH/HVGRFXPHQWVSUpVHQWpVQRXVEURVsent donc un tableau non seulement de la formation professionnelle, mais
aussi des expériences professionnelles et extra-professionnelles que les
RXYULHUVFRQFHYDLHQWFRPPHLPSRUWDQWHVSRXUOHXUTXDOLÀFDWLRQ/DYDULpWpGHVWLWUHVSUpVHQWpVHVWWUqVODUJHHOOHYDGHVDWWHVWDWLRQVGHUpFRPSHQVH
au mérite civil au fait d’avoir fait son service dans le corps des carabiniers,
,ES INFORMATIONS QUI SUIVENT SONT TIRmES DE L´mLABORATION ET DE L´ANALYSE QUE NOUS AVONS EFFECTUmES SUR LE COR
PUS DES DEMANDES PRmSENTmES PAR LES OUVRIERS MILANAIS !C-I %SPOSIZIONE E &IERE %SPOSIZIONE )NTERNAZIONALE
IN 0ARIGI ¯ $OMANDE D´AMMISSIONE DEGLI OPERAI CART # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES du rôle de volontaire joué dans la Croix-Rouge italienne à l’appartenance
à des associations comme celle des Reduci delle Patrie battaglie, les anciens
combattants des batailles patriotiques, et aux travaux effectués pour des
personnages très en vue professionnellement et socialement, comme des
architectes, des ingénieurs, des médecins, des maires etc.
Pour classer un univers aussi complexe et varié, nous avons isolé certaines catégories récurrentes. Malgré la gamme très large des expériences
réalisées, sur le plan de l’attestation formelle, la documentation considérée comme la plus probante par les travailleurs reste celle provenant des
entreprises ou des patrons pour lesquels ils travaillent ou à qui ils ont
IRXUQLXQVHUYLFH,OV·DJLWGHFHUWLÀFDWVGHWUDYDLOG·DWWHVWDWLRQVGHOHWWUHV
de recommandation, de déclarations de mérite, rédigés dans des formes
très variées. Dans l’ensemble, plus de la moitié des demandes présentées
FRPSRUWHQWGHVDWWHVWDWLRQVGHFHW\SH/·DWWHVWDWLRQG·DSSDUWHQDQFHjXQH
société ouvrière est jugée presque tout aussi utile, puisque 107 demandes
SUpVHQWHQWGHVWLWUHVMXVWLÀDQWO·DSSDUWHQDQFHjFHW\SHGHVRFLpWpV
Les travailleurs qui avaient déjà pris part à d’autres expositions, nationales, locales ou internationales constituaient une espèce de microcosme
jSDUW/HXUSDUWLFLSDWLRQQHVHUpVXPDLWSDVVHXOHPHQWjOHXUVpOHFWLRQ
elle s’accompagnait aussi très souvent de prix, de mentions honorables, de
médailles. Certains participants avaient même été exposants lors de précédentes expositions comme travailleurs à leur compte, recevant quelquefois
des prix ou des mentions pour leurs propres inventions, protégées parfois
par un brevet10 2Q D GRQF O·LPSUHVVLRQ TXH OHV JURXSHV G·RXYULHUV HQYR\pVDX[H[SRVLWLRQVpWDLHQWPDMRULWDLUHPHQWIRUPpVSDUGHVWUDYDLOOHXUV
TXL DYDLHQW GpMj HX FH W\SH G·H[SpULHQFH11. Sur trois cent un ouvriers,
VRL[DQWHKXLWSUpVHQWDLHQWHQHIIHWGHVWLWUHVGHFHJHQUHVRLWGXWRWDO
des demandes, et, plus important encore, parmi ces ouvriers, cinquanteQHXIVRQWÀQDOHPHQWVpOHFWLRQQpVSRXUOHYR\DJHj3DULVVRLWGXWRWDO
des élus. Si nous examinons les expositions locales et sectorielles – expoVLWLRQVW\SRJUDSKLTXHVH[SRVLWLRQVGHVDUWVLQGXVWULHOVRXH[SRVLWLRQVUpservées aux ouvriers – le tableau de la participation des travailleurs à des
IRUPHVGHUHFRQQDLVVDQFHSURIHVVLRQQHOOHKRQRULÀTXHVV·DYqUHpJDOHPHQW
#´mTAIT LE CAS DU TYPOGRAPHE IMPRIMEUR !NGELO 4ESTA EMPLOYm DE LA TYPOGRAPHIE "ERNARDONI DE # "ERDESCHINI
QUI g L´%XPOSITION OUVRInRE DE -ILAN EN AVAIT RElU UNE MENTION HONORABLE POUR SA ¦ PROPRE INVENTION §
)L ARRIVE FRmQUEMMENT QUE DES OUVRIERS ENVOYmS COMME OBSERVATEURS g UNE EXPOSITION PARTICIPENT g D´AUTRES
EXPOSITIONS COMME EXPOSANTS AVEC DES PRODUITS OU DES PROCmDmS TECHNIQUES ORIGINAUX FRUIT DE LEUR GmNIE ET
DE LEUR EXPmRIENCE PROFESSIONNELLE ,´IDmE QUE LES INVENTIONS NAISSENT DE L´EFFORT COLLECTIF D´UNE MULTITUDE DE
TRAVAILLEURS QUI CONTRIBUENT g CRmER LES CONDITIONS DANS LESQUELLES LES GRANDS INVENTEURS S´IMPOSENT AU PUBLIC
FAIT PARTIE INTmGRANTE DE LA CRITIQUE RADICALE DU MYTHE DE L´INVENTEURHmROS VOIR g CE PROPOS LES PAGES TRnS
SIGNI½CATIVES QUE #HRISTINE -AC,EOD CONSACRE g 4HOMAS (ODGSKIN LE PREMIER ANALYSTE g AVOIR PROPOSm UNE
CRITIQUE RADICALE DE L´HmROtSATION DES INVENTEURS NOTAMMENT DU CULTE DE *AMES 7ATT #HRISTINE -AC,EOD
(EROES OF INVENTION 4ECHNOLOGY LIBERALISM AND "RITISH IDENTITY #AMBRIDGE #AMBRIDGE 5NIVERSITY
0RESS P ET SUIVANTES
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA très vaste. Les distinctions par des prix récompensant l’expérience professionnelle sont dans l’absolu les plus répandues parmi les titres présentés.
Dans dix cas, on présente des titres délivrés par des académies, surtout
SDUO·$FDGpPLHUR\DOHGHVEHDX[DUWVGH0LODQHWSDUO·$FDGpPLHGH%UHUD
Dans quatre-vingt-quatorze autres cas, on atteste de titres professionnels
GH QDWXUH YDULpH GHV PpGDLOOHV G·RU G·DUJHQW GH EURQ]H HW GH FXLYUH
obtenues en fréquentant des cours du soir et professionnels comme les
cours de dessin technique ou géométrique, de composition d’orfèvrerie,
GH W\SRJUDSKLH MXVTX·DX[ SUL[ HW PHQWLRQV REWHQXV HQ IUpTXHQWDQW GHV
écoles techniques et d’arts appliqués à l’industrie comme l’École supérieure d’art, l’École théorique de la soie, l’École technique, la Société d’encouragement aux arts et métiers, l’École d’ornement et de composition,
d’architecture, l’École de perspective et de dessin technique, toutes celles
de la Reale Accademia di belle arti de Milan. Parfois, on relève des titres
GHSXEOLFDWLRQVF·HVWQRWDPPHQWOHFDVGH&RUUDGR6DODFRPSRVLWHXUW\pographe, qui présente son Manuel de composition typographique en cours
d’édition. Parmi les titres professionnels, on note aussi la fréquentation
de cours de langues étrangères. Le français est la langue la plus étudiée ;
OHV RXYULHUV TXL DIÀUPHQW OD FRQQDvWUH VRQW DX QRPEUH GH TXDWRU]H 8Q
ouvrier seulement déclare avoir fréquenté des cours d’allemand. Treize
ouvriers encore déclarent avoir rempli le rôle d’enseignant dans des écoles professionnelles, dix-huit avoir occupé des charges de direction dans
des associations mutualistes et trois présentent des attestations d’autres
autorités, en l’espèce du maire de la commune de provenance. Vingt-trois
GHPDQGHVHQÀQVRQWGpSRXUYXHVGHVWLWUHVUHTXLV
b#/,% %4 !4%,)%2 ,%3 /562)%23 &,/2%.4).3 %. /HVGHPDQGHVSUpVHQWpHVSDUOHVRXYULHUVÁRUHQWLQVV·pOqYHQWHQWRXWj
deux cent treize ; dans beaucoup manque la documentation relative au degré d’instruction ou à la formation professionnelle. Parmi les travailleurs
GRQW OHV DFWHV V·DFFRPSDJQHQW GH FHV SLqFHV SOXV GH GX WRWDO OH
titre d’instruction le plus courant est celui de la fréquentation, à différents
niveaux, de l’école élémentaire13. Cinquante-trois travailleurs, en effet, déclarent un titre d’enseignement primaire, vingt-huit d’entre eux ont ache
1UATREVINGTCINQ DEMANDES SONT ACCOMPAGNmES DE LA CERTI½CATION RELATIVE AU DEGRm D´INSTRUCTION LES
AUTRES SONT POUR LA PLUPART PRIVmES D´UNE TELLE CERTI½CATION PUISQUE CETTE DERNInRE FUT RETIRmE g L´mPOQUE g LA
½N DES PROCmDURES PAR LES INTmRESSmS EUXMoMES
,ES INFORMATIONS QUI SUIVENT SONT TIRmES DE L´mLABORATION ET DE L´ANALYSE QUE NOUS AVONS EFFECTUmES SUR LE COR
PUS DES DEMANDES PRmSENTmES PAR LES OUVRIERS ¾ORENTINS !RCHIVIO 3TORICO DEL #OMUNE DI &IRENZE PAR LA SUITE
!3#&I %SPOSIZIONE DI -ILANO #ERIMONIE &ESTEGGIAMENTI %SPOSIZIONI DOMANDE PRESENTATE DAGLI OPERAI
CART N€ # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES YpO·HQVHPEOHGHFHF\FOHREWHQDQWRXQRQOHFHUWLÀFDWG·pWXGHTXLQ]H
déclarent avoir fréquenté à des degrés divers les écoles techniques, mais
VHXOV FLQT RQW REWHQX OH FHUWLÀFDW ÀQDO 3DUPL OHV GHPDQGHV RQ VLJQDOH
aussi deux titres d’instruction supérieure et non technique, plus préciséPHQWXQEDFFDODXUpDWSUHPLHUF\FOHHWXQGLSO{PHGHO\FpHFODVVLTXH/HV
travailleurs qui déclarent un degré d’instruction quelconque sont en tout
TXDWUHYLQJWTXDWUH'·DXWUHVHQÀQGpFODUHQWXQWLWUHGHIRUPDWLRQREWHQX
dans les différents ordres d’écoles professionnelles, du soir, privées ou dirigées par des associations. Les travailleurs qui déclarent un degré d’expérience ou d’habileté technico-professionnelle se chiffrent à cent dix. Il
s’agit le plus souvent d’attestations relatives à la carrière professionnelle
précédente, à l’ancienneté du service prêté, dans certains cas à un long
apprentissage effectué au sein de l’établissement ou de la boutique paterQHOOH4XDUDQWHTXDWUHWUDYDLOOHXUVHQWRXWPHQWLRQQHQWFHW\SHGHFRPSpWHQFHFHODIDLWEHDXFRXSGDQVO·DEVROXPDLVPRLQVTXHFHTXHO·RQDXUDLW
pu attendre, étant donné que l’expérience et l’ancienneté professionnelles
FRQVWLWXHQWGHX[GHVSULQFLSDX[FULWqUHVGpÀQLVVDQWODÀJXUHGHO·RXYULHU
GHPpWLHUW\SLTXHGHODSHWLWHLQGXVWULHVHPLDUWLVDQDOHÁRUHQWLQH&HSKpQRPqQHV·H[SOLTXHSDUOHIDLWTX·XQHSDUWVLJQLÀFDWLYHGHWUDYDLOOHXUVSUpfère plutôt citer parmi ses titres l’appartenance à des associations professionnelles, territoriales, de secours mutuel et d’autres du même genre.
8QHSDUWLPSRUWDQWHGHWUDYDLOOHXUVSUpVHQWHGHVFHUWLÀFDWLRQVRXGHV
©UHFRPPDQGDWLRQVªGHODSDUWG·LQGXVWULHOV$VVH]QRPEUHX[GRX]HHQ
tout) sont ceux qui peuvent se vanter de prix, mentions ou brevets signalant une distinction technique et professionnelle particulière. Assez signiÀFDWLYH DXVVL HVW OD SDUW GH FHX[ TXL SUpVHQWHQW j GpIDXW G·DWWHVWDWLRQV
plus pertinentes, l’attestation de libération des classes ou la carte d’électeur, comme attestations d’un degré d’instruction général. Dans un cas,
on revendique même un titre de mérite qui fait référence à des valeurs
QDWLRQDOHVHWSDWULRWLTXHVLOV·DJLWGH*LXVHSSH$FFLOOLRXYULHUjO·XVLQH
Amatucci materiali per medicazione, où il construit personnellement des appareils pour la stérilisation, des fers chirurgicaux pour l’hôpital militaire.
&HOXLFLGpFODUHFRPPHWLWUHGHPpULWHrWUHOH©ÀOVG·$QWRQLRTXLDSSDUWLQW
DXe 5pJLPHQWG·LQIDQWHULHTXLHXWODJORLUHGHVHEDWWUHHQj9LOODIUDQFDIDLVDQWSDUWLHGXIDPHX[EDWDLOORQFDUUpG·+XPEHUWGH6DYRLHª
/HVLQVWLWXWVRpWDLHQWIRUPpVOHVWUDYDLOOHXUVÁRUHQWLQVpWDLHQWWUqVYDriés ; les écoles instituées par des associations, des institutions religieuses
RXÀQDQFpHVSDUGHVFRPLWpVGHELHQIDLVDQFHODwFVRXFDWKROLTXHVMRXDLHQW
un rôle particulièrement important. Parmi les cours les plus fréquentés, en
HIIHWLO\DYDLWFHX[GHV6FXROH3LHÀRUHQWLQH, ceux du Pio istituto Demidoff et
$EMANDE DE L´OUVRIER 'IUSEPPE !CCILLI IBID
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA des Scuole del Popolo Pietro DazziFHVGHUQLqUHVpWDQWQRWRLUHPHQWÀQDQFpHV
par la franc-maçonnerie locale. Les cours du soir enregistraient aussi un
certain succès, en particulier ceux des écoles populaires portant le nom de
*LQR&DSSRQLLO\DYDLWDXVVLXQHJUDQGHYDULpWpG·pFROHVWUqVVSpFLDOLVpHV
comme l’institut sténographique toscan, ou à l’enseignement plus général
comme l’école du soir et dominicale d’arts et métiers d’Arezzo, ou encore
les écoles du soir de dessin et de matières techniques.
Toutefois, au-delà des attestations formelles, c’est la pratique qui
comptait pour beaucoup de travailleurs. L’un d’eux ne présenta aucun
FHUWLÀFDWjODFRPPLVVLRQGpFODUDQWTX·LOQHYR\DLWSDVjTXRLSRXYDLHQW
ELHQVHUYLUFHV©VRXYHQLUVG·HQIDQFHMDXQLVª&HUHIXVG·REWHPSpUHUDX[
prescriptions de la bureaucratie communale exprimait l’orgueil du métier
GXWUDYDLOOHXUDUWLVDQTXDOLÀpSRXUTXLODFXOWXUHWHFKQLTXHHWOHVDYRLU
professionnel effectif s’acquéraient aussi et surtout par la pratique du travail, par le long apprentissage (qui était proposé comme titre professionnel) et éventuellement par la formation continue et complémentaire, dans
les écoles du soir et professionnelles, dans les associations, dans le réseau
serré d’institutions prévues à cet effet dans les différents contextes locaux,
TXLSRXYDLHQWDPHQHUOHWUDYDLOOHXUjGHYHQLUXQRXYULHU©TXDOLÀpª
,%3 3!6/)23 /562)%23 ª ,´b02%56% $% ,´%80/3)4)/.
Mais quel impact la technologie, présente dans toute sa modernité spectaculaire, avait-elle sur ces ouvriers et sur leur culture professionnelle ?
Ces travailleurs avaient cessé depuis longtemps d’être les dépositaires d’un métier traditionnel et immobile. Les transformations rapides des
secteurs commerciaux et l’introduction de fabrications en petites séries
pour les produits de luxe ont porté à un fort renouveau certains procesVXV SURGXFWLIV HW OHV WHFKQRORJLHV V·\ UDSSRUWDQW (Q YHUWX GH FHV FKDQgements, la petite production exprimait elle aussi un degré d’adhérence
'ILDO 6ALEGGIA 3TORIA DELLA LOGGIA MASSONICA ½ORENTINA LA #ONCORDIA &LORENCE &ORNI %D P VOIR AUSSI !NNA 0ELLEGRINO ¦ $ALL´5NITg A &INE /TTOCENTO LA PRESENZA MASSONICA FRA UMANITARISMO E ANTICLE
RICALISMO § DANS &ULVIO #ONTI DIR ,A MASSONERIA A &IRENZE $ALL´ETg DEI ,UMI AL SECONDO .OVECENTO "OLOGNE IL
-ULINO P 0OUR UNE ANALYSE THmORIQUE DU CONCEPT DE TECHNOLOGIE AU XIXE SInCLE ,ILIANE (ILAIRE0mREZ ,A PInCE ET LE GES
TE %NTREPRISES CULTURES OPmRATOIRES ET MARCHmS g ,ONDRES AU XVIIIE SInCLE MmMOIRE INmDIT EN VUE DE L´HABILITATION
g DIRIGER LES RECHERCHES DE L´UNIVERSITm 0ARIS )0ANTHmON3ORBONNE SOUS LA DIRECTION DE $OMINIQUE -ARGAIRAZ
DmCEMBRE EN PARTICULIER ¦ ,A RATIONALITm TECHNOLOGIQUE ENTRE mCONOMIE INDUSTRIELLE ET mCONOMIE DU
PRODUIT § P PLUS GmNmRALEMENT SUR LE ¦ COMMENCEMENT § DE L´USAGE DU TERME SUR LA Dm½NITION DU
CONCEPT ET SUR L´ENTRmE DE LA DISCIPLINE DANS L´UNIVERS SCIENTI½QUE *ACQUES 'UILLERME ET *AN 3EBESTIK ¦ ,ES
COMMENCEMENTS DE LA TECHNOLOGIE § DANS 4HALnS XII P RmmDITm DANS $OCUMENTS POUR L´HISTOIRE DES
TECHNIQUES P LES RmSULTATS LES PLUS RmCENTS DE CETTE RECHERCHE ONT mTm PUBLImS DANS UN ARTICLE
EN ITALIEN *ACQUES 'UILLERME ET *AN 3EBESTIK ¦ 'LI INIZI DELLA TECNOLOGIA § DANS 3TORIA DEL DISEGNO INDUSTRIALE
-ILAN %LECTA P # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES HWGHUpDFWLYLWpjO·LQQRYDWLRQSDUIRLVPrPHSOXVÁH[LEOHHWUDSLGHGDQV
l’adaptation que la production de masse ; tout ceci impliquait l’accroissePHQWGHVFXOWXUHVGHVVDYRLUVVSpFLÀTXHVHWGHVFRQQDLVVDQFHVWHFKQLTXHV
et professionnelles17.
'HWHOOHVFRPSpWHQFHVVHUHWURXYHQWWUqVODUJHPHQWGDQVOHVÀJXUHVGH
QRV©RXYULHUVªeYLGHPPHQWOHVDYRLUWHFKQLTXHQ·HVWSDVO·DSDQDJHH[clusif des entrepreneurs, des techniciens spécialisés ou des procédés de proGXFWLRQ©LQJpQLHULVpVªFHFLSHUPHWGHQXDQFHUODWURSQHWWHRSSRVLWLRQ
que l’on est parfois tenté de faire entre les deux réalités socio-économiques
considérées et de montrer que la capitale lombarde se caractérisait également par des processus productifs où étaient présents à la fois des éléments
GH©PRGHUQLWpªHWXQHIRUWHSHUVLVWDQFHGHODFXOWXUHGXPpWLHU
Dans les deux cas, ces parcours conduisent à une destination qui représente le sommet de la technologie du moment. De même que pour
les Florentins Milan est la capitale industrielle de l’Italie, « la ville la plus
YLOOHG·,WDOLHªSRXUOHV0LODQDLV3DULVHVWODFDSLWDOHGHODPRGHUQLWpHQ
Europe ; ces deux parcours sont chargés d’attentes et d’émotions. L’étonnement et l’émerveillement sont cependant le substrat, la base expérientielle sur laquelle les travailleurs greffent toute une série de jugements
attentifs, circonstanciés, parfois ouvertement critiques, qui permettent
d’évaluer la distance et l’examen critique qu’ils appliquent à la grande
quantité d’informations et de connaissances nouvelles rencontrées, sur la
base des compétences, des savoirs, des cultures hérités de leur travail. Il
n’est pas facile de tirer des conclusions généralisables d’un ensemble de
WH[WHVLQGLYLGXHOVUpGLJpVDYHFGHVFULWqUHVHWGHVVW\OHVWUqVSHUVRQQHOVLO
H[LVWHWRXWHIRLVXQIRQGFRPPXQSRXUOHV)ORUHQWLQVODFRPSDUDLVRQVH
fait surtout entre les technologies industrielles plus avancées et celles plus
traditionnelles soutenues par le métier et par l’habileté personnelle de
l’ouvrier. Rentrent aussi en jeu des éléments en quelque sorte extérieurs
au facteur technique au sens strict, comme ceux liés à la mode et au goût,
aux données du marché ou d’ordre économique et organisationnel. Dans
le cas des Milanais, la comparaison est plus technique, elle se meut dans
des ordres de grandeur de plus grande échelle (la production italienne
IDFHjFHOOHGHVSD\VpWUDQJHUVHWODWKpPDWLTXHFHQWUDOHVHPEOHrWUHFHOOH
de la formation professionnelle.
#F #HARLES & 3ABEL ET *ONATHAN :EITLIN 3TORIES STRATEGIES STRUCTURES RETHINKING HISTORICAL ALTERNATIVES TO MASS
PRODUCTION DANS #HARLES & 3ABEL ET *ONATHAN :EITLIN 7ORLD OF 0OSSIBILITIES &LEXIBILITY AND -ASS 0RODUCTION IN
7ESTERN )NDUSTRIALIZATION 0ARIS #AMBRIDGE -3(#50 P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA -b4)%2 %4 ./56%,,%3 4%#(./,/')%3 ,%3 &,/2%.4).3 ª -),!.
'DQV OH FDV GHV RXYULHUV ÁRUHQWLQV OHV DYLV OHV SOXV VpULHX[ WHFKQLTXHPHQW SURYLHQQHQW GH OD FRPSRVDQWH SOXV QRPEUHXVH HW TXDOLÀpH GX
JURXSHOHVW\SRJUDSKHV&HX[FLH[SULPHQWGHGLYHUVHVPDQLqUHVODGLVtance entre leurs compétences, leur façon traditionnelle de travailler et les
nouveautés technologiques vues à l’exposition. Les jugements se révèlent
critiques mais techniquement appropriés, même devant des machines de
FRQVWUXFWLRQWUqVUpFHQWHFRPPHSDUH[HPSOHOD0RQRF\OHWWHGHOD0DLVRQ
/DPEHUW&RGH3DULV&HWWHPDFKLQH
« […] impression en deux couleurs, a deux plans réglables pour la presVLRQTXLIRQFWLRQQHQWO·XQDSUqVO·DXWUHFKDFXQOHXUWRXUOHF\OLQGUHHVWRVcillant, soutenu par deux petits côtés qui glissent sur des guides, est muni
d’un engrenage crémaillère des deux côtés [...] Je relève tout de suite que la
FRQVWUXFWLRQGHFHWWHPDFKLQHHVWIDLEOHFDUHOOHFRPSUHQGXQHLQÀQLWpGH
petits mécanismes avec des combinaisons quelque peu défectueuses18ª
Il arrive que l’outillage exposé soit en retard par rapport au progrès
technologique en cours ; l’opinion de Cesare Puliti sur les machines à imSULPHUHVWHQFHVHQVHPEOpPDWLTXH
©>«@M·DLHXO·RFFDVLRQGHYRLUGLIIpUHQWVV\VWqPHVGHPDFKLQHVPDLVMH
le dis tout de suite, pas de nouveautés absolues [...] une machine à impriPHUHQW\SRJUDSKLHDYHFXQV\VWqPHQRXYHDXIDEULTXpVSpFLDOHPHQWSRXU
l’exposition je ne l’ai pas trouvée19ª
Dans certains cas, le jugement technique peut s’étendre de la propre comSpWHQFHSURIHVVLRQQHOOHVSpFLÀTXHjGHVGRPDLQHVLPPpGLDWHPHQWOLPLWURSKHV /H W\SRJUDSKH FRPSRVLWHXU *XJOLHOPR %DUFDOL DSUqV DYRLU DQDO\Vp
les machines de sa compétence, se lance dans des considérations critiques
VXUGHVPDFKLQHVXWLOLVpHVGDQVG·DXWUHVEUDQFKHVGHVDSURIHVVLRQ
« ... je ne peux cependant m’empêcher de parler des machines à imprimer, même si mes amis imprimeurs en parleront avec plus de comSpWHQFHHWGHPDvWULVH2Q\H[SRVHXQHPDFKLQHDSSHOpH-RKDQQLVEHUJ
avec un margeur automatique Dux qui non seulement se passe du jeune
homme qui met la feuille, mais qui a un mérite [...] si dans le papier qui
doit être imprimé se trouve une feuille abîmée la machine s’arrête instantanémentª
Exprimer un jugement sur les nouveautés exposées n’est pas un processus automatique ; cela implique une acquisition rapide de la propriété
2ELAZIONE DI 0ULITI #ESARE COMPOSITORE TIPOGRAFO !3#&I %XPOSITION DE -ILAN CART N )BID
2ELAZIONE SULL´%SPOSIZIONE DI -ILANO DI 'UGLIELMO "ARCALI IBID
# DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES et des caractéristiques des outillages en exposition. Les ouvriers se plaignent souvent dans leurs écrits de la carence de guides. Ils se trouvent
ainsi parfois dans l’obligation de chercher seuls des explications, à travers
XQHUpÁH[LRQUpYpODWULFHGHOHXUFDSDFLWpjUHOLHUFRPSpWHQFHVHWFRQQDLVVDQFHV/HJUDYHXU*LQR&DOYHWWLSDUH[HPSOHGHYDQWXQPpWLHUjWLVVHU
©WRXWÀOWRXWHFDQHWWHSOHLQGHEDJXHWWHVG·DFLHUSRXUODIDEULFDWLRQGHV
WDSLVVHULHVªHVVD\HVHXOG·HQLPDJLQHUOHPpFDQLVPH
« Je suis resté satisfait par une explication que […] je me suis donnée à
moi-même et je n’ai ainsi importuné personne pour des éclaircissements. Ce
métier à tisser doit fonctionner, je crois, comme un harmonium, à ceci près
que ce carton perforé est plus compliqué que celui de ces instruments musicaux et qu’au lieu de correspondre à des cordes harmoniques il met en mouvement, à son passage, des engins qui, avec une précision mathématique,
ERXJHQWWHOÀOGHWHOOHFRXOHXUHWSOXW{WTX·XQVRQIRUPHQWXQGHVVLQª
Ce processus va jusqu’à l’expression de doutes sur l’authenticité des
produits exposés, ce qui révèle comment les savoirs traditionnels du métier sont mis en situation de crise par une technologie qui parvient à rivaliser avec les produits artisanaux au point de tromper l’œil expert de
l’ouvrier. Ainsi, dans le pavillon de l’art décoratif français, en face d’une
VDOOH©pFODLUpHHQRUVW\OH/RXLV;9,ªXQERQVFXOSWHXUpPHWGHVUpVHUYHV
VXUO·RULJLQDOLWpGHFHUWDLQVREMHWV
« Je n’hésite pas un instant à avancer des doutes sur l’authenticité de
la sculpture d’un fauteuil élégant et compliqué qui, vu l’égalité parfaite
de certains boutons, paraît formé de cette composition avec laquelle en
France on supplée et on suppléera la sculpture. Je le répète, tout ceci me
laisse dans le doute, qui pourrait être infondé, mais que je n’ai pas pu ni
YRXOXFDFKHU&HUWHVOHSUL[GHFHIDXWHXLOWUDYDLOOpDXVVLGHUULqUHOLres), voudrait qu’il fût entailléª
Les compétences et les savoirs ouvriers ne sont pas uniquement liés à
ODWHFKQRORJLH/HVDSSUpFLDWLRQVFRQFHUQHQWDXVVLOHVW\OHOHGHVVLQODÀnition des produits et leur conformité avec le goût et la mode. Cela semble
DVVH]QDWXUHOVLO·RQSHQVHDXU{OHGHV©DUWVLQGXVWULHOVªGDQVOHVH[SRVLWLRQVHWjODIRUWHVLJQLÀFDWLRQGHO·pGXFDWLRQDXJR€WHWDXEHDXTXHFHV
PDQLIHVWDWLRQVRQWHXGHSXLVOHXUVRULJLQHV1RPEUHX[VRQWOHVFDVROHV
WUDYDLOOHXUVÁRUHQWLQVpPHWWHQWGHVUpVHUYHVVXUODSUpVHQWDWLRQODFRPSRVLWLRQODYDOHXUHVWKpWLTXHGHVSURGXLWVSUpVHQWpV
« À gauche de la salle en question se trouve le mobilier pour un salon
exécuté de façon assez moderne, dans ce salon l’ingénieur Leone Smaiers
2ELAZIONE DELL´OPERAIOINTAGLIATORE 'INO #ALVETTI IBID
)BID
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA a voulu et entendu corriger ou déplacer la ligne et trouver une ligne nouYHOOHYpULWDEOHFRPPHLOOHPRQWUHGDQVO·H[SRVLWLRQGHFHVDORQ>@DÀQ
de le rendre encore plus harmonieux dans l’ensemble, il a voulu commencer à construire les murs pour lui donner la grandeur et la juste proportion que requièrent ces meubles, il a dessiné et fait faire les vitres pour les
fenêtres et même les tapis qui doivent aller dans la salle en question ; ceci
GHYUDLWrWUHGHUqJOHSRXUWRXWHVOHVVDOOHVGHWRXVOHVVW\OHVHWO·RQYRLW
au contraire dans beaucoup qui existent aussi à Florence […] un mobilier
G·XQFHUWDLQW\SHXQDXWUHGLIIpUHQWHWODGpFRUDWLRQGHODSLqFHG·XQDXWUH
VW\OHHQFRUHFKRVHTXLV·DFFRUGHWUqVPDOª
Les compétences et les capacités de jugement vont encore plus loin.
Beaucoup de travailleurs expriment des opinions circonstanciées et préFLVHVGXSRLQWGHYXHpFRQRPLTXH,OVXIÀWGHYRLUSDUH[HPSOHFRPPH
le même Arturo Berni juge les travaux exposés dans la section de l’art
GpFRUDWLIIUDQoDLV
©8QHWUqVEHOOHKRUORJHjSHQGXOH>@G·XQHYDOHXUWRWDOHGH…
le temps consommé pour faire le travail en question, en rassemblant ébéniste, bronzeur, ciseleur, marqueteur et horloger réunis en un seul ouvrier
SHQGDQWWURLVDQVOHERvWLHUSRXUODPXVLTXHVDYDOHXUVHPRQWHj…
[…]. Mais je dois le répéter, ces chiffres me semblent assez élevés [...] l’horORJH R O·RQ FRQVLGqUH TX·LO \ D WURLV DQV GH WUDYDLO G·XQH SHUVRQQH HQ
admettant que l’ouvrier du ciseleur à l’ébéniste parvienne à gagner en
PR\HQQH … SDU MRXU FRQVLGpUp MRXUV GH WUDYDLO SDU DQ V·pOqYH j
… PXOWLSOLp SDU WURLV DQV VRLW … HQ DGPHWWDQW TX·LO VRLW SOXV
IDFLOHTXHOHPRQWDQWMRXUQDOLHUGHODSD\HVRLWPRLQGUHSOXW{WTXHVXSpULHXUGRQFWRXWFRPSWHIDLWLOUHVWHUDLW…SRXUOHVGpSHQVHVFHTXL
me semble, selon ma façon de voir, des prix assez élevés.
/·pEpQLVWH ÁRUHQWLQ HVW HQ PHVXUH G·HVWLPHU QRQ VHXOHPHQW OD YDOHXU
technique et esthétique des produits, mais aussi les éléments relatifs au
SUL[DX[FR€WVGHODPDLQG·±XYUHHWGHVPDWLqUHVSUHPLqUHVXQH[DPHQ
FULWLTXHTXLGpPRQWUHXQHFDSDFLWpG·DQDO\VHVHPEODEOHjFHOOHG·XQHQWUHpreneur, d’un maître artisan, d’un propriétaire de boutique. Dans beaucoup de cas, ces travailleurs artisans, habiles, spécialisés, parfois étonnamPHQW FXOWLYpV j QRV \HX[ RQW j O·pYLGHQFH GX PDO j VH SRVLWLRQQHU SDU
UDSSRUWDXPRQGHGHODFXOWXUHWHFKQLTXHHWVFLHQWLÀTXH©KDXWHªTXLHVW
exposée en ces occasions et qui représente le sommet de la technologie
HWGXVDYRLUWHFKQLFRVFLHQWLÀTXHGHO·pSRTXH,OVWHQWHQWGHVHSUpVHQWHU
comme d’humbles travailleurs manuels, mettant dans leurs rapports des
2ELAZIONE DELL´OPERAIOSTIPETTAIO "ERNI !RTURO IBID
# DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES IRUPXODWLRQVUKpWRULTXHVSOXVRXPRLQVVWpUpRW\SpHVTXLFRQWLHQQHQWOHXU
©SURIHVVLRQGHPRGHVWLHª/HVDIÀUPDWLRQVTXLVXLYHQWVRQWW\SLTXHVGH
FHWWHIDoRQGHIDLUH
« […] en tenant compte du fait que je suis un simple ouvrier et que je passe la majeure partie de mes heures occupé dans mon travail ; ils ne pourront
donc pas s’attendre à de grandes et belles choses de ma plume […]ª
« […] mère nature a été ma marraine et ne me permit pas, pauvre paria
du travail, de m’élever à la hauteur de pouvoir comprendre et narrer lucidement toutes les beautés artistiques, les hardiesses du cerveau humain,
les conquêtes de la Science, les triomphes de la mécanique dans chaque
branche des industries et du savoir, qui dans cette exposition mondiale se
VRQWSXLVVDPPHQWUpYpOpVHWDIÀUPpVª
En réalité, le niveau de considération et de conscience de soi des
RXYULHUVÁRUHQWLQVHVWFHUWDLQHPHQWVXSpULHXU7RXWG·DERUGLOVGpFODUHQW
ouvertement être les héritiers quand bien même lointains, quand bien
même simples exécutants et imitateurs, du grand art de la Renaissance,
dont ils réclament les contenus esthétiques et formels, avec un orgueil
SOXVRXPRLQVYRLOpFRPPHXQpOpPHQWHVVHQWLHOGXSD\VDJHSK\VLTXHHW
PHQWDORLOVWUDYDLOOHQWTXRWLGLHQQHPHQW
« Pour en revenir à la ligne nouvelle de Monsieur Leone Smaier il ne
faut pas cacher que c’est une chose belle et originale, mais comme habitant
de Florence où j’ai grandi, où il existe et a existé l’art véritable, il ne faut
SDVFRQIRQGUHODOLJQHGH6QDLHUVRXGHVW\OH/LEHUW\DYHFODQ{WUHGX[YH
ou du XVIeXQVW\OHSXUTX·LOVQ·DWWHLQGURQWMDPDLVª
,%3 -),!.!)3 ª 0!2)3 ,! #/-0!2!)3/. !6%# ,! 02/$5#4)/.
b42!.'È2% %4 ,%3 4(È-%3 $% ,! &/2-!4)/. 02/&%33)/..%,,%
À première vue, le ton des écrits des travailleurs lombards semble senVLEOHPHQWGLIIpUHQW/·pOpPHQWOHSOXVYR\DQWYLVLEOHDXVVLGDQVODIRUPH
extérieure de leurs écrits, est donné par l’accent nettement plus technique
de leurs comptes rendus. Prévaut en général un sentiment de déception,
ou la tentative de comparer et d’évaluer le niveau de l’industrie italienne
par rapport à l’industrie internationale, clairement et incontestablement
plus avancée.
2ELAZIONE DELL´OPERAIO ARMAIOLO !RTURO 3IMONCINI IBID
2ELAZIONE DELL´OPERAIO TIPOGRAFO &ERDINANDO #IOLINI IBID
2ELAZIONE DELL´OPERAIOSTIPETTAIO "ERNI !RTURO IBID
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA /·DYDQFH GHV DXWUHV SD\V HW VXUWRXW GH OD )UDQFH SD\V G·DFFXHLO HVW
cependant vue en termes positifs, comme quelque chose à suivre et à
concurrencer. La confrontation entre les différentes réalités nationales
pousse aussi les ouvriers lombards à des observations de caractère écoQRPLFRRUJDQLVDWLRQQHO$LQVLO·RXYULHUGHÀODWXUHHWEURGHULHHQRUHWDUgent Romeo Mazzola, en plus de dresser un tableau critique sur les raisons
de la supériorité des Français, avance des théories sur la façon dont l’Italie
SHXWDUULYHUjXQpWDWSOXVDYDQFp
« […] la visite à l’exposition de Paris m’a persuadé encore une fois que
seuls les Français traitent sur une grande échelle l’industrie à laquelle je
consacre mes pauvres forces. […] je crois être dans le vrai quand je dis que
le facteur principal de cette suprématie réside dans la production consiGpUDEOHHWVRLJQpHGHÀOVHQRUHQDUJHQWHWHQFXLYUH>«@(WMHSHQVHTXH
si en Italie on constituait par des actions le capital nécessaire au développement de cette branche industrielle, cela serait un grand avantage pour
l’économie nationaleª
/H OLWKRJUDSKH (UDVPR +HUGHQEHUJ YLVLWDQW O·pWDEOLVVHPHQW OLWKRJUDphique de Monsieur Lemercier, « le plus ancien de France et peut-être du
PRQGH ª VH ODQFH TXDQW j OXL GDQV GHV FRQVLGpUDWLRQV VXU FHUWDLQV SURcédés de fabrication utilisés dans l’usine, les jugeant meilleurs que ceux
utilisés dans les établissements italiens, avec une compétence technique
SOXW{WpOHYpH
©1RXVDYRQVHXXQHGLVFXVVLRQDLPDEOHVXUODIDoRQGHUHSURGXLUHGHV
dessins au pastel sur la pierre [...] Chez nous cette opération se fait sur une
pierre lisse c’est-à-dire polie à la perfection. Chez Lemercier, elle se fait au
FRQWUDLUHVXUXQHSLHUUHJUHQXHPDLVG·XQJUDLQWUqVÀQ1RVRXYULHUVYHXlent avoir raison et feront des expériences. Il me semble au contraire que la
méthode française est meilleure car avec la pierre lisse le travail s’empâte
plus facilement qu’avec la pierre grenue et ceci fut aussi démontré par ces
mêmes imprimeurs qu’après 3000 tirages le travail est net et frais comme
s’il s’agissait de la première copieª
Il émerge de ces écrits une conscience de la supériorité étrangère qui
GRQQHOLHXjXQHVSULWG·pPXODWLRQ/HPpWLHUODTXDOLÀFDWLRQGHO·RXYULHU
restent toutefois des points de référence impératifs. De fait, les observations sur la situation économique italienne portent à souligner la nécessité d’une formation professionnelle mieux organisée, vue et préconisée
FRPPHXQPR\HQSRXUDPpOLRUHUOHVSURGXLWVGHO·LQGXVWULHQDWLRQDOH/HV
observations critiques et les jugements, qui permettent d’évaluer le de
2ELAZIONE DELL´OPERAIO IN ½LATI PASSAMANERIA E RICAMI -AZZOLA 2OMEO ALL´%SPOSIZIONE DI 0ARIGI IN !C-I
%SPOSIZIONI E &IERE %SPOSIZIONE )NTERNAZIONALE IN 0ARIGI ¯ 2ELAZIONI DEGLI OPERAI VISITATORI CART ,´ARTE LITOGRA½CA ALL´%SPOSIZIONE INTERNAZIONALE DI 0ARIGI NEL ¯ 2ELAZIONE DI %RASMO (ARDENBERG IVI CART # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES gré d’interaction entre la culture professionnelle possédée et les nouveautés accueillies au cours de l’exposition, s’orientent très souvent vers des
questions telles que la formation professionnelle et le problème des écoles
WHFKQLTXHV&RPPHO·DIÀUPHO·RXYULHU(QHD6HPHQ]Dj3DULVHQFH
qui manque aux travailleurs italiens ce n’est pas la bonne volonté mais le
©PR\HQGHV·LQVWUXLUHª
©1RXVPDQTXRQVGHWUDLWpVERQVHWPRGHUQHVWUDGXLWVHQODQJXHLWDlienne, parce que ce serait trop que d’exiger de certains ouvriers adultes
G·pWXGLHUOHIUDQoDLVRXO·DOOHPDQGSRXUSRXYRLUOHVpWXGLHU1RXVDYRQVLO
est vrai la Société d’encouragement aux arts et métiers qui est une très belle
LQVWLWXWLRQPDLVOHFHUFOHGHVOHoRQVTXLV·\IRQWHVWTXHOTXHSHXUHVWUHLQW
[…] à Paris, au contraire, il existe depuis très longtemps le Palais des arts
et métiers où chaque art est largement représenté dans ses produits, où
en présence des travailleurs se tiennent continuellement des conférences
théoriques alternées de démonstrations des différents procédés de fabriFDWLRQRXHQÀQXQRXYULHUTXLFRQoRLWXQHLQYHQWLRQRXXQHLQQRYDWLRQ
HVWDSSX\pSDUWRXVOHVPR\HQVSRXUPHWWUHHQSUDWLTXHVRQLGpHGDQVOH
palais lui-mêmeª
Ce défaut d’écoles est nettement ressenti comme un besoin national
SDUOHWDLOOHXU(VDQWR%LDQFKL
©'HVGRQQpHVTXHM·DLSXUHWLUHUGHOD&KDPEUHV\QGLFDOHGHV7DLOOHXUV
de Paris, je me suis convaincu que les tailleurs d’Italie n’ont jusqu’à présent pas compris que l’art a besoin d’une réforme radicale. Pour ce faire, il
faut primo l’unité de pensée et secundo que naisse en Italie [...] une école
de Coupe et Confection où la jeunesse puisse croître dans l’idéal de l’unité
et de l’art [...]. Convaincu qu’une nation, pour être forte à l’intérieur et
respectée à l’extérieur, ait besoin d’une instruction sage et pondérée, je fais
vœux pour que s’accomplisse ce suprême et urgent besoin national30ª
Un autre point sur lequel il est possible de noter une différence sensiEOHHQWUHOHVGHX[JURXSHVDQDO\VpVUpVLGHGDQVOHIDLWTXHWDQGLVTXHOHV
RXYULHUVÁRUHQWLQVMXJHQWOHVRXYULHUVSUpSRVpVDX[QRXYHOOHVIDEULFDWLRQV
©UDSLGHVPDLVSDVERQVªFULWLTXDQWHQIDLWODdilution of labor, la parcellisation du travail en plusieurs phases séparées qui rend l’exécution plus
rapide mais moins soignée, les Milanais au contraire aspirent à une plus
grande division du travail, critiquant l’habitude italienne de couvrir avec
OD VHXOH ÀJXUH GH O·RXYULHU DUWLVDQ OHV GLIIpUHQWHV SKDVHV GH SURGXFWLRQ
2ELAZIONE DI %NEA 3EMENZA IN %SPOSIZIONE )NTERNAZIONALE DI 0ARIGI IVI CART 2ELAZIONE DELL´%SPOSIZIONE 5NIVERSALE DI 0ARIGI ¯ !NNO SU QUANTO RIGUARDA L´ARTE DEL SARTO 2ELAZIONE DI
"IANCHI %SANTO SARTO IVI CART 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA selon les nécessités et non selon un plan établi de répartition des tâches et
GHVH[pFXWLRQV
« La perfection du travail donc [est donnée] par l’exécution soignée
en toute circonstance […] il est bien vrai qu’en France et en Allemagne
l’ouvrier, en général, se consacre spécialement et presque exclusivement à
XQHVHXOHFKRVHGHVRUWHTX·LO\DGHVPDFKLQLVWHVHWGHVSUHVVLHUVTXLLPSULment continuellement certaines couleurs et qui, parce que voués toujours
à la même opération, peuvent acquérir une pratique spéciale et avoir une
FRQQDLVVDQFHSDUIDLWHGHVGLIÀFXOWpVG·XQHPDWLqUHGRQQpHDORUVTXHFKH]
QRXVO·RXYULHUGRLWIDLUHXQSHXGHWRXWHWSOXVHQFRUHDYHFGHVPR\HQVWURS
économiques, c’est-à-dire non aptes à un résultat de travail parfait31ª
Les formes de conscience de soi qui, dans le cas des Florentins, passent
par le renvoi à la tradition et au contexte où se situent les « arts indusWULHOVªV·H[SULPHQWGDQVOHFDVPLODQDLVSDUXQHIRUPHG·©DSSURSULDWLRQª
de la technique qui est donnée par la reproduction soignée – extrêmement
fréquente dans leurs comptes rendus – des dessins de machines, d’appareils, de mécanismes, d’éléments qui n’apparaissent qu’une seule fois et
VRXVXQHIRUPHDSSUR[LPDWLYHGDQVOHVFRPSWHVUHQGXVÁRUHQWLQV,OV·DJLW
pYLGHPPHQWG·XQWpPRLJQDJHGHVDYRLUSURIHVVLRQQHOVSpFLÀTXHGLUHFWHW
évident, mais aussi d’une autre forme d’expression de ces savoirs.
,O IDXW QRWHU HQÀQ TXH OHV RXYULHUV ORPEDUGV Q·DIIURQWHQW SUHVTXH MDmais la thématique de la machine comme ennemie potentielle de l’emSORL OHV DFFHQWV j GHPLPRW OXGGLWHV SUpVHQWV GDQV OHV pFULWV ÁRUHQWLQV
sont pratiquement absents des écrits des ouvriers milanais. Des comptes
rendus transparaît – voire est revendiqué comme l’un des aspects plus
SRVLWLIVGXSURJUqV²OHFRQÁLWREMHFWLIGHODFRQFXUUHQFHPDWpULHOOHHQWUH
les machines et le monde du travail. Les machines manifestent clairement leur capacité à éroder et absorber les espaces jusque-là réservés à la
dextérité du travail manuel, amenant donc un chômage technologique,
attaquant l’existence même du travail dans ses formes traditionnelles.
2ELAZIONE DI ,EOPARDI %NRICO ,ITOGRAFO $ISEGNATORE SULL´ARTE DELLA LITOGRA½A E DEI PROCESSI ATTINENTI IVI !TTI DEL
#OMITATO CART 3UR LE RAPPORT DES OUVRIERS AUX MACHINES AU XIXE SInCLE -AXINE "ERG 4HE MACHINERY QUESTION AND THE MA
KING OF POLITICAL ECONOMY #AMBRIDGE #AMBRIDGE UNIVERSITY PRESS !NDREW :IMMERMAN ¦ 4HE
IDEOLOGY OF THE MACHINE AND THE SPIRIT OF THE FACTORY REMARK ON "ABBAGE AND 5RE § DANS #ULTURAL CRITIQUE
P #HRISTINE -AC,EOD (EROES OF INVENTION¨ OP CIT 6INCENT "OURDEAU &RANlOIS *ARRIGE *ULIEN
6INCENT ,ES ,UDDITES "RIS DE MACHINES mCONOMIE POLITIQUE ET HISTOIRE -AISON!LFORT bDITIONS ÈRE POUR
LE CAS FRANlAIS -ICHELLE 0ERROT ¦ ,ES OUVRIERS ET LES MACHINES EN &RANCE DANS LA PREMInRE MOITIm DU XIXE SIn
CLE § DANS ,E SOLDAT DU TRAVAIL SEPTEMBRE P &RANlOIS *ARRIGE ¦ ,ES OUVRIERS PARISIENS ET
LA QUESTION DES MACHINES AU DmBUT DE LA MONARCHIE DE *UILLET § DANS 0ATRICK (ARISMENDY DIR ,A &RANCE DES
ANNmES ET L´ESPRIT DE RmFORME 2ENNES 0RESSES UNIVERSITAIRES DE 2ENNES P COLL #ARNOT DU
MoME AUTEUR ¦ ,E MARTYRE DE *ACQUARD OU LE MYTHE DE L´INVENTEUR HmROtQUE &RANCE XIXE SInCLE § DANS 4RACmS
2EVUE DE 3CIENCES HUMAINES MAI P AINSI QUE &ACE AU -ONSTRE MmCANIQUE 5NE HISTOIRE DES
RmSISTANCES g LA TECHNIQUE 0ARIS )-(/ ET !U TEMPS DES ±TUEUSES DE BRAS² ,A BRISE DE MACHINES g L´AUBE
DE L´nRE INDUSTRIELLE 2ENNES 0RESSES UNIVERSITAIRE DE 2ENNES # DE 2%#)43 #OMPTES RENDUS DES OUVRIERS ITALIENS AUX EXPOSITIONS UNIVERSELLES Cette conscience est presque toujours présente, et elle ne manque pas de
frapper l’imagination et la sensibilité des ouvriers, mais elle est presque
toujours contrebalancée par une forte volonté d’adhésion aux principes
inspirateurs de ce processus, considéré comme à même de résorber les
contradictions qu’il génère lui-même continuellement.
Le progrès technique apparaît comme un processus inévitable où les
inconvénients et les contradictions ne sont aucunement niés mais trouvent
OHXUMXVWLÀFDWLRQjXQQLYHDXSOXVKDXWGDQVXQQRXYHORUGUHSOXVDYDQFp
de la société et de la civilisation capable d’harmoniser les divers intérêts.
Il ne s’agit pas, dans cette optique, de lutter contre un processus dont la
force apparaît irrépressible, mais de garantir un rôle adéquat, une reconnaissance convenablement négociée aux classes laborieuses.
#/.#,53)/.3
(QGpÀQLWLYHLOUHVVRUWGHFHVUDSSRUWVXQHVpULHG·LQGLFDWLRQVQRXYHOles et de première main sur la culture technique et professionnelle des
RXYULHUVLPSOLTXpV$XGHOjGHVLQIRUPDWLRQVVSpFLÀTXHVTXHQRXVIRXUnit chaque cas, comment évaluer l’ensemble des documents ? Il s’agit certainement de matériaux hétérogènes où les variables en jeu sont multiples,
WRXWFRPPHHVWYDULpHHWGLYHUVLÀpHODIRUPDWLRQGHEDVHGHFKDTXHWUDYDLOOHXU,O\DHQRXWUHFHUWDLQVIDFWHXUVFHUWDLQHVYDULDEOHVLQGpVLUDEOHV
qui conditionnent la validité même de la source, comme la procédure de
VpOHFWLRQGHVRXYULHUVTXLSULYLOpJLHV€UHPHQWXQHÀQHWUDQFKHGHO·DULVWRFUDWLHRXYULqUHHWTXLSDUIRLVjO·LQWpULHXUGHFHOOHFLVHPEOHÀQLUSDUSULYLlégier les travailleurs qui possèdent la plus grande capacité d’expression
écrite. Malgré tout, l’on ne peut que rester frappé par l’émergence d’une
couche, dans l’ensemble assez volumineuse, de travailleurs dotés non seulement d’une bonne, voire parfois d’une excellente maîtrise de la langue
et d’une certaine culture générale, mais aussi d’une compétence technique
HWSURIHVVLRQQHOOHVSpFLÀTXH6RXVFHWDQJOHLOIDXWFRQVLGpUHUTX·LOV·DJLW
souvent d’une compétence non formelle et théorique, mais fortement interactive, au sens où les travailleurs se montrent capables non seulement
de comprendre les problèmes posés par les nouvelles technologies vues à
l’exposition, mais aussi de savoir les adapter et réinterpréter à la lumière
des processus de travail et des connaissances technico-professionnelles de
OHXU HQYLURQQHPHQW SURIHVVLRQQHO VSpFLÀTXH 6H FRQÀUPH GRQF XQ WUDLW
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA W\SLTXHGHODÀJXUHGHO·RXYULHUGHPpWLHUUHOHYpSDUO·KLVWRULRJUDSKLHVXU
le sujet, mais aussi une variante notable33. En effet, ce qui ressort n’est pas
tant la capacité de l’ouvrier de métier à exprimer un orgueil professionnel
et une compétence technique, incarnant des savoirs traditionnels et des
pratiques consolidées d’un haut niveau qualitatif mais destinés à céder le
SDVGHYDQWODGLOXWLRQO·©LQJpQLHULVDWLRQªGHVSURFHVVXVGHSURGXFWLRQHW
O·pPHUJHQFHGHODÀJXUHGHO·RXYULHUGHPDVVH&HTXLpPHUJHSOXW{WHVWOD
ÀJXUHG·XQWUDYDLOOHXUSORQJpGDQVOHSURFHVVXVGHFKDQJHPHQWGHVWHFKQRORJLHVHWGHVF\FOHVSURGXFWLIVTXLFKHUFKHjUpLQWHUSUpWHUFHVSURFHVVXV
GDQVXQHRSWLTXHG·DGDSWDWLRQÁH[LEOHHWDUWLFXOpH'DQVFHFRQWH[WHOHV
WUDYDLOOHXUVDSSDUDLVVHQWFRPPHGHVÀJXUHVHQFRUH©PL[WHVªHWHQpYRlution. En effet, ils ont en commun des fonctions, des compétences, des
connaissances, des savoirs qui sont propres à la fois aux différents stades
de développement technique et productif – des plus anciens et traditionnels aux plus novateurs – et aux différentes fonctions internes du milieu
du travail. De plus, ils semblent en mesure de remplir non seulement des
fonctions d’exécution, mais aussi dans une certaine mesure des fonctions
de direction, sur le plan technique, laissant même transparaître parfois
une capacité ou une velléité d’évaluation sur le plan de la gestion et de
l’entrepreneuriat. Sur le plan technique, bien sûr, ils expriment une sensiELOLWpjO·H[SpULPHQWDWLRQjO·pWXGHHWjO·DQDO\VHGHVSUREOqPHVHWGHVVRlutions proposées par la technologie, qui les rend souvent beaucoup plus
SURFKHVGHÀJXUHVTX·DXMRXUG·KXLQRXVSRXUULRQVFODVVHUGDQVODFDWpJRrie des techniciens. D’autre part, leur culture générale, leur forte implication, que nous avons ici traitée seulement en partie, dans les messages
SOXVJpQpUDX[YpKLFXOpVSDUOHVH[SRVLWLRQVHWSDUOHP\WKHGXSURJUqV
UHQGHQW FHWWH ÀJXUH EHDXFRXS SOXV FRPSOH[H VWUDWLÀpH GRQF IDVFLQDQWH
jQRV\HX[
3UR L´ARGUMENT VOIR $UCCIO "IGAZZI ¦ &IEREZZA DEL MESTIERE E ORGANIZZAZIONE DI CLASSE GLI OPERAI MILANESI
§ DANS 3OCIETg E 3TORIA P DU MoME AUTEUR ¦ #ULTURE ED ETICA DEL LAVORO § DANS
0AOLO &AVILLI ET -ARIO 4RONTI #LASSE OPERAIA ,E IDENTITg STORIA E PROSEPETTIVA -ILAN !NGELI P ET
AUSSI 'IULIANO 0ROCACCI ,A LOTTA DI CLASSE IN )TALIA AGLI INIZI DEL SECOLO 88 2OME %DITORI 2IUNITI )
# DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS ,´INVENTION DE L´AUTRE FORMATION
DES INGmNIEURS DmBATS ET CONTROVERSES
AUTOUR DES ENSEIGNEMENTS
NON TECHNIQUES AU MILIEU DU 88E SInCLE
!NTOINE $EROUET
C
ES DERNIÈRES ANNÉES,
les débats portant sur les formations d’ingénieurs se sont focalisés sur une dimension traditionnellement
FRQVLGpUpHFRPPHVXSSOpWLYHDXFRUSXV©QRUPDOªGHO·LQJpQLHXUODRXOHVIRUPDWLRQV©QRQWHFKQLTXHVªGHO·LQJpQLHXU. Supplétive
non pas parce qu’elle serait absente des formations d’ingénieurs, mais
parce que par les appellations qui la désignent (non technique, humaine,
éthique...), elle semble vouée à être considérée comme différente, à être
appréhendée comme un objet qui ne va pas de soi ou ne devrait pas aller
de soi lorsque l’on pense au corpus de savoirs mobilisé par les ingénieurs.
Cette catégorisation semble d’autant plus marquée qu’elle s’accompagne
G·XQGLVFRXUVYDQWDQWOHVPpULWHVG·XQH©LQWURGXFWLRQªG·XQH©LQWpJUDWLRQªDXWUHPHQWGLWGXSRVLWLRQQHPHQWGHFHW\SHGHIRUPDWLRQGDQVXQ
espace qui ne serait a priori pas le sien.
Au regard des seuls curricula3 de formation, la chose peut surprendre.
Peu d’écoles d’ingénieurs ne peuvent aujourd’hui se vanter d’avoir mis
HQSODFHGHWHOOHVIRUPDWLRQVHWVHXOHVGHVGpÀQLWLRQVGLYHUJHQWHVUHQGHQW
ODFRPSWDELOLVDWLRQGLIÀFLOHYRLUHLQRSpUDQWH&HSHQGDQWVHVpYROXWLRQV
#E TRAVAIL EST EFFECTUm DANS LE CADRE DU PROJET DE RECHERCHE ¦ &ORMER L´INGmNIEUR CITOYEN SAVOIRS PRATIQUES
ACTEURS § MENm PAR LE #ENTRE -AURICE(ALBWACHS #.23%(%33%.3 ET L´ASSOCIATION )NGmNIEURS SANS &RON
TInRES &RANCE SOUTENU PAR LA RmGION ÊLEDE&RANCE DANS LE CADRE DU PROJET 0)#2)
/N PENSE AUX DIFFmRENTES PUBLICATIONS DONT IL SERA QUESTION PAR LA SUITE MAIS AUSSI AUX COLLOQUES ORGANISmS
PAR LA #ONFmRENCE DES GRANDES mCOLES ET NOTAMMENT CELUI DE SUR ¦ (UMANITmS ET 'RANDES bCOLES §
!U SENS ENTENDU PAR *EAN#LAUDE &ORQUIN DANS 3OCIOLOGIE DU CURRICULUM 2ENNES 0RESSES UNIVERSITAIRES DE
2ENNES COLL ¦ 0AIDEIA §
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE de curricula ne sont pas uniquement le résultat de politiques pédagogiques explicites, et celles-ci ne sont pas nécessairement liées à des courants
GHSHQVpHLGHQWLÀDEOHV. En réalité, les débats illustrent et produisent une
forme de doxa dont les effets n’ont rien de mécanique. Le partage de cette
grille de lecture commune fortement liée à l’identité professionnelle des
ingénieursHQH[SOLTXHO·LQÁXHQFHGDQVOHVIRUPDWLRQVTXHFHVRLWDXQLveau des formateurs comme des membres des différents organes décisionQDLUHV ,O VHPEOH GRQF \ DYRLU XQ LQWpUrW SDUWLFXOLHU j VH SHQFKHU VXU OD
TXHVWLRQGHFHVGpEDWVUpFXUUHQWVTXLGpÀQLVVHQWHWUHGpÀQLVVHQWODSODFH
la nature, les objectifs et le contenu de ces enseignements, dans la mesure
où ceux-ci formulent et produisent cette catégorisation comme un ensemEOHH[WpULHXUDXFXUVXV©QRUPDOªGHVLQJpQLHXUV
Ces différentes manières d’appréhender le réel ne sont pas pour autant
la résultante des seuls débats récents. Bien que les arguments – qui s’acFRUGHQWVRXYHQWVXUO·LPSpULHXVHQpFHVVLWpG·LQWURGXLUHFHW\SHGHFRXUV²
s’inscrivent dans un processus présent, le cadre du débat et les catégories
de pensée sont eux le produit d’un processus historique. Pour rendre
FRPSWHGHFHFKDPSSDUWLFXOLHUTXHVRQWOHVGLVFLSOLQHV©QRQWHFKQLTXHVª
il est nécessaire d’établir une sociologie historique de ses conditions de
structuration7 et plus particulièrement ici des principes qui vont générer
une grille de lecture du réel.
C’est pour cette raison qu’il est tout particulièrement important de se
pencher sur la manière dont a été produite au cours du xxe siècle la question de la formation non technique des ingénieurs en dépassant le débat
actuel, clivé entre positions académiques ou militantes. En cherchant à
5NE APPROCHE MONOGRAPHIQUE SUR QUATRE mCOLES L´bCOLE CENTRALE DE 0ARIS L´bCOLE DES HAUTES mTUDES D´INGm
NIEURS g ,ILLE (%) L´bCOLE POLYTECHNIQUE DE ,OUVAIN 5#, ET CELLE DE "RUXELLES 5," NOUS PERMET DE VmRI½ER
CETTE HYPOTHnSE /N CONSTATE EN EFFET QUE LES mVOLUTIONS DE CURSUS SE FONT BIEN SOUVENT PLUS EN LIEN AVEC LES
TENSIONS INTERNES PAR EXEMPLE DES mQUILIBRES ENTRE ENSEIGNANTS OU LE REMPLACEMENT DE PROFESSEURS PARTIS
EN RETRAITE ,E LIEN AVEC LES IDmOLOGIES N´EST SANS AUCUN DOUTE PAS TOTALEMENT ABSENT LORSQUE SE ROMPENT
LES ACTIVITmS ROUTINInRES QUI RnGLENT LE FONCTIONNEMENT D´UNE FORMATION MAIS LES DmCISIONS NE SONT QUE TRnS
RAREMENT PRISES EN FONCTION OU EN FAISANT RmFmRENCE g UN MODnLE COMME L´EXPLIQUE BIEN *ULIE 'ERVAIS ¦ ,A
RmFORME DES CADRES DE L´ACTION PUBLIQUE OU LA FABRIQUE D´UN ³NOUVEAU´ CORPS DES 0ONTS ET #HAUSSmES )MPmRATIFS
MANAGmRIAUX LOGIQUES ADMINISTRATIVES ET STRATmGIES CORPORATISTES ½N DU 8)8E SInCLE §, THnSE DE DOCTORAT EN
3CIENCE 0OLITIQUE SOUS LA DIRECTION DE 'ILLES 0OLLET )%0 DE ,YON !U SENS ENTENDU PAR #LAUDE $UBAR ,A SOCIALISATION #ONSTRUCTION DES IDENTITmS SOCIALES ET PROFESSIONNELLES
0ARIS !RMAND #OLIN E mD COLL 5
#´EST LE SENS DE LA DmMARCHE PROPOSmE DANS &RmDmRIC -OLLm 'mNmALOGIE DE L´ASCnSE BUREAUCRATIQUE 2ENNES
0RESSES UNIVERSITAIRES DE 2ENNES COLL ¦ ,E LIEN SOCIAL § %N PARTANT DE LA CONSTRUCTION SOCIALE DE L´AD
MINISTRATION PAR DES GROUPES D´INTmRoT AU COURS DU XIXE SInCLE L´AUTEUR ESSAIE DE COMPRENDRE LES CADRES D´AP
PRmHENSION QUI AUJOURD´HUI ENCORE DmTERMINENT NOTRE VISION DE LA ¦ BUREAUCRATIE §
#E TRAVAIL S´APPUIE SUR UN CORPUS CONSTITUm NOTAMMENT DES PUBLICATIONS DES PRINCIPAUX GROUPEMENTS D´IN
GmNIEURS ET CADRES EN &RANCE ET EN "ELGIQUE DES JOURNAUX D´ASSOCIATIONS D´ANCIENS mLnVES DES mCOLES mTUDImES
AINSI QUE DES REVUES DES SYNDICATS DE CADRES SUIVANT #&4# #'# #'4 #&$4 AINSI QUE DU PATRONAT ET DE
GROUPEMENTS DIVERS TELS QUE LE #OMITm NATIONAL DE L´ORGANISATION FRANlAISE $IFFmRENTS COLLOQUES ET OUVRAGES
VIENNENT COMPLmTER CES DERNInRES NOTAMMENT POUR LA PmRIODE RmCENTE
# DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS restituer la matrice argumentative8, on peut en effet produire une sociologie historique des catégories de pensée9 qui, encore aujourd’hui, détermiQHQWO·DSSUpKHQVLRQGHFHWpOpPHQWVL©H[RJqQHªTX·HVWODIRUPDWLRQQRQ
technique de l’ingénieur. Cette approche par le temps long tend à écraser
les variations contextuelles10 qui pèsent sur les arguments mobilisés, en se
concentrant sur ses cadres généraux formés pendant l’entre-deux-guerres,
à un moment où le groupe professionnel se structure11, puis durant la péULRGHFODVVLTXHPHQWTXDOLÀpHGH©7UHQWH*ORULHXVHVª
,´b-%2'%.#% $´5. #!$2% $% $b"!4
Lorsque émerge la question d’une formation sociale de l’ingénieur, au
cours de l’entre-deux-guerres, les bases en ont déjà été posées au XIXe siècle.
Un certain nombre d’écoles possèdent déjà des cours qui, plus tard, seront
mis sous la bannière de cette autre formation. Cependant, ces cours ne sont
SDVSHQVpVFRPPHGLIIpUHQWVLOV©YRQWGHVRLªHQTXHOTXHVRUWHGDQVOD
formation d’ingénieur, dans la mesure où il s’agit plus de savoirs poursuivant l’objectif de l’éducation sociale de la future élite que de la formation
GHO·LQJpQLHXUHQWDQWTXHWHO&HVVDYRLUVFRUUHVSRQGHQWGHIDLWjODÀJXUH
sociale de l’ingénieur qu’essaient de produire les premières institutions de
formation. Celui-ci, homme d’élite, doit posséder les savoirs qui correspondent à son rang$LQVL O·eFROH SRO\WHFKQLTXH TXL WHQG j IRUPHU OHV
GLULJHDQWVGHO·eWDWV·DSSXLHVXUODSKLORVRSKLHHWODOLWWpUDWXUHDÀQGHGRQner à ces élèves les apparats de l’homme honnête et cultivé13, distinctions
nécessaires dans la hiérarchie sociale. De la même manière, les élites inGXVWULHOOHVIRUPpHVSDUO·eFROHFHQWUDOHSHXYHQWMXVWLÀHUGHOHXUVSRVLWLRQV
sociales par l’acquisition de savoirs de gouvernement comme le droit.
,A MmTHODE UTILISmE POUR RENDRE COMPTE DES DmBATS S´INSPIRE DE LA MmTHODE SUIVIE PAR *ULIETTE 2ENNES ,E
MmRITE ET LA NATURE 5NE CONTROVERSE RmPUBLICAINE L´ACCnS DES FEMMES AUX PROFESSIONS DE PRESTIGE 0ARIS &AYARD COLL ¦ ,´ESPACE DU POLITIQUE §
#E TYPE DE DmMARCHE EST EMPRUNTm PAR ,UC "OLTANSKI DANS ,ES CADRES LA FORMATION D´UN GROUPE SOCIAL 0ARIS
bDITIONS DE -INUIT COLL ¦ ,E SENS COMMUN § O| L´AUTEUR TRAVAILLE g L´mTUDE DE L´mLABORATION HISTORIQUE
D´UNE RmALITm SOCIALE QUI DEVIENT UN CADRE D´APPRmHENSION COURANT
6OIR TOUT PARTICULInREMENT LES ARGUMENTS MOBILISmS PAR LA #OMMISSION DES TITRES D´INGmNIEUR POUR DmFENDRE
SA VISION DE LA FORMATION HUMAINE mCONOMIQUE ET SOCIALE DANS #OMMISSION DES TITRES D´INGmNIEUR ¦ $IMEN
SION PERSONNELLE HUMAINE ET SOCIALE § #AHIER COMPLmMENTAIRE P HTTPWWWCTICOMMISSIONFR
)-'PDF#AHIER?#OMPLEMENTAIRE???,%302).#)0%3%4#2)4%2%3PDF
6OIR !NDRm 'RELON ,ES INGmNIEURS DE LA CRISE 0ARIS bDITIONS DE L´%(%33 COLL 3TUDIES IN HISTORY AND THE
SOCIAL SCIENCES
-oME SI CELUICI SE FOCALISE SUR LES SAVOIRS SCIENTI½COTECHNIQUES LA RELATION ENTRE LES SAVOIRS MOBILISmS PAR
LES INGmNIEURS ET LA PRmTENTION DE GROUPES SOCIAUX D´mLITE EST PARTICULInREMENT BIEN MONTRmE PAR 4ERRY 3HINN
¦ $ES CORPS DE L´bTAT AU SECTEUR INDUSTRIEL GENnSE DE LA PROFESSION D´INGmNIEUR § DANS 2EVUE
FRANlAISE DE 3OCIOLOGIE 8)8 P 3UR L´HISTOIRE DE 0OLYTECHNIQUE VOIR NOTAMMENT "RUNO "ELHOSTE ,A FORMATION D´UNE TECHNOCRATIE ,´bCOLE PO
LYTECHNIQUE ET SES mLnVES DE LA 2mVOLUTION AU 3ECOND %MPIRE 0ARIS "ELIN COLL ¦ (ISTOIRE DE L´mDUCATION §
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE L’existence même de ces cours est révélatrice de l’indissociation entre
sciences de la nature et sciences sociales en gestation au sein d’un corpus
qui ne connaît pas encore une segmentation disciplinaire nette. Les « esSULWVpFODLUpVªGXVLqFOHWUDQVIqUHQWjO·REVHUYDWLRQGXVRFLDOGHVFRQFHSWV
VFLHQWLÀTXHV SRXU SRVHU OHV EDVHV GHV IXWXUHV VFLHQFHV VRFLDOHV 6DYDQWV
engagés dans les affaires publiques, ils prétendent rationaliser le monde
par l’avancée de la science, et leur philosophie sociale fortement marquée
SDUOHP\WKHGXSURJUqVVFLHQWLÀTXHGpULYHYHUVXQHYLVLRQVFLHQWLVWHGX
PRQGH FRPPH O·DWWHVWHQW OHV ÀJXUHV ELHQ FRQQXHV G·+HQUL GH 6DLQW6LPRQ$XJXVWH&RPWHRXHQFRUH)UpGpULF/H3OD\.
Ce dernier, ingénieur et professeur de métallurgie à l’École des mines
pose les jalons d’une science sociale qu’il veut résolument empiriste et tournée vers l’action. Comme le montre bien Jérôme David, c’est la transposition de son ethos d’ingénieur catholique à l’observation du monde social qui
O·DPqQHjSRXUVXLYUHGHVREMHFWLIVPRUDX[HQV·DSSX\DQWVXUGHVUDLVRQQHments scientistes et profondément ancrés dans l’expérience de terrain. Figure parmi d’autres de ces savants éclairés, son œuvre a pour conséquence
jODÀQGX XIXe d’accentuer la séparation entre ces pensées sociales et leurs
institutions, et les sciences sociales qui émergent autour de Durkheim. La
VHJPHQWDWLRQGXFKDPSDFDGpPLTXHGpMjODWHQWHGDQVOHV\VWqPHIUDQoDLV
entre universités et écoles, se renforce autour des nouvelles disciplines, emSrFKDQWDX[OHSOD\VLHQVGHSUHQGUHSLHGGDQVOHPRQGHDFDGpPLTXHHWOHV
FRQÀQDQW DX PRQGH SURIHVVLRQQHO. À l’inverse, les disciplines académiques ne parviennent pas à pénétrer au sein de ces institutions en marge du
V\VWqPHG·HQVHLJQHPHQWYRLUHQHOHYHXOHQWVLPSOHPHQWSDV
Cette polarisation se retrouve dans l’opposition de la Ligue pour la
défense de la Culture française au mouvement créé par Durkheim, sur
le plan intellectuel, comme institutionnel. Cette Ligue regroupe les milieux conservateurs et littéraires, séduisant une partie du monde des ingénieurs17/DSULVHGHSDUWLHGHFHVGHUQLHUVHWQRWDPPHQWGXFpOqEUH+HQU\
6OIR NOTAMMENT *OHAN (EILBRON .AISSANCE DE LA SOCIOLOGIE -ARSEILLE !GONE COLL ¦ "ANC D´ESSAIS §
*mRxME $AVID ¦ !VEZVOUS LU ,E 0LAY .OTE SUR LA GENnSE DES /UVRIERS EUROPmENS § DANS 2EVUE D´HISTOIRE DES
SCIENCES HUMAINES, 86 P -ONDE PROFESSIONNEL AU SENS LARGE PUISQU´ILS PRENNENT PIED AUTANT DANS LES GROUPES REPRmSENTATIFS QUE
DANS LES FORMATIONS PROFESSIONNELLES TOUT EN S´EXPORTANT g L´mTRANGER !PRnS DES ANNmES D´OUBLI ET DE MISE
g L´INDEX LES TRAVAUX DE ,E 0LAY ONT mTm RETRAVAILLmS CES VINGT DERNInRES ANNmES NOTAMMENT DANS !NTOINE
3AVOYE &ABIEN #ARDONI bRIC !NCEAU ET AL &RmDmRIC ,E 0LAY 0ARCOURS AUDIENCE HmRITAGE 0ARIS 0RESSES DE L´bCOLE
DES MINES COLL ¦ 3CIENCES SOCIALES § MAIS AUSSI DANS UN GRAND NOMBRE D´ARTICLES ET DE COLLOQUES SUR
CE SUJET ET PLUSIEURS THnSES RmCENTES DONT -AGUELONE .OUVEL ,ES IDmES SOCIALES DE &RmDmRIC ,E 0LAY RmSEAUX DE
DIFFUSION RmCEPTION CRITIQUE ET INCIDENCES POLITIQUES SOUS LE 3ECOND %MPIRE THnSE DE DOCTORAT D´HISTOIRE SOUS LA
DIRECTION DE 'ENEVInVE 'AVIGNAUD&ONTAINEUNIVERSITm 0AUL6ALmRY -ONTPELLIER ))) 6OIR 3APIRO 'ISnLE ¦ ,E SAVANT ET LE LITTmRAIRE ,ES HOMMES DE LETTRES CONTRE LA SOCIOLOGIE DURKHEIMIENNE §
DANS *OHAN (EILBRON 2EMI ,ENOIR 'ISnLE 3APIRO DIR 0OUR UNE HISTOIRE DES SCIENCES SOCIALES (OMMAGE g 0IERRE
"OURDIEU 0ARIS &AYARD COLL ¦ (ISTOIRE DE LA PENSmE §
# DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS Le Chatelier18, s’explique par leur attachement aux humanités classiques et
notamment à la philosophie, ainsi que par la réaction à la spécialisation de
la formation des ingénieurs engagée par les instituts universitaires. Cette
UpDFWLRQSDVVHQRWDPPHQWSDUXQHFRQIpUHQFHGH/pRQ*XLOOHWHQ19,
futur directeur de l’École centrale, qui vante les mérites de l’enseignement
HQF\FORSpGLTXHHWGHVKXPDQLWpVFODVVLTXHVFRPSpWHQFHVIRQGDWULFHVGH
l’ingénieur sur le modèle français.
/HGpEDWV·LQVWDXUHDXVRUWLUGHOD3UHPLqUH*XHUUHVXUFHVEDVHVXQH
séparation nette avec l’Université et un corpus qui repose sur l’importance de la culture générale au sens classique. Les impératifs de la guerre
RQWSUpFLSLWpGDQVOHVXVLQHVGHX[FKDQJHPHQWVPDMHXUVO·LQWURGXFWLRQ
massive de l’organisation du travail, et la création d’œuvres sociales généralisées. Ces nouvelles fonctions de l’entreprise n’apparaissent pas par
hasard, comme en témoigne l’abondante littérature du début de siècle sur
de telles initiatives. Les ingénieurs ont pleinement participé à la diffusion
GH FH W\SH GH UpIRUPHV HW V·\ VRQW GRQQp XQ U{OH WRXW SDUWLFXOLHU. La
guerre traduit en acte cette pensée sociale autour de l’entreprise, et l’ingénieur se retrouve face à de nouvelles responsabilités, ou plutôt tente-t-il
de se trouver face à de nouvelles responsabilités. En effet, les prises de
position des représentants du groupe professionnel tendent à donner un
rôle professionnel plus grand encore aux ingénieurs en captant la gestion
de ces nouvelles fonctions de l’entreprise.
L’entre-deux-guerres ouvre donc une situation nouvelle pour la profession et une opportunité sans pareille pour se transformer, à un moment
où les nécessités de la reconstruction obligent à repenser les formations.
(QRXWUHOHFRUSXVOHSOD\VLHQHVWjGLVSRVLWLRQSRXUTXLYHXWSHQVHUO·LQWHUYHQWLRQ VRFLDOH GH O·LQJpQLHXU$XWUHPHQW GLW O·KHXUH HVW j OD UHFRQÀguration de la profession en lui faisant dépasser ses barrières strictement
VFLHQWLÀFRWHFKQLTXHV VDQV VH FRQWHQWHU SRXU DXWDQW GHV VDYRLUV G·pOLWH
traditionnels.
6OIR L´ENCART QUI LUI EST CONSACRm DANS /DILE (ENRY ¦ $E LA SOCIOLOGIE COMME TECHNOLOGIE SOCIALE LA CONTRIBU
TION DE *EAN #OUTROT § DANS !CTES DE LA 2ECHERCHE EN 3CIENCES 3OCIALES, P 6OIR ,mON 'UILLET ,´ENSEIGNEMENT TECHNIQUE SUPmRIEUR g L´APRnSGUERRE 0RmFACE D´(ENRI ,E #HATELIER, 0ARIS 0AYOT
/N PEUT AINSI CITER !UGUSTE &ABRE 5N INGmNIEUR SOCIAL *EAN%DME ,ECLAIRe .sMES #HASTANIER OU ENCORE
(ENRY 'LEIZE #E QUE L´INGmNIEUR SOCIAL DOIT SAVOIR, 0ARIS !LCAN "IEN ENTENDU VIENNENT S´Y AJOUTER LES
mCRITS LEPLAYSIENS COMME bMILE #HEYSSON ,E 2xLE SOCIAL DE L´INGmNIEUR CONFmRENCE FAITE DEVANT LA 3OCImTm DES
INGmNIEURS CIVILS LE MAI , 0ARIS 'UILLAUMIN ,E LIEN ENTRE CE RxLE NOUVEAU DE L´INGmNIEUR ET LA PENSmE LEPLAYSIENNE EST BIEN EXPLIQUm DANS !NTOINE 3AVOYE
&RmDmRIC !UDREN .AISSANCE DE L´INGmNIEUR SOCIAL LES INGmNIEURS DES MINES ET LA SCIENCE SOCIALE AU 8)8E SInCLE 0ARIS
0RESSES DE L´bCOLE DES MINES COLL ¦ 3CIENCES SOCIALES §
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE ,ES COMPmTENCES SOCIALES D´UN NOUVEAU PROFESSIONNEL
Les ingénieurs de l’entre-deux-guerres vont pleinement s’investir dans
la promotion de ce nouveau rôle professionnel, notamment par l’intermédiaire d’un mouvement de grande importance, l’Union sociale des ingénieurs catholiques&HPRXYHPHQWG·LQJpQLHXUVFUppHQFURvWUDSLGHPHQWMXVTX·jGHYHQLUOHV\QGLFDWG·LQJpQLHXUVOHSOXVLPSRUWDQWMXVTX·j
OD6HFRQGH*XHUUHPRQGLDOH6RQDWWDFKHPHQWDXFDWKROLFLVPHVRFLDOSRUWH
les membres de l’USIC vers l’étude des activités des ingénieurs, conçues
dans leur esprit comme les intermédiaires devant résoudre les antagonismes de classes pour parvenir à la paix sociale. Dans cette logique,
OH PRXYHPHQW SRUWH VRQ DFWLRQ VXU GHX[ D[HV SULQFLSDX[ XQH GpIHQVH
de la profession et de ses intérêts, qui passe par la promotion d’un ingénieur aux responsabilités élargies, et une sensibilisation de ces derniers
aux questions sociales.
&HOOHFLSDVVHSDUXQHJULOOHGHOHFWXUHWUqVLQVSLUpHSDUOHVOHSOD\VLHQV
un diagnostic social à base de monographies devant permettre d’agir pour
transformer le monde social. Du reste, la vision d’un ingénieur pensé comme intermédiaire entre les classes, agissant pour le maintien de la paix
VRFLDOHHVWHOOHPrPHWUqVSURFKHGHVGRFWULQHVGH/H3OD\TXLSODoDLWO·LQgénieur en haut de sa hiérarchie sociale, car mieux à même de se détacher
de ses intérêts propres.
$X GpEXW GHV DQQpHV VL OH PRXYHPHQW SU{QH RXYHUWHPHQW XQ
activisme social, il n’en est pas encore à formuler l’idée d’une formation
VSpFLÀTXH&HVLOHQFHVXUODTXHVWLRQQ·HVWSDVSURSUHjO·86,&HWODPDjorité des revues industrielles ou de groupes d’ingénieurs sont muettes à
ce sujet. Le débat sur les formations à la sortie de la guerre fait long feu et
GLVSDUDvWGHVSULQFLSDOHVUHYXHVGqVVDQVDYRLUpYRTXpODIRUPDWLRQ
aux nouvelles compétences sociales revendiquées par les ingénieurs. De
IDLWODUHYHQGLFDWLRQPDMHXUHGXJURXSHPHQWHWGHVDXWUHVV\QGLFDWVG·LQgénieurs porte sur la reconnaissance de la profession, qui passe par celle
de sa formation. Fort logiquement, ceci n’incite guère aux attaques contre
le modèle existant.
L’USIC, elle, ne délaisse pas le terrain de la formation sociale de l’ingénieur parce que sa position dans le champ est particulière. Son caractère
FDWKROLTXHOXLSHUPHWG·DIÀFKHUVDSUpWHQWLRQVRFLDOHWRXWDXWDQWTX·HOOH
lui confère une certaine liberté dans ses prises de position. Son importanFHQXPpULTXHOXLGRQQHHQRXWUHXQHUHSUpVHQWDWLYLWpVXIÀVDPPHQWIRUWH
,´IMPORTANCE DE L´53)# DANS LE GROUPE SOCIAL DES CADRES EST mVOQUmE PAR ,UC "OLTANSKI ,ES CADRES OP CIT
!NDRm 4HmPOT ¦ ,´5NION SOCIALE DES INGmNIEURS CATHOLIQUES DURANT LA PREMInRE MOITIm DU 88E SInCLE § DANS
!NDRm 4HmPOT DIR ,´)NGmNIEUR DANS LA SOCImTm FRANlAISE 0ARIS bDITIONS OUVRInRES P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS pour pouvoir se faire le porte-parole de la profession et l’autorise donc à
SUHQGUHSRVLWLRQVXUODGpÀQLWLRQGHFHOOHFL
&HSHQGDQW GXUDQW OHV DQQpHV OD IRUPDWLRQ VRFLDOH HVW XQLTXHment pensée en supplément du cursus normal, et passe principalement
par l’activité des membres au sein du mouvement, comme lorsqu’est publiée une réponse à un jeune ingénieur qui veut parfaire son instruction
VRFLDOHHQ
©²(QPpGLWDQWO·HQF\FOLTXH5HUXP1RYDUXPDSUqVDYRLUOXODOHWWUH
GH0JU*HUPDLQDUFKHYrTXHGH7RXORXVHVXUODSDL[VRFLDOHSDUO·RUJDQLVDWLRQFKUpWLHQQHGXWUDYDLO&HWWHOHWWUHHVWXQHLQWHUSUpWDWLRQGHO·HQF\clique et des autres documents du Saint-Siège.
– En lisant quelques ouvrages d’économie sociale et d’économie politique, peu nombreux mais bien choisis.
²(QV·H[HUoDQWMRXUQHOOHPHQWjDQDO\VHUOHVIDLWVVRFLDX[GRQWRQHVW
WpPRLQjODOXPLqUHGHODGRFWULQHVRFLDOHFDWKROLTXH&HWWHJ\PQDVWLTXH
développe le sens social.
– En fréquentant des hommes se consacrant à des œuvres sociales et en
collaborant à ces œuvres.
– En apprenant à connaître le peuple, par des conversations, ou par des
visites (par exemple comme membre de conférences de Saint-Vincent-dePaul).
– Lorsqu’on le peut, et cela est très facile à Paris, en suivant des cours et
GHVFRQIpUHQFHVFRPPHFHOOHVTXLVHGRQQHQWUXH6DLQW+RQRUpVLqJH
de l’Usic)ª
L’USIC propose également une formation par les stages, comme en
WpPRLJQHO·LPSRUWDQWGpEDWTXLDVHFRXpO·DQQpH. D’un débat tout
d’abord lié au retour des jeunes gens mobilisés par l’armée qui nécessitent
une formation technique accélérée par la pratique en usine, l’objet dérive
vers les préoccupations du mouvement et se concentre vers l’instruction
sociale qu’il pourrait générer, dans la droite ligne de la position de son
SURSUHSUpVLGHQWVXUODIRUPDWLRQ
« Parce que, sur ce terrain, l’ingénieur a été jusqu’ici complètement isolé et très mal préparé. La formation reçue dans les écoles, les conférences
des sociétés techniques, les articles de publications variées lui ont appris
jPHWWUHHQ±XYUHOHVPDWpULDX[HWjIDLUHDSSOLFDWLRQGHVORLVSK\VLTXHV
2QQHOXLDMDPDLVDSSULVFRPPHQWLOIDOODLWPDQLHUOHVKRPPHVQLTXHOV
devoirs sociaux lui imposaient les lois supérieures de la morale.
53)# ¦ #ONSEIL AUX JEUNES QUI VEULENT PERFECTIONNER LEUR mDUCATION SOCIALE § DANS bCHO DE L´5NION SOCIALE
MARS P 6OIR LES NUMmROS DE L´bCHO DE L´5NION SOCIALE DE g CE SUJET
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE 4XHGHFRQÁLWVYLROHQWVRXODWHQWVDXUDLHQWpWppYLWpVTXHGHVRXIIUDQces, que de pertes matérielles auraient été épargnées si les chefs d’industries avaient toujours su prendre à temps des mesures appropriées à la
situation.
En cette matière, comme en toute autre, l’expérience ne s’acquiert que
SpQLEOHPHQWHWHOOHFR€WHKRUULEOHPHQWFKHUVLO·RQQHVDLWSDVSURÀWHUGH
l’expérience et de la collaboration des autres. C’est de cette expérience des
autres qu’est faite la science sociale que nous avons mise dans notre proJUDPPHG·DFWLRQHWGRQWO·LQWpUrWV·DIÀUPHGHMRXUHQMRXUª
Pour autant, il n’est en aucun cas question de rendre ce stage obligatoire, ni même encore de l’intégrer au cursus. Il est encore un supplément
et la formation sociale de l’ingénieur n’est pour ainsi dire pas pensée en
tant que telle.
Pendant ce temps, l’USIC ne reste pas inactive et s’engage dans une
SURJUHVVLYHUHGpÀQLWLRQGHO·RUJDQLVDWLRQVRFLDOHGDQVODTXHOOHO·LQJpQLHXU
D XQ U{OH WRXW SDUWLFXOLHU DX FURLVHPHQW GH O·KpULWDJH OHSOD\VLHQ GHV UpÁH[LRQVVXUOHU{OHVRFLDOGHO·LQJpQLHXUHWGHFHOXLYHQXQRWDPPHQWGHV
SD\VDQJORVD[RQVVXUO·LQJpQLHXUVRFLDO
/D QXDQFH HQWUH OHV GHX[ WHUPHV Q·HVW SDV DQRGLQH l’ingénieur social
désigne un technicien du monde social, appelé à remplir la fonction sociale de l’ingénieur qui consiste principalement en la gestion des œuvres
sociales de l’usine et de la gestion du personnel; autrement dit des tâches
comme le recrutement, la paie, la gestion des intendantes d’usines dont
le nombre se développe, ou encore des services sociaux de l’entreprise. À
O·LQYHUVHOHU{OHVRFLDOHVWSOXW{WHQWHQGXFRPPHODGpÀQLWLRQGHFHTXH
l’ingénieur apporte à la société, autrement dit sa contribution à la vie de
ODFLWpjODFURLVVDQFHpFRQRPLTXHGXSD\VjVRQU{OHGDQVOHVFRQÁLWV
etc., dans un discours de défense corporatiste de la profession. Mais, rôle
VRFLDOVLJQLÀHpJDOHPHQWO·DWWHQWLRQSDUWLFXOLqUHTXHOHVSUDWLFLHQVGRLYHQW
porter aux conditions sociales d’exercice du travail, en vue de faciliter les
rapports entre le patronat et la classe ouvrière. Dans cette seconde déclinaison, l’ingénieur doit améliorer les conditions de travail, se montrer
proche des ouvriers et des patrons en vue de concilier leurs intérêts, ou
bien encore être un modèle moral pour le prolétariat. Si, dans les autres
SD\VODOLWWpUDWXUHSURGXLWHjO·pSRTXHWHQGjPRQWUHUXQHGLVWLQFWLRQGH
ces deux termes, l’USIC s’inscrit pleinement dans la tradition française en
!LBERT ,IOUVILLE ¦ #ARACTnRE /RGANISATION !CTIVITm DE L´53)# § DANS bCHO DE L´5NION SOCIALE, MARS P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS rassemblant la fonction et le rôle au sein d’un seul et même homme qui
FDSWHFHVDWWULEXWLRQVO·LQJpQLHXU.
À ce stade de son histoire, le mouvement possède à la fois une déÀQLWLRQ SURSUH GH O·LQJpQLHXU TXL O·DPqQH j VH SHQVHU FRPPH LQGLYLGX
social et une sensibilisation plus ou moins grande à sa formation qui n’est
jusqu’ici pensée que comme un ajout. En outre, la question du rôle social de l’ingénieur émerge également autour de deux débats récurrents
GHO·pSRTXHO·LQVHUWLRQGHVMHXQHVLQJpQLHXUVTX·LOIDXWIDFLOLWHUSDUXQH
pGXFDWLRQDX[FRQGLWLRQVGHYLHHQXVLQHHWOHWUDYDLOGHV©FDGUHVkJpVª
qu’il faut permettre en leur offrant des postes qui conviennent à leur expérience et leur distance aux nouvelles techniques, donc plutôt sur des
WkFKHV©VRFLDOHVª.
/HVpYpQHPHQWVVHSUpFLSLWHQWDXPLOLHXGHVDQQpHV(QODORL
sur la protection du titre d’ingénieur reconnaît et réglemente la profession,
après des débats qui ont insisté tout particulièrement sur les humanités,
dans une logique plutôt classique de l’enseignement des ingénieurs et du
UpFXUUHQW FRQÁLW © HQF\FORSpGLVPH FRQWUH VSpFLDOLVDWLRQ ª 3DU DLOOHXUV HQ
O·DUULYpHDXJRXYHUQHPHQWGH/pRQ%OXPHWGX)URQWSRSXODLUHYRLWOD
création de nouveaux ministères dédiés à la rationalisation du monde économique et social, prémices du planisme à la française. Ces créations s’accompagnent de l’accession à des postes à responsabilité d’ingénieurs d’un
nouveau genre, qui prennent ainsi en charge la politique socio-économique
GHOD)UDQFH&HVGHUQLHUVVRQWSULQFLSDOHPHQWGHVPHPEUHVGXJURXSH;
crise majoritairement composé d’ingénieurs qui vont prôner à partir de 1931
XQHUDWLRQDOLVDWLRQGHODJHVWLRQGHO·pFRQRPLHHWGXSROLWLTXHSUpÀJXUDQW
le modèle du technocrate d’après-guerre30. Ceci passe par la promotion d’un
LQGLYLGX©SLYRWªHQWUHOHVLQWpUrWVGHFODVVHVO·LQJpQLHXU31.
Cependant, malgré une conjoncture a priori favorable aux revendiFDWLRQVVRFLDOHVGHVLQJpQLHXUVXQHIRUPDWLRQTXL\VHUDLWDGDSWpHQ·HVW
pas à l’ordre du jour. Durant ces années 1930, un seul espace de débat va
V·RXYULUHWrWUHUpSHUFXWpSDUODUHYXHGHO·86,&XQ&RQJUqVLQWHUQDWLRQDO
,A Dm½NITION FOURNIE PAR UN MEMBRE DE L´5NION NOMMm 'AY DANS LE BULLETIN D´OCTOBRE ILLUSTRE BIEN L´AM
BIGUtTm DU TERME DANS LE CONTEXTE FRANlAIS 6OIR * 'AY ¦ ,E RxLE DE L´INGmNIEUR SOCIAL § DANS bCHO DE L´5NION
SOCIALE, OCTOBRE P ,A QUESTION DU ¦ CADRE hGm § ET DE SON IMPORTANCE DANS LA STRUCTURATION DE LA PROFESSION SE RETROUVE DANS
.ATHALIE (UGOT0IRON ¦ $ES MAUX AUX MOTS UNE APPROCHE SOCIOHISTORIQUE DES ³³CADRES DE PLUS DE ANS´´
§ DANS ,E -OUVEMENT SOCIAL 6OIR !NDRm 'RELON Les INGmNIEURS DE LA CRISE, OP CIT
6OIR NOTAMMENT #ENTRE POLYTECHNICIEN D´mTUDES mCONOMIQUES $E LA RmCURRENCE DES CRISES mCONOMIQUES 8
CRISE SON CINQUANTENAIRE 0ARIS bCONOMICA OU ENCORE &RANlOIS $ENORD .mOLIBmRALISME VERSION
FRANlAISE (ISTOIRE D´UNE IDmOLOGIE POLITIQUE 0ARIS $EMOPOLIS ,A RHmTORIQUE DE L´INTERMmDIAIRE SE RETROUVE AUSSI DANS LE CmLnBRE 'EORGES ,AMIRAND ,E RxLE SOCIAL DE L´INGm
NIEUR 3CnNES DE LA VIE D´5SINE 0ARIS 0LON 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE de l’enseignement technique à Bruxelles, où des intervenants belges, noWDPPHQWOHVOHSOD\VLHQVGH/RXYDLQYRQWLQVLVWHUVXUODIRUPDWLRQVRFLDOH
qui recevra un certain écho à l’USIC. Toutefois, en raison peut-être de la
fragilité des écoles ou encore de la concurrence exacerbée entre elles, qui
expliquerait que les débats ne puissent avoir lieu qu’en dehors du cadre
national, si certains cours existent et se développent sous la pression de
tensions institutionnelles33 HW VL OH PRGqOH GH O·LQJpQLHXU HQF\FORSpGLVWH
V·DSSX\DQWVXUOHVKXPDQLWpVUHVWHODWHQWOHGpEDWVXUFHTXLVHUDLWXQH
IRUPDWLRQVSpFLÀTXHDGDSWpDX[QRXYHOOHVFRPSpWHQFHVVRFLDOHVGHO·LQgénieur reste inexistant.
,OIDXWDWWHQGUHODPLVHHQSODFHGXUpJLPHGH9LFK\HQSRXUYRLU
converger un certain nombre d’éléments qui vont contribuer à une prePLqUHIRUPDOLVDWLRQ$ÀQGHGpSDVVHUODIDLOOLWHGHVpOLWHVSROLWLTXHVTXH
Pétain considère comme la cause de la défaite française, le régime décide
GHV·DSSX\HUVXUGHVJHVWLRQQDLUHVGXPRQGHVRFLDO,OSRXUVXLWDLQVLjOD
IRLVODYLVLRQG·;FULVHHWFHOOHGHO·86,&HQSURPRXYDQWO·LGpHG·XQLQJpnieur du monde social et économique. C’est plutôt la vision de l’USIC
qui prévaut, la proximité idéologique avec le régime aidant, notamment
sur la question de l’organisation corporative de la société. Ainsi, très rapidement après son entrée en fonction, le maréchal Pétain s’adresse aux
LQJpQLHXUVVXUOHVTXHOVLOGLWYRXORLUV·DSSX\HUSRXUUHIRQGHUODQDWLRQ
Ce discours est repris dans l’Écho de l’USIC paraissant en zone libre, et
DFFODPpSDUVRQSUpVLGHQW
« Ces lignes, nettement inspirées de la doctrine chrétienne, doivent recevoir l’adhésion de tous les catholiques français ; et ceux qui, comme
nous, travaillent depuis de longues années à l’instauration d’une politique
sociale conforme à la doctrine sociale de l’église, ne peuvent que se réjouir
de l’avènement du régime nouveau qui prépare, dans la mesure permise
par les circonstances présentes, des réalisations conformes à l’essentiel de
leurs programmesª
'DQVODGpÀQLWLRQGHO·86,&O·LQJpQLHXUVHGRLWG·rWUHjODIRLVXQWHFKnicien du social et de porter une grande attention au social, se situant audelà des intérêts de classes par sa position d’intermédiaire et d’homme
de rationalité. Cette dualité des fonctions, qui doivent être regroupées
"UREAU INTERNATIONAL DE L´ENSEIGNEMENT TECHNIQUE #ONGRnS INTERNATIONAL DE L´ENSEIGNEMENT TECHNIQUE g "RU
XELLES LES ET SEPTEMBRE , 0ARIS ")%4 /N PENSE NOTAMMENT g LA QUERELLE ENTRE L´bCOLE DES HAUTES mTUDES D´INGmNIEURS DE ,ILLE DEVANT FORMER DES
INGmNIEURS DIRIGEANTS D´ENTREPRISES ET L´)NSTITUT CATHOLIQUE DES ARTS ET MmTIERS DEVANT FORMER DES CONTRE
MAsTRES 5NE PARTIE DE LA CONTROVERSE PORTERA SUR LE CONTENU DES COURS DE L´)#!- QUI TEND g INTRODUIRE DE PLUS
EN PLUS DE COURS NON TECHNIQUES APANAGE DES mCOLES FORMANT L´mLITE DES INGmNIEURS ET PROVOQUANT L´IRE DE SA
CONS®UR LILLOISE L´ACCUSANT DE VOULOIR CHASSER SUR SES TERRES
#E QUI NE SIGNI½E PAS QUE LES MEMBRES DE CES MOUVEMENTS SOUTIENDRONT LE RmGIME DE 6ICHY
!LBERT ,IOUVILLE ¦ ,A NOUVELLE POLITIQUE SOCIALE DE LA &RANCE § DANS bCHO DE L´5NION SOCIALE, DmCEMBRE P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS dans un seul professionnel, est, d’une certaine manière, celle qui encore
aujourd’hui structure le groupe professionnel des ingénieurs.
&HWWHUHFRQQDLVVDQFHUHQFRQWUHODYRORQWpGXUpJLPHGH9LFK\GHUHVWUXFWXUHUOHVFXUVXVGHIRUPDWLRQHQV·RSSRVDQWQRWDPPHQWDXV\VWqPH
républicain créé sous inspiration durkheimienne et accusé d’être la cause de la faillite morale de la nation. Au niveau de l’enseignement supérieur, ceci se concrétise par exemple par la création de l’École des cadres
d’Uriage, mais aussi la proximité du régime avec certaines grandes écoles d’ingénieurs37(QÀQFHWWHQRXYHOOHPDQLqUHG·HQYLVDJHUODJHVWLRQGHV
affaires publiques nécessite de recourir à de nouveaux instruments sociopFRQRPLTXHV 2Q DVVLVWH j XQ UHGpSORLHPHQW GHV VFLHQFHV VRFLDOHV HW GH
l’économie pour produire les conditions d’une gestion dite rationnelle du
monde social par des cadres, qui tendent pour l’une à une biologisation
du monde social et pour l’autre à une mathématisation de l’économie38.
De cette conjonction d’événements découle la première formalisation
d’un cadre conceptuel qui pense la formation sociale de l’ingénieur39. Un
WULSW\TXHSRVWXOHTXHFHOOHFLGRLWFRPSUHQGUHGHVWHFKQLTXHVGHJHVWLRQ
du social, une connaissance de soi et des autres qui lui permette d’agir
dans le monde social, et une culture générale qui relie les deux dans un
KRPPHFXOWLYpVRLW
©8QFRPSOpPHQWGHIRUPDWLRQJpQpUDOHKXPDLQHpGXFDWLRQPRrale, culture intellectuelle et spirituelle.
8QHIRUPDWLRQSDUWLFXOLqUHDXU{OHGXFKHIDSSUHQWLVVDJHGXFRPmandement.
8QHpWXGHVSpFLDOLVpHGHVpOpPHQWVGHWHFKQLTXHVVRFLDOHVpFRQRPLHSROLWLTXHHWVRFLDOHOpJLVODWLRQRXYULqUHKLVWRLUHGXWUDYDLOª
Le modèle professionnel de l’ingénieur qui dépasse la simple technique étant acquis, sa formation sociale est désormais pensée en fonction
de cette nouvelle identité. Cette première formalisation ne fait qu’illustrer
XQHWHQGDQFHODTXHVWLRQGHODIRUPDWLRQVRFLDOHGHO·LQJpQLHXUSHXWGpsormais être pensable, la catégorie a désormais émergé.
2APPORTm AVEC L´AGRmMENT DE L´AUTEUR DANS L´bCHO DE L´5NION SOCIALE DE JANVIER VOIR 53)# ¦ ,A FORMATION
DES CHEFS § DANS bCHO DE L´5NION SOCIALE, JANVIER P /N PENSE NOTAMMENT g L´bCOLE CENTRALE DONT LE DIRECTEUR ,mON 'UILLET FUT DnS UN PROCHE DU MARmCHAL
0mTAIN AINSI QUE DE L´ANCIEN CENTRALIEN DE L´53)# 'EORGES ,AMIRAND SECRmTAIRE D´bTAT g LA *EUNESSE CONNU
POUR SON OUVRAGE ,E 2xLE SOCIAL DE L´INGmNIEUR. #ES DEUX EXEMPLES ILLUSTRENT LA PROXIMITm IDmOLOGIQUE AVEC LE
RmGIME D´UNE PARTIE DU MONDE DES INGmNIEURS ET DES mLITES EN GmNmRAL NOTAMMENT CATHOLIQUES
#E MOUVEMENT QUI PASSE PAR EXEMPLE PAR LA CRmATION DE LA &ONDATION #ARREL OU LA PLACE PRISE PAR (ENRY
"ORDEAUX mCRIVAIN CATHOLIQUE REVENDIQUANT L´HmRITAGE LEPLAYSIEN SOUS SA DIMENSION LA PLUS RmACTIONNAIRE EST
mTUDIm DANS &RANCINE -UEL$REYFUS ¦ ,A RmmDUCATION DE LA SOCIOLOGIE SOUS LE RmGIME DE 6ICHY § DANS *OHAN
(EILBRON 2EMI ,ENOIR 'ISnLE 3APIRO DIR 0OUR UNE HISTOIRE DES SCIENCES SOCIALES, OP CIT P #ETTE Rm¾EXION RmSULTE D´UNE ENQUoTE ANNUELLE DE L´5NION SOCIALE SUR LA FORMATION SOCIALE DE L´INGmNIEUR QUI
S´APPUIE SUR UNE LARGE CONSULTATION DE SES MEMBRES PAR UNE ENQUoTE ET DES RmUNIONS DE Rm¾EXION VOIR 53)#
¦ ,A FORMATION SOCIALE DE L´mLnVE INGmNIEUR § DANS bCHO DE L´5NION SOCIALE, MAI P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE ,% -/$È,% -),)4!.4 /DIRUPXODWLRQGHFHWULSW\TXHQ·DSDVHQVRLWGHJUDQGVHIIHWV'·DERUG
SDUFH TXH OH SD\V HVW HQ JXHUUH HQVXLWH SDUFH TXH OD OLEpUDWLRQ YHUUD OH
déclin de l’USIC qui ne pourra pas l’imposer. Cependant, un espace de
GpEDWHVWRXYHUWGRQWOHFDGUHHVWGpWHUPLQpjSDUWLUGHODGpÀQLWLRQGHOD
profession d’ingénieur. Toutefois, la période qui succède immédiatement
à la reconstruction ne reprend pas ce débat et est plutôt l’occasion de voir
le renforcement d’un corpus non directement destiné aux ingénieurs, mais
que ceux-ci vont capter, compte tenu de leur prétention sociale. Ce corpus
KpWpURFOLWHQpDX[eWDWV8QLVVHFRPSRVHGHODSV\FKRORJLHGHVFRPSRUWHPHQWVHWQRWDPPHQWODSV\FKRPpWULHDLQVLTXHGHVUHODWLRQVKXPDLQHV
qui cherchent à prendre en compte le facteur humain dans l’organisation
du travail. Ces savoirs, repris et adaptés dès les années 1930 et qui se traduisirent notamment par le redéploiement des sciences humaines évoqué précédemment, qu’il s’agisse de la Fondation Carrel ou du groupe
;&ULVH, connaissent une nouvelle vigueur. À partir de la Libération, leur
GpYHORSSHPHQWVHUDGpIHQGXSDUOHVGLIIpUHQWVV\QGLFDWVHWSDUOHSDWURQDW
par l’intermédiaire des missions de productivité soutenues par l’Agence
française de productivité, organe né du plan Marshall. Cela n’a pas pour
conséquence un débat sur leur introduction en écoles d’ingénieurs, qui
VH IDLW SURJUHVVLYHPHQW GDQV OD OLJQpH GH FRXUV GH FH W\SH H[LVWDQW GHSXLVTXHOTXHVDQQpHVLOOXVWUDQWELHQXQHG\QDPLTXHG·K\EULGDWLRQHWQRQ
d’importation.
,A PmRIODE DES ANNmES QUI CONNAsT UN FORT DmVELOPPEMENT DE LA SENSIBILITm POUR LA RATIONALISATION DU
MONDE SOCIAL EST CEPENDANT DISTINCTE DE CETTE SECONDE PmRIODE %N EFFET EN DEHORS DES QUELQUES PIONNIERS
CITmS DANS LES TRAVAUX D´9VES #OHEN NOTAMMENT 9VES #OHEN ¦ 5NE HISTOIRE DE PRATIQUE LES USINES 0EUGEOT
LA 0REMInRE 'UERRE MONDIALE ET L´ACTION D´UN ORGANISATEUR %RNEST -ATTERN § ,ES #AHIERS DE 2b#)43 P LES REVUES PROFESSIONNELLES D´INGmNIEURS FONT PEU DE CAS DE L´EXEMPLE AMmRICAIN ,´ORGANISATION
SCIENTI½QUE DU TRAVAIL PORTmE PAR LE #OMITm NATIONAL DE L´ORGANISATION FRANlAISE S´INSPIRE PLUTxT DE &AYOL ET LA
REVUE DE L´53)# mVOQUE BIEN LA PSYCHOLOGIE OU L´mCONOMIE MAIS DANS UNE VISION PLUTxT FRANlAISE UNE BRnCHE
S´OUVRANT UN MOMENT SUR LA QUESTION DES FORMATIONS COMME DANS #HARLES ,ALANDE ¦ ,ES INGmNIEURS ET L´mCO
NOMIE POLITIQUE § DANS bCHO DE L´5NION SOCIALE SEPTEMBRE P ,´EXEMPLE LE PLUS INTmRESSANT EST
S}REMENT LE TRAVAIL EFFECTUm PAR *EAN #OUTROT mVOQUm DANS /DILE (ENRY ¦ $E LA SOCIOLOGIE COMME TECHNOLO
GIE SOCIALE § LOC CIT P )L TENTE UNE REDm½NITION g SA MANInRE DES SCIENCES SOCIALES PAR EXEMPLE EN
CONVIANT AUX DmCADES DE 0ONTIGNY DES PERSONNALITmS COMME 'EORGES -ATISSE OU !LDOUS (UXLEY VOIR *EAN
#OUTROT ¦ -mMOIRE INTRODUCTIF § DANS -ARCEL 0RmLOT %NTRETIEN SUR LES SCIENCES DE L´HOMME ESSAI COLLECTIF DE CO
ORDINATION 0ARIS #ENTRE D´bTUDES DES 0ROBLnMES HUMAINS $ANS CES DIFFmRENTS CAS ON VOIT QUE L´IN¾UENCE
AMmRICAINE SUR LES PRATIQUES PROFESSIONNELLES EST BIEN MOINDRE QUE CE QUI SE PASSERA APRnS LA 3ECONDE 'UERRE
MONDIALE 3UR CETTE SECONDE PmRIODE VOIR NOTAMMENT &ERRUCCIO 2ICCIARDI ,´IMPORTATION DU ±MODnLE AMmRI
CAIN² EN )TALIE ET SON AMmNAGEMENT POLITIQUE mCONOMIQUE CADRES DIRIGEANTS ET GESTION D´ENTREPRISE g L´mPOQUE
DU LONG PLAN -ARSHALL THnSE EN HISTOIRE SOUS LA DIRECTION D´!NDRm 'RELON %(%33 AINSI QUE
'IULIANA 'EMELLI 4HE &ORD &OUNDATION AND %UROPE ´S´S CROSSFERTILIZATION OF LEARNING IN SOCIAL SCIENCE
AND MANAGEMENT "RUXELLES %UROPEAN )NTERUNIVERSITY 0RESS ,E RxLE DE L´!&!0 SE LIT g TRAVERS LES LIGNES DE DIFFmRENTES ORGANISATIONS SYNDICALES DE L´mPOQUE QUI PARTICIPENT
AUX MISSIONS INTERSYNDICALES DE PRODUCTIVITm AUX bTATS5NIS ET ALIMENTENT LE DmBAT SUR L´IMPOSITION DE LA
NOTION DE PRODUCTIVITm DANS L´INDUSTRIE FRANlAISE
# DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS ,OIDXWDWWHQGUHHWXQUDSSRUWGH:ROIIPHPEUHGHOD&RPPLVVLRQ
des titres d’ingénieur, au Conseil économique, pour voir la formation
remise en question. Ce rapport, qui critique lourdement les grandes écoles
autant pour leur malthusianisme que pour l’absence de spécialisation, a
pour principale conséquence de faire réagir le groupe professionnel. Dès
lors, s’engage un débat, qui se termine au début des années 1970. Ce débat
VHOLPLWHG·DLOOHXUVXQLTXHPHQWDXPRQGHPLOLWDQWV\QGLFDWVHWSDWURQDW
OHVTXHOTXHVÀJXUHV©LQWHOOHFWXHOOHVªTXL\FRQWULEXHQWOHIDLVDQWGDQVOH
cadre de ces structures militantes. Son propos passe rapidement des questions strictement techniques à la question de la formation non technique.
/·LPSRUWDQFHSULVHSDUFHGpEDWQHVHUHWURXYHSDVGDQVOHVDXWUHVSD\V
tout au moins pas sous cette forme. Des ingénieurs belges vont jusqu’à
regretter l’absence totale de questionnement sur le sujet dans leur propre
SD\V, alors que dans les faits celui-ci semblait en pointe dans les années
1930. En Belgique, les débats se déroulent dans le cadre de la problémaWLTXHGHODIRUPDWLRQFRQWLQXH/DUpÁH[LRQVXUO·LQWURGXFWLRQG·XQHIRUmation non technique intégrée au cœur même du cursus des ingénieurs
FLYLOVHVWPDUJLQDOH&HWWHVSpFLÀFLWpIUDQoDLVHVHPEOHWHQLUDXIDLWTXHOD
France voit alors l’émergence du groupe des cadres soutenu par des reYHQGLFDWLRQVV\QGLFDOHVJURXSHTXLHQJOREHHWGpSDVVHODVHXOHSURIHVVLRQ
d’ingénieur et ses références techniques. Les structures qui se saisissent
du débat ne se focalisent donc pas sur la seule formation de l’ingénieur,
mais sur ce qu’il lui faut pour devenir un cadre dès le début de sa carrière
et non plus au cours de celle-ci.
,´HmRITAGE DE LA CULTURE HUMANISTE
Le débat se polarise rapidement sur différentes positions représentées
par des organisations différentes. La Confédération générale des cadres
&*&PLOLWHSRXUXQHFRQFHSWLRQVSLULWXDOLVWHGHFHWWHIRUPDWLRQTX·HOOH
appelle humaine, qui va de la culture générale classique, autrement dit les
KXPDQLWpVjODUpÁH[LRQSKLORVRSKLTXHVXUODWHFKQLTXHQRWDPPHQWDYHF
André Sigfried SHQVHXU DWWLWUp GX V\QGLFDW &H V\QGLFDW FUpH GqV son propre Centre de perfectionnement des cadres et dirigeants par l’inWHUPpGLDLUHGHOD)pGpUDWLRQQDWLRQDOHGHVV\QGLFDWVG·LQJpQLHXUVHWFDGUHV
)16,&GLULJpSDU5RJHU0LOORW­WUDYHUVFHWWHVWUXFWXUHOD&*&GLIIXVH
/RGANE D´HABILITATION DES FORMATIONS D´INGmNIEURS CRmm PAR LA LOI DE &mDmRATION DES PATRONS ET DES INGmNIEURS CATHOLIQUES ¦ &ORMATION DE L´INGmNIEUR § DANS 0OINTAGES FmVRIER
AVRILJUIN !NDRm 3IEGFRIED SOCIOLOGUE HISTORIEN ET GmOGRAPHE FRANlAIS NOMMm ACADmMICIEN AU SORTIR DE LA
GUERRE DEVIENT LE PREMIER PRmSIDENT DE LA &ONDATION NATIONALE DES SCIENCES POLITIQUES
6OIR -ARIE(mLnNE /LIVIER ¦ ,´ENGAGEMENT SOCIAL D´UN INGmNIEUR HUMANISTE § DANS -ATmRIAUX POUR L´HISTOIRE
DE NOTRE TEMPS P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE sa propre vision de la formation non technique des ingénieurs, qui reprend
jVRQFRPSWHO·KpULWDJH©FODVVLTXHªG·XQHIRUPDWLRQDX[KXPDQLWpV
/HV\QGLFDWHVWOXLDXVVLVHQVLEOHDXGLVFRXUVVXUOHIDFWHXUKXPDLQHW
O·RUJDQLVDWLRQ VFLHQWLÀTXH GX WUDYDLO PDLV IRFDOLVH VRQ DWWHQWLRQ VXU OHV
rapports de l’homme à la technique qui lui semble être l’explication du
PDODLVHVRFLDOHWGHVGLIÀFXOWpVWUDYHUVpHVSDUOD)UDQFH$LQVLRXWUHOHV
personnalités déjà citées, se succèdent à la tribune de son Centre et dans
les pages de ses revues Jean Fourastié, le penseur catholique Theilard
GH&KDUGLQO·pFRQRPLVWHQpROLEpUDO+\DFLQWKH'XEUHXLORXHQFRUH*DVWRQ
Berger. Ce dernier illustre bien la multipositionnalité des acteurs mobilisés dans le cadre de cet institut. Se revendiquant à la fois philosophe et industriel, il est un homme de la haute administration d’État où il œuvrera à
la direction des enseignements supérieurs, ce qui lui permettra de traduire
en acte sa pensée philosophique.
Comme le montre bien le travail de Marie-Pierre EscudieVDUpÁH[LRQ
sur les relations de l’homme à la technique ainsi que sa conception des
humanités l’amènent progressivement à développer des institutions accueillant des sciences humaines et sociales, à commencer par la Maison
GHV VFLHQFHV GH O·+RPPH j 3DULV HW O·,QVWLWXW QDWLRQDO GHV VFLHQFHV DSSOLTXpHVj/\RQ&HWWHGHUQLqUHUpDOLVDWLRQHVWW\SLTXHGHODSHQVpHGH
%HUJHU FRPSUHQDQW QRWDPPHQW XQ GpSDUWHPHQW GHV +XPDQLWpV FKDUJp
d’amener une nouveauté dans la formation des ingénieurs.
/D SURPRWLRQ G·XQH IRUPDWLRQ © KXPDLQH ª GHV LQJpQLHXUV TXL UHSRVH VXU OD FXOWXUH KXPDQLVWH Q·HVW SDV OH VHXO IDLW GH OD &*& (Q HIIHW OHV
personnalités captées par ce mouvement sont aussi présentes au sein du
&RPLWpQDWLRQDOGHO·RUJDQLVDWLRQIUDQoDLVH&12)JUDQGSURPRWHXUGH
O·267VXUOHWHUULWRLUHIUDQoDLV­SDUWLUGHODÀQGHOD6HFRQGH*XHUUHPRQGLDOH OH &12) VH ODQFH GDQV XQH DUGHQWH SURPRWLRQ GX IDFWHXU KXPDLQ
dans l’entreprise, adaptant les disciplines américaines à la mode au modèle
culturel français, fortement marqué par l’importance des humanités.
­SDUWLUGHOH&12)GpYHORSSHXQLPSRUWDQWFRUSXVTXLSRUWHjOD
fois sur les méthodes d’administration et de gestion des entreprises, dans
ODORJLTXHGH)D\RODLQVLTXHVXUO·LPSRUWDQFHGHODFXOWXUHJpQpUDOHGDQV
l’exercice de la direction. Si l’impulsion décisive en matière de formation
des cadres et dirigeants vient des États-Unis, pour autant elle s’opère sur
un cadre forgé durant les années 1930 par les débats sur le commandement
et l’éducation du chef, qui font de ce dernier avant tout un homme possédant une forte culture générale dans la tradition de l’élite française
6OIR DANS CE NUMmRO
$ONT 2OGER -ILLOT SERA L´UN DES ADMINISTRATEURS PENDANT LES ANNmES #./& ¦ *OURNmES D´bTUDES ENTREPRISES UNIVERSITmS § DANS #./& ¯ 2EVUE MENSUELLE DE L´ORGANISATION, JUIN P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS « L’ingénieur doit sans doute agir sur les choses, mais il le fait toujours
par l’intermédiaire d’autres hommes. Si on lui donne une formation trop
exclusivement technique, sans formation humaine correspondante, nos
SUREOqPHVYRQWVHFRPSOLTXHUDXOLHXGHVHVLPSOLÀHU&·HVWGLUHTXHOHV
organismes de l’enseignement supérieur qui se consacrent aux sciences humaines ne sont pas, comme on ose parfois le dire, les vestiges d’un passé révolu, mais ils sont bien à la pointe même de notre recherche la plus avancée
HWF·HVWVXUHX[TXHQRXVSRXYRQVIRQGHUQRVHVSRLUVOHVSOXVOpJLWLPHVª
/H&12)WLHQWQRWDPPHQWGHVUHQFRQWUHVDQQXHOOHVj5R\DXPRQWR
ODUpÁH[LRQVXUOHVVFLHQFHVHWWHFKQLTXHVVHPrOHjODSURPRWLRQGHQRXvelles méthodes d’administration. Ces rencontres sont par ailleurs assez
UpYpODWULFHV GX IRQFWLRQQHPHQW GX &12) FRPPH OLHX QHXWUH, regroupant des tendances diverses de l’élite et diffusant dans celle-ci un corpus
de connaissances a priori vidé de contenu idéologique, parce que dispensé
dans un tel espace. Ce corpus de savoirs de gouvernement va progressivement prendre racine au sein des écoles d’ingénieurs dont les membres
sont bien entendu présents.
#ONNAsTRE LE MONDE SOCIAL OU LE MONDE mCONOMIQUE /DFRQFHSWLRQ©KXPDQLVWHªGHOD&*&VHUHWURXYHSDUIRLVjOD&RQIpdération française des travailleurs chrétiens (CFTC), qui, présente dès
VXUOHVXMHWQHIRUPXOHSDVGHSRVLWLRQIHUPHVXUVDGpÀQLWLRQGHOD
IRUPDWLRQHWVHFRQWHQWHJpQpUDOHPHQWGHFRQVWDWHUXQPDQTXH
« Au fur et à mesure que sont gravis les échelons de la hiérarchie, les
problèmes techniques s’estompent et sont remplacés par des questions
administratives, économiques et sociales. Comme par ailleurs on remarque que les postes importants sont plus souvent attribués à des cadres de
formation uniquement administrative, on observe une réaction naturelle
des ingénieurs tendant à acquérir une formation complémentaire, utile
pour l’exercice du métier certes, mais aussi pour la promotionª
Cependant, le processus de transformation en Confédération française
démocratique du travail (CFDT) lui permet de prendre un virage en prônant une formation aux conditions sociales des ouvriers, qui permette aux
ingénieurs d’améliorer les conditions de vie de ces derniers, ainsi que leur
SURSUHVWDWXW
6OIR 0IERRE "OURDIEU ,UC "OLTANSKI ¦ ,A PRODUCTION DE L´IDmOLOGIE DOMINANTE § DANS !CTES DE LA 2ECHERCHE EN
3CIENCES SOCIALES JUIN P #ECI SANS DISSOCIER LE PRIVm DU PUBLIC g TEL POINT QU´IL PARAsT IMPROPRE DE PARLER POUR CE TYPE DE MmTHODES DE
GESTION D´IMPORTATION DE LA LOGIQUE PRIVmE AU SEIN DE LA SPHnRE PUBLIQUE mTANT DONNm QU´IL S´AGIT EN FAIT D´UN
SEUL ET MoME CORPUS DnS L´ORIGINE
4OFANI ¦ 2APPORT DU CONGRnS DE LA FORMATION DES CADRES § DANS #ADRES ET PROFESSIONS MAI P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE « [les disciplines non techniques doivent] former des démocrates, c’està-dire concevoir, tant au niveau du contenu qu’à celui des méthodes, un
enseignement qui permette à chacun d’exercer sa liberté et sa responsabilité dans la vie socialeª
La CFDT se place en fait dans la droite ligne des mouvements cathoOLTXHVVRFLDX[KpULWLHUVGHO·86,&/·8QLRQVRFLDOHTXLGHYLHQWHQOH
Mouvement des cadres chrétiens (MCC), publie dans sa revue Responsables un certain nombre de positions qui tendent à promouvoir des formations touchant aux conditions sociales du monde ouvrier. L’Action cathoOLTXHJUDQGHVpFROHV$&*(PRXYHPHQWFDWKROLTXHGHMHXQHVSURFKHGH
l’USIC et publiant aussi dans sa revue, critique ainsi fortement le contenu
des formations, enjoignant les directeurs à introduire des cours consacrés
à la connaissance du milieu ouvrier.
/HV\PEROHGHFHPRXYHPHQWLGpRORJLTXHHVWVDQVDXFXQGRXWHODUpIRUPH
HIIHFWXpjO·eFROHGHVPLQHVGH1DQF\SDU%HUWDQG6FKZDUW], réforme restée
jusqu’à nos jours comme emblématique de la question de la formation sociale de l’ingénieur. Il n’est pas utile de revenir sur l’ensemble de la réforme,
commentée de manière très différente selon les mouvements. Cependant,
force est de constater que cet exemple focalise l’attention des mouvements
catholiques qui en font leur priorité, jouant certainement sur la proximité de
6FKZDUW]TXLSXEOLHGHQRPEUHX[DUWLFOHVGDQVOHXUVFRORQQHV.
Cette vision d’une formation aux conditions sociales de l’ouvrier, qui
passe notamment par le stage ouvrier, se retrouve dans le plus important
V\QGLFDWpWXGLDQWGHO·pSRTXHHQpFROHO·8QLRQGHVJUDQGHVpFROHV­ODÀQ
GHVDQQpHVO·8*(YRLWG·DERUGGDQVFHWWHIRUPDWLRQXQPR\HQG·DSprendre le futur milieu professionnel et de permettre ainsi une meilleure
LQWpJUDWLRQDXV\VWqPHGHSURGXFWLRQHWXQHPHLOOHXUHHPSOR\DELOLWpGHV
diplômés, considérant que ces enseignants permettent une « meilleure
connaissance des problèmes humains, [qui] offrira à l’ingénieur la possibilité de s’intégrer dans l’entreprise à tous les niveauxª
&HWWHSRVLWLRQLQWpJUDWULFHVHUDUHSULVHDSUqVSDUOD)pGpUDWLRQQDWLRQDOHGHVDVVRFLDWLRQVGHVJUDQGHVpFROHVQRXYHDXV\QGLFDWpWXGLDQWQp
G·XQHVFLVVLRQGXHjODSROLWLVDWLRQGHO·8*(GXUDQWODJXHUUHG·$OJpULHTXL
*ACQUES -OREAU ¦ ,E DIALOGUE EST OUVERT ENTRE mTUDIANTS ENSEIGNANTS ET SYNDICALISTES § DANS #ADRES ET PRO
FESSIONS, JANVIER P 6OIR &RANlOISE "IRCK !NDRm 'RELON $ES INGmNIEURS POUR LA ,ORRAINE .ANCY 0RESSES UNIVERSITAIRES DE .ANCY
COLL ¦ (ISTOIRE DES INSTITUTIONS UNIVERSITAIRES §
$EUX INTERPRmTATIONS DIVERGENTES SONT VISIBLES g TRAVERS #.0& ¦ ,ES STAGES DANS L´INDUSTRIE § DANS "ULLETIN
DU #.0& JANVIER P QUI INSISTE SUR L´ENTRmE DE L´INDUSTRIE DANS LE FONCTIONNEMENT DE L´bCOLE ET
DANS $ANIEL 0ARROT ¦ 5'% UNIVERSITAIRE QUEL EN EST LE SENS § DANS /RGANE DE L´5'% AVRIL P QUI VOIT
PLUTxT LE CHANGEMENT DES MmTHODES PmDAGOGIQUES
#OMME "ERTRAND 3CHWARTZ ¦ ,A RmFORME DE L´ENSEIGNEMENT g L´bCOLE DES MINES DE .ANCY § DANS 2ESPONSA
BLES MARS P $ANIEL 0ARROT ¦ "ILAN D´UNE RmFORME § DANS /RGANE DE L´5'%, FmVRIER P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS déclare que la culture générale professionnelle transmise par ces cours doit
« permettre au cadre supérieur de s’intégrer dans l’environnement éconoPLTXHHWVRFLDOª/·8*(GHVRQF{WpDEDQGRQQHO·LGpHG·LQWpJUDWLRQSRXU
défendre une vision de plus en plus critique. Il ne s’agit plus de permettre
DXMHXQHLQJpQLHXUGHV·LQWpJUHUGDQVOHV\VWqPHGHSURGXFWLRQLOV·DJLWGH
critiquer celui-ci et de tenter de rendre l’ingénieur conscient des lacunes du
V\VWqPHSRXUTX·LOSXLVVHDJLUGHVVXV(OOHHVWHQFRXUDJpHHQFHODSDUXQ
FROORTXHLQWHUQDWLRQDOGHVpOqYHVLQJpQLHXUVRUJDQLVpHQ%HOJLTXHHQ
où les jeunes ingénieurs de Louvain, de Liège et de Bruxelles, défendent
une conception d’ouverture et de critique sociale de cette formation. Au
FRXUVGHVDQQpHVDYHFOHVRXWLHQGDQVXQSUHPLHUWHPSVGHOD&)'7
SXLVDSUqVGHOD&RQIpGpUDWLRQJpQpUDOHGXWUDYDLO&*7O·8*(Gpfend l’idée d’une formation censée permettre de dépasser les antagonismes
de classes par la connaissance mutuelle et l’attention portée par les ingénieurs aux conditions de travail, comme dans cet extrait de discours du
SUpVLGHQWGHOD&)7&/DJDQGUpDXFRQJUqVGHO·8*(HQ
©/·DFFRUGV·HVWIDLWGHSXLVXQFHUWDLQWHPSVjO·8*(SRXUDIÀUPHUOD
nécessité d’une culture absolument indispensable à la vraie liberté, qui ne
peut exister que si le cadre est aussi conscient que possible de la situation
hiérarchique économique, sociale qui est la sienne. C’est pourquoi nos
projets de réforme ont comporté un enseignement économique, juridique,
VRFLDO HWF GRQQDQW j O·pWXGLDQW OHV PR\HQV G·LQWHUYHQLU DYHF MXJHPHQW
HW HIÀFDFLWp GDQV OH FRXUV GH OD YLH pFRQRPLTXH &HOD VXSSRVH TX·LO DLW
VXIÀVDPPHQW GH UHVSRQVDELOLWp GDQV FH GRPDLQH 6L O·pWXGH VRLJQpH GH
la structure actuelle de l’entreprise et de l’économie nous montrait qu’il
n’en est rien, mis à part quelques individus privilégiés, alors pourquoi cet
enseignement, cette utopie de la liberté et son développement par l’école ?
1·HVWFHSDVOHFDV"ª
Représenté principalement par le Conseil national du patronat français, le patronat prône une amélioration de la connaissance de l’entreprise
HWGXIRQFWLRQQHPHQWGHVRUJDQLVDWLRQVDÀQG·DPpOLRUHUOHUHQGHPHQWSDU
l’amélioration des relations de travail, principale cause de la résistance
des Français à la productivité, en prônant l’apprentissage des « sciences
KXPDLQHV>[email protected]
&RANlOIS *ACQUEMET ¦ 6ICEPRmSIDENCE UNIVERSITAIRE § DANS #OHmSION, OCTOBRE P ,A VISION DU SYN
DICAT SE RETROUVE g TRAVERS DE NOMBREUX NUMmROS DE SON MAGAZINE #OHmSION NOTAMMENT &.!'% ¦ ,A FORMA
TION GmNmRALE PROFESSIONNELLE ET L´mLnVE EN GRANDE mCOLE § DANS #OHmSION OCTOBRE P "ERNARD $UREL ¦ ,ES CADRES DE DEMAIN AU CONGRnS DE L´5NION DES GRANDES mCOLES § DANS #ADRES ET PROFESSIONS
AVRIL P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE thodes propres à renforcer l’aptitude des cadres à communiquer et animer
les groupes de travailª
/HVpYpQHPHQWVGHPDLIRQFWLRQQHQWFRPPHXQpOHFWURFKRFSRXU
le patronat qui fait le constat d’échec de sa stratégie de soutien plus ou
moins actif au modèle des humanités et se recentre sur l’idée de l’adaptation de l’enseignement à l’économie. Ceci se décline de deux manièUHVODSUHPLqUHSOXVpYLGHQWHFRQVLVWHjIDLUHHQVRUWHTXHOHVLQGXVWULHOV
puissent intégrer les organes décisionnaires des formations, de préférence
OHVJUDQGHVpFROHVSOXVSHUPpDEOHVjFHW\SHGHVROOLFLWDWLRQ­FHWWHIRUPH
d’entrisme s’ajoute une action plus structurelle en faveur de lois rendant
obligatoire cette représentation, voire le souhait de la création des universités technologiques conformes aux vœux du patronat. De plus, en favoriVDQWODPLVHjGLVSRVLWLRQGHVpFROHVG·LQJpQLHXUVGHO·LQGXVWULHjGHVÀQV
d’enseignement ou à l’inverse de stages industriels pour les enseignants,
OH &13) IDLW OH SDUL G·LQÁXHU GLUHFWHPHQW VXU OH FRQWHQX GHV FRXUV /D
VHFRQGHLQÁXHQFHSDUWGXFRQVWDWTXHOHVWURXEOHVVRFLDX[VRQWODFRQVpquence d’une méconnaissance des mécanismes de l’économie du côté des
©FLWR\HQVGHEDVHª$LQVLGXSULPDLUHDXVXSpULHXUOH&13)VRXKDLWH
l’introduction de cours consacrés à la culture économique, dans l’idée de
rendre la population moins rétive aux positions patronales.
En outre, des réorganisations internes l’amènent à sortir de son attitude
GpIHQVLYHSRXUSDVVHUjXQ©SDWURQDWPLOLWDQWªHWjSUHQGUHO·LQLWLDWLYHVXU
certains sujets. C’est pour ces raisons qu’au cours de l’année 1970, est publié
un livre blanc intitulé La formation des hommes dans la société moderne, qui reSUHQGOHVWUDYDX[GHV$VVLVHVGH/\RQGXRFWREUHHWXQVHFRQGVXU
le management intitulé Le management dans votre entreprise./H&13)\DUUrte sa position concernant la formation des ingénieurs, modernisant sans le
VDYRLUOHWULSW\TXHGHO·86,&HQSRVWXODQWGHVFRQQDLVVDQFHVQRWDPPHQW
HQJHVWLRQGHVDSWLWXGHVQRWDPPHQWGDQVOHVUHODWLRQVKXPDLQHVHWHQÀQ
une attitude qui règle le comportement général du chef.
/HVDQQpHVODV\QWKqVHGXGpEDWSDUOH&13)HWVRQDFWLYLVPHDX
VHLQGHVIRUPDWLRQVSRXULQVWDOOHUGHVHQVHLJQHPHQWVGHFHW\SHQHFORVHQW
SDVSRXUDXWDQWODUpÁH[LRQVXUOHVXMHW*UkFHDXGpYHORSSHPHQWLQVWLWXtionnel du secteur de la formation et grâce à l’émergence des premiers enseignants spécialistes au sein des écoles, la problématique se déplace, ainsi
#OMMISSION %NTREPRISEbCOLE DE GUERRE ¦ ,E PERFECTIONNEMENT DES CADRES SUPmRIEURS § DANS "ULLETIN DU
#.0& AO}TSEPTEMBRE P %ICHENBERGER ¦ ,ES PROBLnMES DE L´ENSEIGNEMENT ET DE SON ADAPTATION g L´mCONOMIE § DANS "ULLETIN DU #.0&
FmVRIER P /N PEUT NOTAMMENT VOIR CETTE POSITION DmVELOPPmE DANS UN ARTICLE DE L´mCONOMISTE *EAN0AUL #OURTHmOUX QUI
EXPLIQUE QUE L´ENSEIGNEMENT ¦ LIMITERAIT LES MALENTENDUS ET LES CONTRADICTIONS § VOIR *EAN0AUL #OURTHmOUX
¦ 2m¾EXION POUR UNE FORMATION mCONOMIQUE § DANS "ULLETIN DU #.0& JANVIER P # DE 2%#)43 ,´INVENTION DE L´AUTRE FORMATION DES INGmNIEURS TXHOHVDFWHXUV\FRQWULEXDQW'DQVO·XQDQLPLWpDSSDUHQWHTXLFDFKHGHV
GpÀQLWLRQV GLYHUJHQWHV VHXOH O·8*( TXL VH UDGLFDOLVH GXUDQW FHV DQQpHV
1970, va contester de front l’enseignement non technique, avec le soutien
SOXVRXPRLQVSURFKHGHOD&*7/HV\QGLFDWpWXGLDQWGpFODUHDORUV
« En développant des enseignements à fort contenu idéologique (économie, sciences sociales, conférences de représentants du grand patronat),
le pouvoir essaie de mouler les étudiants conformément aux intérêts de la
classe dominanteª
Ce tournant critique est d’autant plus remarquable qu’il semble être
le seul moment sur un siècle de débat où une organisation se posera en
contestataire de la nécessité d’introduire des sciences humaines. CepenGDQWO·8*(HVWGpFOLQDQWHHWSHLQHjIDLUHHQWHQGUHVDYRL[3OXVHQFRUHOH
débat s’est déplacé et l’émulation militante n’est plus à l’ordre du jour.
De cette émulation idéologique sans précédent, deux éléments ressortent. Tout d’abord, après la phase d’émergence du cadre de débat avec
l’USIC, cette nouvelle phase a imposé l’idée de la légitimité d’une telle
IRUPDWLRQHQpFROHG·LQJpQLHXUVjFKDUJHSRXUFHVGHUQLqUHVG·HQGpÀQLU
OHFRQWHQX(QVXLWHODGpÀQLWLRQTXLV·LPSRVHHVWGRQQpHHQSDUOH
&13)/HPRXYHPHQWSDWURQDOSDUOHG·XQHQVHLJQHPHQWGXPDQDJHPHQW
jSDUWLUG·XQWULSW\TXHTXLFRPSUHQGWURLVD[HVVHQVLEOHPHQWLGHQWLTXHVj
FHX[GHO·86,&HWODLVVHVRXVHQWHQGUHTXHVDGpÀQLWLRQHVWG·DERUGOLpHj
celle du groupe professionnel que la formation a la charge de reproduire,
en conformité avec les intérêts du groupe et ceux du patronat.
En outre, il ne faut pas négliger les deux autres éléments mis en éviGHQFH/·LGpHGHODFRQQDLVVDQFHGXPRQGHRXYULHUjGHVÀQVGHFULWLTXH
VRFLDOHRXGHFRQQDLVVDQFHGHO·HQWUHSULVHHQYXHGHO·LQWpJUDWLRQDXV\Vtème de production se développe. Par ailleurs, on constate l’importance
GHODWUDGLWLRQKXPDQLVWHHQWUHWHQXHSDUGHV©LQWHOOHFWXHOVpFODLUpVªTXL
DSSRUWHQWOHXUUpÁH[LRQVXUODFRQGLWLRQGHO·KRPPHWHFKQLTXHHQVHGLVtinguant fortement du monde académique.
6%23 ,! $b&).)4)/. %80%24% $5 #/.4%.5 Conséquence de la structuration organisationnelle du secteur de la formation, conséquence également de la perte de pouvoir des organisations
professionnelles, ce sont désormais les responsables des formations et les
enseignants peu à peu installés en école qui reprendront à leur compte le
GpEDWFKHUFKDQWjGpÀQLUOHFRQWHQXGHVHQVHLJQHPHQWV$LQVLVLO·RQVH
5'% ¦ 8 § DANS 'RANDES bCOLES OCTOBRE )L S´AGIT EN FAIT DE LA REPRISE D´UN COMMUNIQUm FAIT LE OCTOBRE PAR LE GROUPE D´ACTION SYNDICALE DE 0OLYTECHNIQUE
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%2/5%4 !NTOINE focalise seulement sur l’actualité des débats concernant les sciences humaines en école d’ingénieurs, ceux-ci semblent principalement relever de
considérations épistémologiques, pédagogiques et autres, soutenus en
cela par l’évolution du format des prises de position vers un modèle académique. En apparence, les débats semblent donc être une entreprise de
SURVSHFWLYHVFLHQWLÀTXHWHQGDQWYHUVO·DGDSWDWLRQGXFRUSXVGHVVFLHQFHV
humaines aux études d’ingénieurs.
Cependant, au regard de l’historicité de la question, les prises de posiWLRQV·LQVFULYHQWGDQVXQFDGUHGHGpEDWSUpGpÀQLUpSRQGDQWQRWDPPHQW
à une injonction peu à peu construite socialement. Il ne s’agit pas de réduire les positions idéologiques aux positions sociales, quand bien même
on observe intuitivement des liens forts. L’histoire de ce champ particulier
dont on a montré ici le processus idéologique de structuration, mais qui
pourrait aussi être vu sous l’angle institutionnel, détermine un cadre de
SHQVpHTXLLQÁXHDXMRXUG·KXLVXUOHVGpEDWVHQOHVFRQFHQWUDQWGDQVXQ
HVSDFHGHVSRVVLEOHVGpÀQL.
L’esquisse d’une socio-histoire de cette catégorie de pensée a permis de
FRPSUHQGUHOHVSUpPLFHVGHVUpÁH[LRQVDFWXHOOHVHWDLQVLGHVHGpWDFKHU
de la fausse question d’une alternative supposée entre un débat purement
PLOLWDQWFRQWUHXQGpEDWSXUHPHQWVFLHQWLÀTXHSRXUIDLUHDSSDUDvWUHOHV
ressorts sociaux préalables à un débat porté aujourd’hui par les milieux
VFLHQWLÀTXHV &HWWH HQWUHSULVH GH UpÁH[LYLWp pourrait permettre d’expliTXHUODSUR[LPLWpGHGHX[SULVHVGHSRVLWLRQD\DQWSUqVGHVRL[DQWHDQV
G·pFDUWHWVRXVXQIRUPDWELHQGLIIpUHQWFHOOHGHO·86,&HQ et celle de
O·RXYUDJHGH'HQLV/HPDvWUHHQ, et de mettre en évidence la structure d’un débat encore d’actualité et dépendant autant que défendant la
GpÀQLWLRQGHO·LGHQWLWpG·LQJpQLHXU
/UTRE LES NOMBREUX ARTICLES SUR LE SUJET PUBLIm PAR L´5NESCO OU ENCORE LA REVUE %UROPEAN *OURNAL OF %NGINE
ERING %DUCATION DE LA 3OCImTm EUROPmENNE DES FORMATIONS D´INGmNIEURS CITONS 'UY -INGUET ¦ ,A FORMATION
DES INGmNIEURS AUX SCIENCES HUMAINES ET SOCIALES QUESTION DE LmGITIMITm § DANS 3OCIOLOGIES PRATIQUES P OU ENCORE !NNIE $UFOUR ,ES ENJEUX DE L´ENSEIGNEMENT DE LA SOCIOLOGIE DANS UNE mCOLE D´IN
GmNIEURS ANALYSE DU CURRICULUM DE L´)NSTITUT SUPmRIEUR D´AGRICULTURE 2HxNE!LPES DE g THnSE EN
SCIENCES DE L´mDUCATION SOUS LA DIRECTION DE 'UY !VANZINI 5NIVERSITm ,UMInRE ,YON ,A NOTION D´ESPACE DES POSSIBLES EST NOTAMMENT MOBILISmE g PROPOS DU TRAVAIL DES ARTISTES DANS 0IERRE "OU
RDIEU ,ES 2nGLES DE L´ART 'ENnSE ET STRUCTURE DU CHAMP LITTmRAIRE, 0ARIS 3EUIL 0OUR L´INTmRoT DE LA Rm¾EXIVITm DANS LE CADRE DE TRAVAUX SCIENTI½QUES VOIR 0IERRE "OURDIEU 3CIENCE DE LA SCIENCE
ET Rm¾EXIVITm 0ARIS 2AISONS D´!GIR 53)# ¦ ,A FORMATION SOCIALE § LOC CIT P $ANS $ENIS ,EMAsTRE ,A FORMATION HUMAINE DES INGmNIEURS, Paris 05& COLL bDUCATION ET FORMATION CE
LIVRE EST ISSU DE SA THnSE EN SCIENCE DE L´mDUCATION $ENIS ,EMAsTRE &ORMATION HUMAINE DANS LES mCOLES D´IN
GmNIEURS mTUDE DES CONCEPTIONS CONTEMPORAINES DIMENSIONS ANTHROPOLOGIQUE mTHIQUE ET CULTURELLE THnSE EN
SCIENCES DE L´mDUCATION SOUS LA DIRECTION DE -ICHEL &ABRE UNIVERSITm DE .ANTES # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER
!UX ORIGINES DE L´).3!
-ARIE0IERRE %SCUDIm
L
A « POLITIQUE DE L’ESPRIT », telle qu’elle se présente chez Paul ValéU\RXGDQVO·DQDO\VHGHO·±XYUHG·$XJXVWH&RPWH1, propose une
réunion de la politique et de la science, une organisation sociale
fondée sur l’accès à la connaissance. Selon cette tradition qui interroge
comment former l’esprit, voire de qui former l’esprit, l’étude de la penVpHHWGHO·DFWLRQGH*DVWRQ%HUJHUSUpVHQWHXQLQWpUrW'HSOXVO·DFWLRQ
SROLWLTXHGH*%HUJHUGDQVOHGRPDLQHGHO·pGXFDWLRQFRPPHGLUHFWHXU
JpQpUDO GH O·HQVHLJQHPHQW VXSpULHXU HVW VRXWHQXH SDU XQH
pensée philosophique3DFTXLVHGXUDQWVHVDQQpHVG·pWXGHVHW
G·HQVHLJQHPHQWjODIDFXOWpG·$L[0DUVHLOOH
Le problème fondamental qui le préoccupe, porte sur la crise des valeurs
FKH]O·KRPPHPRGHUQHIRUWELHQH[SULPpHSDU3DXO9DOpU\HQ
« […] le monde moderne dans toute sa puissance, en possession d’un
capital technique prodigieux, entièrement pénétré de méthodes positives,
n’a su toutefois se faire ni une politique, ni une morale, ni un idéal, ni des
lois civiles ou pénales, qui soient en harmonie avec les modes de vie qu’il
a crées, et même avec les modes de pensée que la diffusion universelle et
"RUNO +ARSENTI 0OLITIQUE DE L´ESPRIT !UGUSTE #OMTE ET LA NAISSANCE DE LA SCIENCE SOCIALE 0ARIS (ERMANN !NALYSANT L´®UVRE D´!UGUSTE #OMTE " +ARSENTI Dm½NIT LA ¦ POLITIQUE DE L´ESPRIT § COMME UNE POLITIQUE QUI
¦ ;¨= VISE g INSTAURER UNE RmGULATION SOCIALE SUR LA BASE D´UN CERTAIN MODE D´ACCnS DE LA PENSmE g ELLEMoME
ACCnS QU´IL S´AGIT DE DmMOCRATISER ET DE RENDRE DISPONIBLE g TOUS § P 3UZANNE 'UERLAC ¦ ,A POLITIQUE DE L´ESPRIT ET LES USAGES DU CLASSICISME g L´mPOQUE MODERNE § DANS 2EVUE D´HI
STOIRE LITTmRAIRE DE LA &RANCE P $ANS SON INTRODUCTION CETTE mTUDE DE L´HISTOIRE LITTmRAIRE
FAIT mTAT DU DmBAT SUR LES POLITIQUES D´ENSEIGNEMENT AU TOURNANT DU 88E SInCLE 'USTAVE ,ANSON ,´UNIVERSITm ET
LA SOCImTm MODERNE !GATHON ,´ESPRIT DE LA .OUVELLE 3ORBONNE bDOUARD -OROT3IR EXPLIQUE DANS SON PROPOS INTRODUCTIF g L´®UVRE DE ' "ERGER QUE ¦ L´HOMME D´AFFAIRES
S´ ;EST= TRANSFORMm EN UN PROFESSEUR LE PROFESSEUR S´EST LUIMoME CHANGm EN UN ADMINISTRATEUR DE TRnS GRAN
DE CLASSE -AIS AU COURS DE CES MUTATIONS SUCCESSIVES LE PHILOSOPHE RESTAIT IDENTIQUE g LUIMoME § bDOUARD
-OROT3IR ¦ )NTRODUCTION § DANS 'ASTON "ERGER ,´HOMME MODERNE ET SON mDUCATION 0ARIS 05& P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE OH GpYHORSSHPHQW G·XQ FHUWDLQ HVSULW VFLHQWLÀTXH LPSRVHQW SHX j SHX j
tous les hommesª
*DVWRQ%HUJHUUpVXPHFHWWHWHQVLRQHQDIÀUPDQW
©1RWUHGUDPHQHYLHQWSDVGHFHTXHQRXVDYRQVGDYDQWDJHGHPR\HQV
PDLVGHFHTXHQRXVQHVDYRQVSOXVTXHOOHVÀQVSRXUVXLYUHª
8QH©SROLWLTXHGHO·HVSULWªRSqUHXQUDSSURFKHPHQWHQWUHODSHQVpH
et l’action, dans la mesure où elle porte son attention sur la connaissance,
parallèlement à la volonté de connaître les phénomènes. Elle recherche
donc un accomplissement de la science dans le concret.
3DU DLOOHXUV OH WKqPH GH O·pGXFDWLRQ FKH] * %HUJHU SHXW rWUH FRQVLdéré comme le contenu matériel de sa pensée politique. En effet, ses idées
traitent des conditions morales qui doivent animer les hommes, et qui
sont les bases d’une « manière de vivre »7HQGpPRFUDWLHFKH]-RKQ'HZH\
6·LQVSLUDQWGHODSHQVpHGH-'HZH\8, nous relisons le propos suivant de
*DVWRQ %HUJHU © ­ XQ PRQGH TXL HVW HQ FRQVWDQWH pYROXWLRQ GRLW FRUrespondre une adaptation permanente des structures, des programmes et
des méthodes. C’est à l’enseignement supérieur qu’il appartient de la promouvoir9ª,OPHWDLQVLHQpYLGHQFHOHU{OHSROLWLTXHGHO·XQLYHUVLWpGDQVOH
monde moderne, maintenant indirectement le poète dans une dimension
principalement esthétique10/·DFWLRQGH*DVWRQ%HUJHUHQWDQWTXH'*(6
UHFKHUFKHSULQFLSDOHPHQWjSURPRXYRLUODVLJQLÀFDWLRQKXPDLQHGHVSKpnomènes et des institutions11.
Dans cette perspective, la création de l’Institut national des sciences
DSSOLTXpHVHQSDU*DVWRQ%HUJHUQRXVSHUPHWG·pWXGLHUVDWHQWDWLYH
GHUpDOLVDWLRQG·XQH©SROLWLTXHGHO·HVSULWªGDQVOHFDGUHGHODIRUPDWLRQ
des ingénieurs. Cet exemple, qui nous intéresse dans le présent article,
semble posséder les traits caractéristiques d’un réformisme politique par
0AUL 6ALmRY ¦ ,A POLITIQUE DE L´ESPRIT .OTRE SOUVERAIN BIEN § DANS 6ARImTm ))) 0ARIS 'ALLIMARD P 'ASTON "ERGER ¦ ,´HOMME PROMmTHmEN § DANS 0HmNOMmNOLOGIE DU TEMPS ET PROSPECTIVE, 0ARIS 05& P 'ASTON "ERGER 2ECHERCHES SUR LES CONDITIONS DE LA CONNAISSANCE %SSAI D´UNE THmORmTIQUE PURE 0ARIS 05& *OHN $EWEY ¦ ,A DmMOCRATIE CRmATRICE § DANS 2EVUE DU -!533 P 'ASTON "ERGER ,´HOMME MODERNE¨, OP CIT. $IRECTION DE L´ENSEIGNEMENT SUPmRIEUR ¦ ,A RmFORME DE L´ENSEIGNEMENT L´EXPOSm DES MOTIFS § DANS #AHIERS
PmDAGOGIQUES 0ARIS #OMITm UNIVERSITAIRE D´INFORMATION PmDAGOGIQUE JANVIER P !RCHIVES DU #!2!.
& ¯ 0ROJET "ILLnRES
,A FORMATION DES ESPRITS EST PRINCIPALEMENT L´ATTRIBUT DU POnTE AU TEMPS DE 6ICTOR (UGO COMME LE RAPPELLE
3 'UERLAC 3UZANNE 'UERLAC ¦ ,A POLITIQUE DE L´ESPRIT ET LES USAGES DU CLASSICISME g L´mPOQUE MODERNE § LOC
CIT.
)L SEMBLE QUE CETTE MANInRE DE METTRE EN RAPPORT LA PENSmE ET L´ACTION FUT TOUJOURS PRmSENTE CHEZ 'ASTON
"ERGER COMME CELA EST EXPLIQUm PAR bDOUARD -OROT3IR ¦ ,A PHILOSOPHIE EST MmDITATION INDIVIDUELLE AMITIm
ET ENSEIGNEMENT -AIS POUR oTRE PLUS PROFONDmMENT ENGAGmE DANS LE MOUVEMENT HISTORIQUE DES SOCImTmS
ELLE DOIT POSSmDER SA PROPRE FORME SOCIALE S´INCARNER DANS UNE INSTITUTION ¯ DANS UNE SOCImTm EN 'A
STON "ERGER FONDAIT LA 3OCImTm D´mTUDES PHILOSOPHIQUES DE -ARSEILLE IL LA DOTAIT D´UNE REVUE TRIMESTRIELLE ,ES
mTUDES PHILOSOPHIQUES ET D´UNE BIBLIOTHnQUE § DANS 'ASTON "ERGER ,´HOMME MODERNE¨ OP CIT P # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER le biais de la philosophie, de la science et de la technique, jusqu’à tendre
vers une éducation.
,OHVWSRVVLEOHTXHQRWUHpWXGHSXLVVHVHKHXUWHUjODFULWLTXHGHVP\WKHVFRQVWLWXWLIVTX·$ODLQ'URXDUGTXDOLÀHGH©UpFLWVG·RULJLQHª, sur la
création des institutions de recherche et d’enseignement en sciences sociales par la mise en valeur excessive des initiatives individuelles. Toutefois,
nous essaierons de mettre en perspective la pensée et l’action historique
GH*DVWRQ%HUJHUDÀQG·DSSX\HUQRVK\SRWKqVHVVXUVDYLVLRQSROLWLTXH
sans surévaluer cet exemple du point de vue du développement des sciences humaines et sociales13.
1RXVGHYURQVGRQFGpWHUPLQHUTXHOOHVVRQWOHVSULQFLSDOHVLGpHVTXL
QRXUULVVHQW OH SURMHW GH FUpDWLRQ GH O·,16$ FKH] *DVWRQ %HUJHU HW QRXV
étudierons quelles solutions ont été mises en œuvre.
1RXV QRXV LQWpUHVVHURQV HQ SUHPLHU OLHX DX[ DUWLFXODWLRQV HQWUH OHV
sciences humaines et sociales et la méthode prospective dans l’œuvre de
*DVWRQ%HUJHUSXLVQRXVDQDO\VHURQVOHVIRQGHPHQWVGHVHVUpDOLVDWLRQV
SROLWLTXHVGDQVOHGRPDLQHGHO·pGXFDWLRQHQÀQQRXVDUJXPHQWHURQVVXU
O·LGpHTXHO·,16$GH/\RQGDQVVRQHQVHLJQHPHQWGHVVFLHQFHVKXPDLQHV
HWVRFLDOHVHWVDSpGDJRJLHDpWpFRQoXFRPPHOH©OLHXªFRQFUHWG·XQH
utopie éducative.
$9.!-)3%2 ,%3 3#)%.#%3 (5-!).%3 5.% 0%.3b% 02/30%#4)6%
'XIDLWGXSURJUqVVFLHQWLÀTXHHWWHFKQLTXHO·pSRTXHGH*DVWRQ%HUJHU
se rend attentive au phénomène d’accélération du monde moderne. Par
ailleurs, l’omniprésence de la culture, comme caractéristique de l’état de
conscience des sociétés européennes, impose le développement des scienFHVKXPDLQHVHWVRFLDOHVDÀQGHO·pWXGLHU&HSHQGDQWODFULVHSKLORVRSKLTXHGHO·HVSULWPLVHHQpYLGHQFHSDU(GPXQG+XVVHUOHWTXLLQÁXHQFH
!LAIN $ROUARD ¦ 2m¾EXIONS SUR UNE CHRONOLOGIE ,E DmVELOPPEMENT DES SCIENCES SOCIALES EN &RANCE DE g
LA ½N DES ANNmES SOIXANTE § DANS 2EVUE FRANlAISE DE SOCIOLOGIE P )L EST OPPORTUN DE SIGNALER DES TRAVAUX EN COURS QUI PERMETTENT DE POURSUIVRE NOTRE mTUDE )L S´AGIT DE RECHER
CHES EN COURS SUR LA MISE EN RmSEAU DES INVENTEURS DE L´).3! ,ABORATOIRE 34/)#! DE L´).3! DE ,YON -ARIANNE
#HOUTEAU *OpLLE &OREST ET #mLINE .GUYEN ¦ )L mTAIT UNE FOIS L´).3!¨5N RmSEAU D´HOMMES RmFORMATEURS § ARTI
CLE g PARAsTRE EN DANS UN OUVRAGE DIRIGm PAR 6IRGINIE #AMPEAU&ONTENEAU ET 2ENAUD $´%NFERT QUI NOUS
INDIQUERONT DANS QUELLE MESURE 'ASTON "ERGER A mTm IN¾UENCm PAR LES IDmES DES AUTRES FONDATEURS DE CE PRO
JET LE RECTEUR *EAN #APELLE LE PRmSIDENT DU #ONSEIL SUPmRIEUR DE LA RECHERCHE SCIENTI½QUE ET DU PROGRnS TECH
NIQUE (ENRI ,ONGCHAMBON LE MINISTRE 2ENm "ILLnRES 5NE LIMITE DE NOTRE ARTICLE PORTE SUR L´mTUDE PARTICULInRE
DU DmVELOPPEMENT DES SCIENCES HUMAINES ET SOCIALES g L´).3! QUI NE PREND PAS EN COMPTE LA LONGUE HISTOIRE
DE CETTE PROMOTION DANS LES mCOLES D´INGmNIEURS THnSE EN COURS D´!NTOINE $EROUET ,ES SCIENCES HUMAINES ET
SOCIALES DANS LES CURSUS DE FORMATION D´INGmNIEURS DE g #ENTRE -AURICE(ALBWACHS mQUIPE 0ROFES
SIONS RmSEAUX ORGANISATIONS ET QUI A NmCESSAIREMENT IN¾UENCm LES CHOIX OPmRmS DANS LE CADRE DE L´).3!
Krisis %DMUND (USSERL ,A CRISE DES SCIENCES EUROPmENNES ET LA PHmNOMmNOLOGIE TRANSCENDANTALE
0ARIS 'ALLIMARD 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE SURIRQGpPHQWODSHQVpHGH*%HUJHUSRVHOHSUREOqPHGHVIRQFWLRQVTXH
peuvent assumer la philosophie et les sciences. En effet, le mouvement
universel qui s’exerce dans la philosophie et dans les sciences et qui aniPHODWUDQVIRUPDWLRQGHO·KXPDQLWpVHORQ+XVVHUOUHFXOHDXSURÀWG·XQH
tendance objectiviste centrée sur les manifestions empiriques. Ainsi, les
sciences humaines et sociales sont progressivement divisées et fondamentalement vidées de sens.
­ SDUWLU GH FH FRQVWDW *DVWRQ %HUJHU DERUGH OD TXHVWLRQ GHV VFLHQFHV
humaines et sociales avec une profonde intention philosophique. L’apSRUW VLJQLÀFDWLI GH VD SHQVpH VH PDQLIHVWH SDU OD FRQFHSWXDOLVDWLRQ GH OD
prospective en France, présentée moins comme une science indépendante,
TXHFRPPHXQW\SHG·HVSULWHWXQHPpWKRGHTXLHQJHQGUHQWXQH©DWWLWXGH
SURVSHFWLYHª/·K\SRWKqVHTXHQRXVDOORQVGpYHORSSHUFRQVLVWHjSHQVHU
TXHFHWWH©DWWLWXGHSURVSHFWLYHªYLHQWQRXUULUXQHQRXYHOOHFRQFHSWLRQGHV
VFLHQFHVKXPDLQHVHWVRFLDOHVFKH]*DVWRQ%HUJHUGRQWO·H[SUHVVLRQIXWQRWDPPHQWSUpFLVpHGDQVODGLVFLSOLQHGHO·©DQWKURSRORJLHSURVSHFWLYHª17.
,´ANTHROPOLOGIE PROSPECTIVE ATTITUDE ET MmTHODE
*%HUJHUSURSRVHOHSUREOqPHGXWHPSVFRPPHEDVHGHVDUpÁH[LRQ
épistémologique sur l’anthropologie prospective. Il le présente comme
XQH FULWLTXH GX GpWHUPLQLVPH KLVWRULTXH /H IRQGHPHQW VFLHQWLÀTXH GH
l’anthropologie prospective se situe chez lui dans la nécessité de rompre
avec les méthodes observées dans les sciences de la nature d’une part, qui
recherchent des régularités, et dans les sciences humaines d’autre part,
TXLIRQFWLRQQHQWVXUODUHFKHUFKHGHSUpFpGHQWV*%HUJHUSURSRVHDORUV
une véritable libération des modes opératoires de la science, en faisant
EDVFXOHUOHUHJDUGVFLHQWLÀTXHGXSDVVpYHUVO·DYHQLU6RQLGpHFRQVLVWHj
examiner les problèmes du monde à long terme, et par là même, tenter de
se saisir de la destinée humaine. L’anthropologie prospective tire sa substance tant de l’histoire que de la philosophie. En effet, elle ne se limite pas
jODSUpYLVLRQVHORQQRWUHDXWHXUFHTXLQ·DXUDLWTX·XQHYDOLGLWpVFLHQWLÀque assez mince. Au contraire, nous pensons qu’elle prend appui, dans sa
constitution, sur une théorie de la connaissance.
)L EST REMARQUABLE QUE CETTE DmMARCHE PHILOSOPHIQUE SOIT FORTEMENT IN¾UENCmE PAR LA PENSmE D´%DMUND
(USSERL QUE ' "ERGER mTUDIE DANS SES DEUX THnSES DE DOCTORAT INTITULmES 2ECHERCHES SUR LES CONDITIONS DE LA
CONNAISSANCE %SSAI D´UNE THmORmTIQUE PURE OP CIT. ET ,E COGITO DANS LA PENSmE DE (USSERL 0ARIS 05& 'ASTON "ERGER ¦ ,´ATTITUDE PROSPECTIVE § DANS 'ASTON "ERGER *ACQUES DE "OURDON"USSET 0IERRE -ASSE $E LA
PROSPECTIVE 0ARIS ,´(ARMATTAN E mDITION P ,´¦ ANTHROPOLOGIE PROSPECTIVE § mTAIT LE TITRE DU COURS QU´AVAIT CHOISI 'ASTON "ERGER DANS LE CADRE DE LA CHAIRE
QUI LUI mTAIT PROPOSmE g L´bCOLE DES HAUTES mTUDES EN SCIENCES SOCIALES g PARTIR DE #E COURS N´A JAMAIS mTm
ENTAMm EN RAISON DE SON DmCnS PRmMATURm LA MoME ANNmE
# DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER 'XSRLQWGHYXHDQDO\WLTXHVDUpÁH[LRQV·DUWLFXOHDXWRXUG·XQUDWLRnalisme, hérité de la raison pratique qui considère que le jugement est un
DFWHDVVRFLpjXQHFRQQDLVVDQFHHPSLULTXHGHVFKRVHV0DLVFHWWHUpÁH[LRQ
trouve son sens dans l’exercice de l’imagination. Dans Juger +DQQDK
$UHQGWDQDO\VDQWODSHQVpHG·(PPDQXHO.DQWPRQWUHTX·HQFRQVLGpUDQW
les phénomènes donnés à l’intuition, il est possible de prendre conscience
de quelque chose qui n’apparaît pas. Par conséquent, « L’imagination n’a
pas besoin d’être guidée par cette association temporelle [La conception
linéaire du temps qui ramène dans le présent ce qui est passé ou ce qui
représente le futur, n’est pas un caractère nécessaire pour l’imagination] ;
elle peut, à volonté, rendre présent tout ce qu’elle choisit18ª L’imaginaWLRQDXVHQVNDQWLHQVHUHWURXYHGDQVODSHQVpHGH*DVWRQ%HUJHUGDQVOH
lien entre sensibilité et connaissance au sein de la démarche prospective.
Mais la méthode prospective, mise en œuvre par notre auteur, est surtout issue de la phénoménologie, car elle permet de « dégager les strucWXUHVSURIRQGHVGHVSKpQRPqQHVª19. Elle s’ajoute au recueil de résultats
FRQFUHWV SURGXLWV SDU OD VWDWLVWLTXH /·REMHW G·DQDO\VH GH *DVWRQ %HUJHU
comprend les actions humaines, qui renferment l’être et le sens. Ainsi,
O·DQDO\VH SKpQRPpQRORJLTXH SRUWH VXU OHV LQWHQWLRQV KXPDLQHV SURIRQdes dans le domaine de l’action, donc le domaine de la vie. Le rôle de
la statistique, méthode novatrice à cette époque, développée en France
SDU-HDQ6WRHW]HOHVWSXUHPHQWTXDQWLWDWLI*%HUJHUH[SOLTXHTXH©/HV
éléments matériels qu’atteindra l’inventaire ne seront plus alors que des
signes permettant de retrouver le mouvement spontané dont ils jalonnent
le développementª
&HGRXEOHDSSRUWGHO·DQDO\VHSKpQRPpQRORJLTXHHWGHODVWDWLVWLTXH
permet de s’extraire en partie de la description. La prospective possède
FHUWHVXQIRQGHPHQWHPSLULTXHPDLVFRPSRUWHFHWWHLGpHTXH©WRXWHDIÀUPDWLRQ\HVWUpÁH[LYHHWWRXWHUpÁH[LRQFUpDWULFHª.
0HILOSOPHIE ET SCIENCES HUMAINES ET SOCIALES
/HV©VFLHQFHVKXPDLQHVSURVSHFWLYHVªRXO·DQWKURSRORJLHSURVSHFWLYH
représentent, selon nous, une rupture de paradigme, comme le décrit simSOHPHQWOHXUDXWHXU©GX´YRLUµDX´IDLUHµª. Cette désignation « scien
(ANNAH !RENDT *UGER 0ARIS bDITIONS DU 3EUIL P 'ASTON "ERGER ¦ ,´HOMME ET SES PROBLnMES DANS LE MONDE DE DEMAIN %SSAI D´ANTHROPOLOGIE PROSPECTIVE §
DANS 'ASTON "ERGER *ACQUES DE "OURDON"USSET 0IERRE -ASSE $E LA PROSPECTIVE OP CIT. P 'ASTON "ERGER ¦ ,´AVENIR DES SCIENCES DE L´HOMME § DANS 'ASTON "ERGER *ACQUES DE "OURBON"USSET 0IERRE
-ASSE $E LA PROSPECTIVE OP CIT. P )BIDEM.
'ASTON "ERGER ¦ -mTHODE ET RmSULTATS § DANS 'ASTON "ERGER *ACQUES DE "OURDON"USSET 0IERRE -ASSE $E LA
PROSPECTIVE OP CIT. P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE FHV KXPDLQHV HW VRFLDOHV SURVSHFWLYHV ª TXL HVW OD Q{WUH D SRXU EXW GH
souligner le mouvement d’ensemble, que crée la prospective dans la penVpHGH*DVWRQ%HUJHUHQDSSOLTXDQWFHUHQRXYHDXPpWKRGRORJLTXHYRLUH
épistémologique, sur les sciences humaines et sociales. L’objet d’étude de
FHVVFLHQFHVV·HQWURXYHPRGLÀpSXLVTX·LOQHV·DJLWSOXVGHUHWURXYHUOHV
habitudes chez l’homme mais ce qu’il peut devenir de nouveau. La part
de créativité de ces sciences se met en œuvre spontanément, rappelant
FHUWDLQHPHQWO·DWWDFKHPHQWSKLORVRSKLTXHGH*DVWRQ%HUJHUj+HQUL%HUJson. Par ailleurs, dans sa conception, les réalités humaines et sociales sont
reliées à la conscience. L’importance de la conscience oriente les sciences
YHUVXQHUHFKHUFKH©LQWHQWLRQQHOOHªHQVRFLRORJLHRXHQSV\FKRORJLH/D
structure sociale qui est alors étudiée se compose des relations intersubjectives des individus, compris comme personnes, car « […] l’acte humain
fondamental […] est à la fois la rencontre de deux natures et la reconnaisVDQFHGHGHX[OLEHUWpVª.
/HVWDWXWTXH*DVWRQ%HUJHUGRQQHDX[©VFLHQFHVKXPDLQHVLQWHQWLRQQHOOHVª se situe à un niveau positiviste, qui n’a pas vocation à produire
des applications mais à questionner leurs implications. C’est dans ce sens
que doit s’effectuer la collaboration entre des philosophes, préoccupés des
ÀQV HW GHV YDOHXUV KXPDLQHV HW GHV VSpFLDOLVWHV LQIRUPpV GHV UpDOLWpV HW
des techniques de leur domaine. En observant les maîtres qui entourent
*DVWRQ%HUJHUSHQGDQWVRQDSSUHQWLVVDJHSKLORVRSKLTXH5HQp/H6HQQH
notamment, il est possible de rapprocher l’auteur de la prospective de la
volonté de ces philosophes chrétiens de l’entre-deux-guerres, qui souhaiWDLHQW © UHVSLULWXDOLVHU ª OD SKLORVRSKLH VDQV UHQRQFHU DX[ DYDQFpHV GHV
sciences sociales. En somme, l’anthropologie prospective se caractérise
GRQFjODIRLVFRPPHSURIRQGHHWV\QWKpWLTXH
/DIRUPDOLVDWLRQGHODSURVSHFWLYHFKH]*DVWRQ%HUJHUQDvWVXUODEDVH
d’une critique de la décision publique, comme le rappelle Philippe Durance. En effet, l’originalité de cette idée, qui se développe dans le contexte
GX UHWRXU GH O·eWDW HQ )UDQFH HVW GH SRVVpGHU XQ EXW PpWDSK\VLTXH HW
pratique, autrement dit, d’envisager une rationalisation des choix politi
¦ ª L´IMPITOYABLE LOI NATURELLE NOUS ENTENDONS SUBSTITUER UNE LOI PLUS HUMAINE § 'ASTON "ERGER ¦ 3CIENCES
HUMAINES ET PRmVISION § 0HmNOMmNOLOGIE DU TEMPS¨ OP CIT P )L EST POSSIBLE DE NOURRIR CETTE QUESTION CHEZ 'ASTON "ERGER GRhCE g L´APPORT DU PERSONNALISME
'ASTON "ERGER ¦ ,´AVENIR DES SCIENCES DE L´HOMME § DANS 'ASTON "ERGER *ACQUES DE "OURBON"USSET 0IERRE
-ASSE $E LA PROSPECTIVE OP CIT P )BIDEM P ¦ ,A MmTHODE QUE NOUS CHERCHONS ICI N´EST PAS DANS LES CHOSES MAIS DANS L´HOMME %LLE N´EST PAS UNE LOI DE
L´OBJET MAIS UNE RnGLE POUR LE SUJET § 'ASTON "ERGER ¦ -mTHODE ET RmSULTATS § DANS 'ASTON "ERGER *ACQUES DE
"OURBON"USSET 0IERRE -ASSE $E LA PROSPECTIVE OP CIT P 'UILLAUME 3TANKIEWICZ ¦ #OMMENT EN ½NIR AVEC UNE TRADITION DOMINANTE § RUPTURE ET CONTINUITm DANS LA
TRAJECTOIRE DE *EAN 3TOETZEL § DANS 2EVUE D´HISTOIRE DES SCIENCES HUMAINES P 0HILIPPE $URANCE ¦ ,A PROSPECTIVE DE 'ASTON "ERGER § DANS 'ASTON "ERGER *ACQUES DE "OURBON"USSET 0IERRE
-ASSE $E LA PROSPECTIVE OP CIT. P # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER ques, économiques et techniques, tout en pensant les problèmes humains.
La question de la rationalisation des choix, développée parallèlement aux
eWDWV8QLVPRQWUHTXHFHTXLpWDLWXQSUREOqPHPpWDSK\VLTXHGXWHPSV
SRXU*DVWRQ%HUJHUVHWUDQVIRUPHHQSUREOqPHSROLWLTXH(QHIIHWLOFULWLque l’intérêt que les hommes d’action expriment pour les sciences humaines et sociales, qui leur apportent des solutions faciles à un niveau empirique, sur le modèle du prêt-à-penser30. Pour lui, l’implication politique de
la question des choix l’engage à poursuivre son projet philosophique, en
DIÀUPDQWOjHQFRUHXQHVXSpULRULWpGHODUDLVRQHWGHVYDOHXUV
%HUJHUSHQVHTXH
©&·HVWO·KRPPHPR\HQTXLDGDSWHVHVÀQVDX[PR\HQVTX·LOD/HJUDQG
homme d’État, comme l’homme de génie, sait avoir cette vision de l’avenir
et cette constance dans les desseins qui permettent de changer le monde et
de promouvoir une réalité meilleure. […] Un véritable homme d’État choisit
VHVÀQVHWV·DSSOLTXHjFUpHUOHVPR\HQVGHODSROLWLTXHTX·LOYHXWIDLUH31ª
En outre, l’objectif principal de la prospective est de s’inscrire dans l’action, comme un véritable moteur du gouvernement. Dans cette perspective,
l’attitude prospective tend à transcender l’homme politique, qui correspond
DX©SKLORVRSKHHQDFWLRQªFKHUj*%HUJHU,OSUpFLVHG·DLOOHXUV©&HODYHXW
GLUHTXHO·DFWLRQHVWODUDLVRQPrPHGHVDIRQFWLRQPDLVTXHODUpÁH[LRQOD
plus large et la plus compréhensive doit orienter sa décision…ª
Par conséquent, la promotion de « sciences humaines et sociales prosSHFWLYHV ª SHXW rWUH LQWHUSUpWpH FRPPH XQ SURMHW LQWHOOHFWXHO UHODWLI DX[
VFLHQFHVPRUDOHVHWSROLWLTXHV1RXVVRXOLJQRQVQRWDPPHQWODFRQFRPLWDQFHHQWUHODPXOWLSOLFDWLRQGHVpFULWVGH*DVWRQ%HUJHUVXUODSURVSHFWLYH
et sa nomination à l’Académie des sciences morales et politiques33, à partir
GH1RXVSHQVRQVTXHVDSHQVpHHVWSURFKHGHFHOOHGHO·$FDGpPLH
qui, par la connaissance des mœurs humaines, de leur contingence et de
leur nécessité, tente de trouver les formes d’organisation politique les plus
favorables au bien public et à l’épanouissement de l’individu.
,OQRXVUHVWHjpWXGLHUGHTXHOOHIDoRQ*DVWRQ%HUJHUYDPHWWUHHQ±Xvre la pensée exposée ci-dessus dans le cadre de ses réalisations politiques
dans le domaine de l’éducation.
"ERGER LES NOMME DES ¦ UTILISATEURS § 'ASTON "ERGER ¦ ,´AVENIR DES SCIENCES DE L´HOMME § DANS 'ASTON "ER
GER *ACQUES DE "OURBON"USSET 0IERRE -ASSE $E LA PROSPECTIVE OP CIT P 'ASTON "ERGER ¦ ,E PROBLnME DES CHOIX FACTEURS POLITIQUES ET FACTEURS TECHNIQUES § DANS 'ASTON "ERGER
*ACQUES DE "OURBON"USSET 0IERRE -ASSE $E LA PROSPECTIVE OP CIT. P )BIDEM P 'ASTON "ERGER EST mLU MEMBRE DE LA SECTION 0HILOSOPHIE AU FAUTEUIL EN JUSQU´g SA MORT EN EN
REMPLACEMENT DE SON MAsTRE 2ENm ,E 3ENNE
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE 2%&/.$%2 ,´(5-!.)3-% 4%#(.)15% %4 b$5#!4)/.
*DVWRQ%HUJHUHVWSURPXGLUHFWHXUJpQpUDOGHO·HQVHLJQHPHQWVXSpULHXU
HQ. Sa tâche d’administrateur a profondément marqué l’histoire de
l’administration de l’enseignement supérieur, lui qui « voulait consacrer
WRXWHVVHVIRUFHVjXQH±XYUHGHYDOHXUª/HVDQQpHVVRQWXQHSpriode de prise de conscience de la complexité du monde moderne, aux valeurs instables, en confrontation directe avec les progrès de la technique.
*XLGpSDUODSUREOpPDWLTXHGXWHPSV*DVWRQ%HUJHUPHWHQ±XYUHXQH
action en faveur de l’éducation, dans un contexte politico-administratif
volontariste et parlementaire. À cette occasion, il donne à sa pensée un
FDUDFWqUHTXHO·RQTXDOLÀHUDG·KXPDQLVWHHQVRXKDLWDQWXQHUpXQLRQGHV
sciences humaines et sociales autour de l’étude phénoménologique de la
WHFKQLTXHSRXUDVVXUHUOHERQKHXUGHVKRPPHV1RXVQRXVLQWpUHVVHURQV
GRQFDX[OLHQVTXHWLVVH*DVWRQ%HUJHUHQWUHFXOWXUHHWWHFKQLTXHHWTXLVH
trouvent engagés dans son action pour la formation de l’ingénieur.
5N CONTEXTE FAVORABLE ET UNE ACTION RmFORMISTE
En France, une nouvelle mobilisation politique autour des questions
de l’enseignement et de la recherche débute vers les années 1930, mais elle
ne devient décisive que pendant l’expérience gouvernementale de Pierre
0HQGqV)UDQFHHQ. Le réseau d’acteurs politiques, d’adminisWUDWHXUV HW GH VDYDQWV TXL JUDYLWH DXWRXU GX SUREOqPH VFLHQWLÀTXH j FH
moment, a été mis en évidence par l’étude d’Alain Chatriot et Vincent
Duclert. Les auteurs insistent notamment sur la cristallisation de ces quesWLRQVORUVGXFROORTXHGH&DHQRUJDQLVpSDU3LHUUH0HQGqV)UDQFHHQ
HW TXL IXW XQ YpULWDEOH VXFFqV SROLWLTXH ­ SDUWLU GH FHWWH DQDO\VH QRWUH
SURSRVWHQGjDSSRUWHUXQpFODLUDJHSDUWLFXOLHUVXUOHU{OHGH*DVWRQ%HUJHUGDQVFHPRPHQWGH©SDUOHPHQWGHODVFLHQFHª37, auquel il a participé
en défendant avec conviction la place des sciences humaines. Ces journées
de Caen marquent, du point de vue idéologique, la volonté de mettre en
±XYUHXQ©YpULWDEOHKXPDQLVPHª38. Les thèmes de la démocratisation de
)L EST NOMMm DIRECTEUR ADJOINT DE L´ENSEIGNEMENT SUPmRIEUR UN AN PLUS TxT EN ,E DISCOURS DE &ERNAND "RAUDEL g SON SUJET EST mLOQUENT IL PRmCISE DANS SON HOMMAGE ¦ !VOCAT DES FRAGILES
SCIENCES HUMAINES EN &RANCE ET HORS DE &RANCE IL A mTm MAGNI½QUE DANS SES COMBATS ET INTERVENTIONS § &ERNAND
"RAUDEL ¦ 'ASTON "ERGER § DANS !NNALES bCONOMIES 3OCImTmS #IVILISATIONS P !LAIN #HATRIOT 6INCENT $UCLERT DIR ,E GOUVERNEMENT DE LA RECHERCHE (ISTOIRE D´UN ENGAGEMENT POLITIQUE DE
0IERRE -ENDnS &RANCE g #HARLES DE 'AULLE 0ARIS ,A $mCOUVERTE ET 6INCENT $UCLERT ¦ ,E COLLOQUE DE #AEN
¯ ,A )6E 2mPUBLIQUE ET LA MOBILISATION SCIENTI½QUE § DANS (ISTORIENS ET GmOGRAPHES MARSAVRIL P 6INCENT $UCLERT ¦ ,E COLLOQUE DE #AEN ¯ ¨ § LOC CIT.
¦ ,ES DOUZE POINTS DU COLLOQUE DE #AEN § DANS !LAIN #HATRIOT 6INCENT $UCLERT DIR ,E GOUVERNEMENT DE LA
RECHERCHE (ISTOIRE D´UN ENGAGEMENT POLITIQUE DE 0IERRE -ENDnS &RANCE g #HARLES DE 'AULLE OP CIT. P # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER l’enseignement et de l’accroissement du nombre des savants sont jugés
SULRULWDLUHVDÀQG·DQLPHUODYLHUpSXEOLFDLQH&RQFHUQDQW*DVWRQ%HUJHU
nous noterons que sa proposition de former des « cadres supérieurs de
OD QDWLRQ ª39 exprime ce besoin impérieux d’intelligence et de créativité
individuelle et collective.
Pendant cette période de réforme de l’enseignement, portée par le ministre de l’Éducation nationale, René Billères, les efforts se concentrent sur
l’organisation et le développement de l’enseignement technique en France. Ce dernier constitue une préoccupation fondamentale dans ces années
de rationalisation politique et économique, considérant que « Former davantage d’ingénieurs, de chercheurs et de techniciens, [est la] condition
essentielle de notre développement économiqueª1RXVVXJJpURQVTXH
SRXU*DVWRQ%HUJHUF·HVWjSDUWLUGHFHWWHQpFHVVLWpGHIRUPDWLRQWHFKQLque, que la question des sciences humaines et sociales trouve des conditions de possibilité pour s’institutionnaliser et se légitimer ensuite.
Cette idée est illustrée au sein des Cahiers de la République, dans le nuPpURTXLÀWVXLWHDXFROORTXHGH&DHQ&ODXGH1LFROHWVRXOLJQHO·LQWpUrW
de promouvoir l’ingénieur dans l’organisation de la République. L’organisation économique assurée par le technicien est indispensable à la démocratie, selon lui, à condition que l’exercice du pouvoir politique reste
DXFLWR\HQ,OIDXWSRXUFHODTXHO·LQJpQLHXUVRLWpGXTXpDÀQGHJDUDQWLU
sa liberté. Du point de vue idéologique, cette éducation entraîne le « vériWDEOHKXPDQLVPHªVRXKDLWpDXFROORTXHGH&DHQ©0DLVXQKXPDQLVPH
TXL VHUDLW H[FOXVLYHPHQW © VFLHQWLÀTXH ª FRPPH G·DLOOHXUV OLWWpUDLUH QH
serait pas un humanisme, ce mot n’admet pas d’adjectifª&HWWHOHFWXUH
humaniste des projets de la science et de l’enseignement s’exprime publiTXHPHQWFKH]*DVWRQ%HUJHUHWGHIDoRQFRQFUqWHFRPPHQRXVOHYHUURQV
SDUODVXLWH'·DLOOHXUV9LQFHQW'XFOHUWDIÀUPHTXH©/·XOWLPHDFTXLVGX
colloque de Caen tient dans l’intérêt critique qu’il a pu nourrir auprès des
VFLHQFHVKXPDLQHVGRQWODSODFHpWDLWUHVWpHVHFRQGDLUHPDOJUpOHSODLGR\HU
GH*DVWRQ%HUJHUª&HWWHIHQrWUHG·RSSRUWXQLWpTXLV·RXYUHDSUqVOHFROloque est immédiatement saisie par notre administrateur, qui tente alors
GHGRQQHUDX[VFLHQFHVKXPDLQHVHWVRFLDOHVXQUpHOPR\HQG·H[LVWHU/H
numéro des Cahiers de la République, qui témoigne de la pensée politique
'ASTON "ERGER ¦ ,´ACCmLmRATION DE L´HISTOIRE ET SES CONSmQUENCES SUR L´mDUCATION § ,´HOMME MODERNE¨ OP CIT
P -INISTnRE DE L´bDUCATION NATIONALE NOTE HEBDOMADAIRE D´INFORMATION N€ JUILLET ¦ ,´EFFORT DU MINI
STnRE DE L´bDUCATION NATIONALE DEPUIS MOIS EN FAVEUR DES mTUDES SCIENTI½QUES ET TECHNIQUES § P ARCHIVES
DU #!2!. & ¯ 0ROJET "ILLnRES
#LAUDE .ICOLET ¦ ,A SCIENCE DANS LA 2mPUBLIQUE § DANS ,ES CAHIERS DE LA 2mPUBLIQUE JANVIERFmVRIER P ARCHIVES DU #!2!. & ¯ #OLLOQUE DE #AEN
6INCENT $UCLERT ¦ ,E COLLOQUE DE #AEN ¯ ¨ § LOC CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE exposée par ses rédacteursSXEOLHXQHLGpHRULJLQDOHGH*DVWRQ%HUJHUj
VDYRLUFUpHUXQH©0DLVRQGHVVFLHQFHVVRFLDOHVª, dans laquelle il se trouverait des bibliothèques, des ressources et le respect de l’indépendance des
groupes de recherche et des individus. Avec l’appui de Fernand Braudel,
OD0DLVRQGHVVFLHQFHVGHO·+RPPHHVWFUppHDXGpEXWGHVDQQpHV
Auparavant, cette amitié avait fait naître le projet de cours d’« anthropoORJLHSURVSHFWLYHªGH*DVWRQ%HUJHUTXLDYDLWYRFDWLRQjrWUHHQVHLJQp
GqV j OD 9,e section de l’École pratique des hautes études. Ce fait
WpPRLJQHSDUWLFXOLqUHPHQWGHO·HQJDJHPHQWSULVSDU*DVWRQ%HUJHUSRXU
les sciences humaines et sociales, puisqu’il allait revenir à l’enseignement,
transmettre sa pensée prospective et se soumettre à la critique. Par ailleurs,
LODYDLWLQWURGXLWGDQVFHWWHpFROHGHVpWXGHVGXW\SH©DUHDVWXGLHVªTXL
traitent des grands espaces politiques et culturels du monde1RWUHOLVWH
Q·D SDV YRFDWLRQ j rWUH H[KDXVWLYH G·DLOOHXUV OHV DFWLRQV GH *DVWRQ %HUger dans le domaine de l’éducation sont encore nombreuses, comme la
FUpDWLRQGHV,QVWLWXWVG·DGPLQLVWUDWLRQGHVHQWUHSULVHV,$(HQWUHHW
O·LQLWLDWLYHG·pFKDQJHVG·pWXGLDQWVHWGHFKHUFKHXUVHQWUHOD)UDQFH
HWOHVeWDWV8QLVFRPPLVVLRQ)XOEULJKWjSDUWLUGHTXLSUpÀJXUHQW
GpMj VD FRQVpFUDWLRQ DGPLQLVWUDWLYH 'qV ORUV O·DFWLRQ GH *DVWRQ %HUJHU
est exemplaire d’un investissement important dans le développement des
sciences humaines et sociales, dans le but de former un homme nouveau,
TXHQRXVQRPPHURQVK\SRWKpWLTXHPHQWOHFLWR\HQ
3CIENCES HUMAINES ET TECHNIQUE
/·RULJLQDOLWpHWODFRPSOH[LWpGHO·KXPDQLVPHGH*DVWRQ%HUJHUVHVLtuent dans sa pensée et son action en faveur du problème de la technique.
6DUpÁH[LRQSRUWHVXUODFULWLTXHGHVVFLHQFHVDSSOLTXpHVHWVHVUDSSRUWV
avec la culture. Bien que peu théorisée, la technique est représentée dans
O·±XYUHGH*%HUJHUFRPPHXQHFUpDWLRQKXPDLQHGRQWOHSURFHVVXVHVW
RUGRQQpjXQHRSpUDWLRQ©FRQVFLHQWHUDLVRQQpHHWYRORQWDLUHª. La technique prend donc part à l’action des hommes de façon naturelle, comme
OHUpVXPH%HUJHU
.OUS RAPPELONS QUE CETTE REVUE INITImE PAR 0IERRE -ENDnS &RANCE EST PERlUE COMME UN VRAI INSTRUMENT
POLITIQUE NON PARTISAN
'ASTON "ERGER ¦ ,ES SCIENCES HUMAINES § DANS ,ES CAHIERS DE LA 2mPUBLIQUE JANVIERFmVRIER P ARCHIVES
DU #!2!. & ¯ #OLLOQUE DE #AEN
' "ERGER DmCnDE AU COURS DE CETTE MoME ANNmE
&AIT RELATm PAR (ENRI ,ONGCHAMBON QUI AJOUTE ¦ 5N DES RxLES ESSENTIELS DES SCIENCES HUMAINES EST LA DIF½CILE
PROSPECTION DU MONDE ACTUEL § (ENRI ,ONGCHAMBON ¦ ,ES SCIENCES SOCIALES EN &RANCE 5N BILAN UN PROGRAM
ME § DANS !NNALES bCONOMIES 3OCImTmS #IVILISATIONS P 'ASTON "ERGER ¦ (UMANISME ET TECHNIQUE § DANS 'ASTON "ERGER *ACQUES DE "OURBON"USSET 0IERRE -ASSE
$E LA PROSPECTIVE OP CIT P # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER « Toute action transforme le monde conformément à la nature de l’agent.
2ULOHVWGDQVODQDWXUHGHO·KRPPHG·DJLUUDLVRQQDEOHPHQWF·HVWjGLUHGH
prévoir autant qu’il le peut la conséquence de ses actes. L’outil prolonge le
bras d’une manière aussi naturelle que la griffe prolonge la patteª
2XHQFRUH
« L’homme est un animal raisonnable et l’intelligence est une de ses
facultés. Il est aussi naturel pour l’homme de fabriquer des instruments
que pour l’espèce d’acquérir des dispositions organiques adaptées aux
circonstancesª
,O HVW LQWpUHVVDQW G·DQDO\VHU FHWWH ÀJXUH DQDORJLTXH HQWUH O·KRPPH HW
l’animal, la technique prenant place naturellement dans le développement
KXPDLQGpÀQLFRPPHG·RUGUHELRORJLTXHSDUQRWUHDXWHXU'HFHIDLWOD
WHFKQLTXHTXLHVWHQWHQGXHFRPPHXQVLPSOHPR\HQIDLWSRXUO·KRPPH
HVWDYDQWWRXWXQHSURSULpWpGHO·KRPPHXQ©RUJDQHª, qui lui permet
G·DWWHLQGUHXQHÀQYRXOXH3DUFRQVpTXHQWOHVDFWLRQVKXPDLQHVUHVWHQW
des aspirations, des manifestations de la valeur, qui dévoilent leur identité
et leur sens dans les œuvres des génies littéraires, artistiques et profesVLRQQHOV$LQVL*DVWRQ%HUJHUSHQVHTXHODFRQQDLVVDQFHGXPRQGHQRXV
parvient non pas grâce à la technique en elle-même mais par l’étude de
l’homme et de sa relation à la technique. En cela, il devient nécessaire de
mettre au cœur de notre monde technique l’apport des sciences humaines
HWVRFLDOHV/·KXPDQLVPHGH*DVWRQ%HUJHUVHSURSRVHG·pWXGLHUOHVUpDlisations humaines grâce à l’ensemble des sciences humaines et sociales
prospectives et à l’apport de la philologie qui ramène les valeurs au centre
GHFHOOHFL&HWWHSUREOpPDWLTXHUpXQLÀHOHVVFLHQFHVKXPDLQHVHWVRFLDOHV
et leur donne un objet, les actes techniques humains (ou la technique). Car
F·HVWDLQVLTXH%HUJHUTXDOLÀDLWODWHFKQLTXH
©,O\DWHFKQLTXHWRXWHVOHVIRLVTXHOHWUDYDLOHVWKXPDLQF·HVWjGLUHWRXtes les fois que l’homme au lieu d’attendre d’une sorte de loi que les chefsG·±XYUHVHIDVVHQWWRXWVHXOVFRQVHQWjUpÁpFKLUjHPSOR\HUVRQLQWHOOLJHQFH
tout son savoir, tout son courage, toute sa patience à la rechercheª
L’étude critique de la technique par les sciences humaines et sociales
montre que cette dernière ne doit pas résoudre seule les problèmes de la soFLpWp3DUDOOqOHPHQW%HUJHUpQRQFHGDQV©+XPDQLVPHHWWHFKQLTXHª©/D
)BIDEM P 'ASTON "ERGER ¦ ,´HOMME ET LA TECHNIQUE § DANS %NCYCLOPmDIE FRANlAISE ¦ ,A VIE QUOTIDIENNE § TOME 0ARIS
3OCImTm DE L´%NCYCLOPmDIE FRANlAISE P )DEM. "ERGER PRmCISE QUE LES MACHINES SONT DES ¦ ORGANES § ET NON DES ¦ oTRES §
6OIR g CE SUJET LA CONFUSION QU´EXPRIME 'ASTON "ERGER SUR LES THnSES ORIGINALES DE 'ILBERT 3IMONDON SUR
L´OBJET TECHNIQUE LORS DE SA CONFmRENCE g LA 3OCImTm FRANlAISE DE PHILOSOPHIE EN FmVRIER #ITm DANS 8AVIER
'UCHET 0OUR UN HUMANISME TECHNOLOGIQUE #ULTURE TECHNIQUE ET SOCImTm DANS LA PHILOSOPHIE DE 'ILBERT 3IMON
DON 0ARIS 05& P 'ASTON "ERGER ¦ ,ES EXIGENCES DE LA TECHNIQUE ET L´mDUCATION § ,´HOMME MODERNE¨ OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE connaissance du milieu où il [l’homme] opère, dont il reçoit les incitations
et où il développe ses initiatives, est d’autant plus nécessaire que l’homme
FRQFUHWHVWWRXMRXUVOLpjXQHFHUWDLQHVLWXDWLRQ©HQJDJpªGDQVXQFHUWDLQ
contexteª'XIDLWGHODGpPDUFKHSKpQRPpQRORJLTXHpWXGLpHSUpFpGHPment, Berger souhaite que les sciences humaines et sociales produisent des
DQDO\VHV FRQFUqWHV VXU O·KRPPH TX·HOOHV V·LQVFULYHQW GDQV OD UpDOLWp GHV
FRQFHSWVHWQRQGDQVGHSXUHVDEVWUDFWLRQVjSURSRVGHO·+RPPH
'DQVFHWWHSHUVSHFWLYH*DVWRQ%HUJHUSHQVHWLOTXHOHOLHXLQVWLWXWLRQnel où doivent s’épanouir les sciences humaines et sociales, se trouve dans
les écoles d’ingénieurs ? Le développement des sciences humaines et sociales rejoint celui des sciences appliquées qui étudient la technique. La
connaissance du monde moderne s’établit précisément dans l’étude huPDQLVWHGHVUDSSRUWVHQWUHO·KRPPHHWODWHFKQLTXH&HWWHK\SRWKqVHQRXV
FRQGXLWjpWXGLHUSDUWLFXOLqUHPHQWODFUpDWLRQHQj/\RQSDU*DVWRQ
Berger, de l’Institut national des sciences appliquées et la singularité de
son Centre des humanités.
,%3 3#)%.#%3 (5-!).%3 %4 3/#)!,%3 ª ,´).3! $% ,9/.
L’histoire d’une institution se construit à partir des faits que nous fourQLVVHQWOHVDUFKLYHVPDLVDXVVLGHVWpPRLJQDJHVELHQTX·©LG\OOLTXHVª,
GHVDFWHXUVGHO·pSRTXHTXLRQWÀqUHPHQWFUppFHWWHQRXYHOOHpFROHSRXUOHV
LQJpQLHXUV*DVWRQ%HUJHUV·HVWH[SULPpRIÀFLHOOHPHQWVXUO·,16$HQGHV
termes élogieux, soulignant sa nouveauté.
,ES SCIENCES HUMAINES ET SOCIALES g L´).3! ENTRE THmORIE ET PRATIQUE
/DFUpDWLRQGHO·,16$GH/\RQUpSRQGjXQLPSpUDWLIGHGpSDUWjXQH
raison administrative, c’est-à-dire à un besoin quantitatif important d’inJpQLHXUV 3RXU FHOD XQH PRGLÀFDWLRQ GH WDLOOH LQWHUYLHQW GDQV OH PRGH
GH UHFUXWHPHQW GHV pOqYHV QRQ SDV SRXU VDFULÀHU OHV FULWqUHV GH TXDOLWp
mais pour développer une véritable vocation. En effet, il s’agit de choisir
les futurs ingénieurs sur la base du dossier de l’enseignement secondaire,
SXLVjO·LVVXHG·XQHQWUHWLHQDYHFXQMXU\, ce qui exclut le concours d’en
)BIDEM P *EAN #APELLE ¦ 0RmFACE § DANS 2ENm "OIREL ,´AVnNEMENT DE L´)NSTITUT NATIONAL DES SCIENCES APPLIQUmES ,YON
!SSOCIATION DES ANCIENS mLnVES DE L´).3! ,9/. 6OIR LA THnSE DE 3ONIA "mCHET !PPROCHE PSYCHOLOGIQUE DE LA CONCEPTION ET DE LA VALIDATION D´UN ENTRETIEN DE
RECRUTEMENT APPLICATION AU PROCESSUS D´ADMISSION EN PREMInRE ANNmE AUX ).3! $OCTORAT DE PSYCHOLOGIE 5NI
VERSITm DE 2OUEN # DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER trée, méthode traditionnellement utilisée pour opérer une sélection juste
dans l’accès aux grandes écoles. À côté de la raison quantitative que nous
venons donc d’évoquer, se trouve une raison plus intuitive, qui vise à engager les jeunes étudiants dans la voie du métier d’ingénieur, au lieu de
leur donner un simple titre prestigieux. L’intention principale est donc de
donner une véritable culture du travail d’ingénieurs, un travail qui se veut
©KXPDLQª comme étudié ci-dessus.
L’aspect théorique et pratiqueGHVpWXGHVVHUDDQDO\VpGDQVOHSDUDJUDSKHVXLYDQWPDLVDYDQWFHODQRXVSUpFLVRQVTXH*DVWRQ%HUJHUSURSRse aussi une visée positiviste de l’enseignement, au sens où celui-ci n’est
SDV XQH ÀQ HQ VRL PDLV XQ SDVVDJH YHUV XQH PHLOOHXUH FRPSUpKHQVLRQ
de la vie, tout en étant une expérience à part entière. Par exemple, il est
prévu, au programme de la formation, plusieurs stages en entreprise pour
OHIXWXULQJpQLHXUHWQRWDPPHQWXQ©VWDJHRXYULHUªTXLDOLHXjODÀQGH
la première année, durant l’été, et dont le nom témoigne de l’objectif de
favoriser les relations sociales entre les travailleurs.
/·HQVHLJQHPHQW j O·,16$ GH /\RQ SUpVHQWH GRQF GHX[ FKDPSV GH
connaissances, théorique et pratique. Au-delà des spécialités techniques qui demandent des exercices appliqués, il relève de la philosophie
GH O·LQVWLWXW GH GRQQHU GHV FRQQDLVVDQFHV VFLHQWLÀTXHV &HWWH GpPDUFKH
LOOXVWUH OD SHQVpH GH *DVWRQ %HUJHU VHORQ ODTXHOOH OD WHFKQLTXH QH GRLW
SDVWULRPSKHUGHODUpÁH[LRQ$LQVLO·,16$V·LPSOLTXHWUqVW{WGDQVOHGRPDLQHGHODUHFKHUFKHHWSURGXLWGHX[W\SHVG·LQJpQLHXUVO·LQJpQLHXUGH
recherche et l’ingénieur de formation. Il se positionne au carrefour de la
recherche fondamentale et de la vie économique. Cette double disposition
QRXVHQFRXUDJHjSHQVHUTXH*%HUJHUVRXKDLWHGRQQHUXQU{OHLPSRUWDQW
jODSKLORVRSKLHDXVHLQGHFHWWHpFROHHWGpYHORSSHUXQHVSULWVFLHQWLÀTXH
JUkFHjXQHPpWKRGHH[SpULPHQWDOH6RQLGpHJpQpUDOHHVWODVXLYDQWH
« Il n’est pas de philosophie valable sans respect de l’objectivité, sans
intérêt porté à la science et, par conséquent, dans le monde moderne, sans
LQWpUrW SRXU OD WHFKQLTXH TXL FRQÀUPH OD VROLGLWp GH OD VFLHQFH HW O·pSDnouit en applications qu’il nous appartient de rendre bienfaisantes. Point
de philosophie non plus sans exigence foncière d’intelligibilité. Le philosophe sert la vérité, et la réussite technique où la force des sentiments ne
VRQWHQPHWWDQWOHVFKRVHVDXPLHX[TXHGHVSUpVRPSWLRQVGHYpULWp2Q
ne saurait ni les négliger ni s’en contenterª
6OIR *EAN #APELLE ¦ 0RmFACE § DANS 2ENm "OIREL ,´AVnNEMENT DE L´).3!¨ OP CIT 'ASTON "ERGER ,´HOMME MO
DERNE¨ OPCIT. #LAUDE .ICOLET ,ES CAHIERS DE LA 2mPUBLIQUE LOCCIT. (ENRI ,ONGCHAMBON ¦ ,ES SCIENCES SOCIA
LES EN &RANCE¨ § LOC CIT
$nS LA PREMInRE ANNmE g L´).3! LES mTUDIANTS DEVAIENT RECEVOIR UN ¦ ENSEIGNEMENT QUI SERA DnS LE DmBUT
ET g LA FOIS THmORIQUE ET PRATIQUE § 'ASTON "ERGER ¦ ,´)NSTITUT .ATIONAL DE ,YON § DANS 2EVUE DE L´%DUCATION
NATIONALE E ANNmE NUMmRO FmVRIER SANS PAGINATION
'ASTON "ERGER ¦ 0OUR UN RETOUR g $ESCARTES § ,´HOMME MODERNE¨, OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE (W*DVWRQ%HUJHUVHIDLWPrPHSUpFLVGDQVODGpVLJQDWLRQG·XQSURMHW
SRXUO·,16$GH/\RQ
« Faite pour former des hommes attentifs à l’expérience, la nouvelle
institution doit être elle-même docile à la méthode expérimentale. Elle
VDXUD V·LQÁpFKLU j OD GHPDQGH GHV FLUFRQVWDQFHV ,PPpGLDWHPHQW LQIRUmée des progrès de la science, en contact étroit avec les laboratoires où se
poursuit la recherche fondamentale, elle saura écouter aussi les leçons de
ceux qui appliquent les sciences et se heurtent à la résistance du réelª
En ce sens, le contenu des programmes en sciences humaines et sociaOHVGHVSUHPLqUHVDQQpHVG·H[LVWHQFHGHO·,16$SUpVHQWHXQLQWpUrWSRXU
les grandes questions philosophiques permanentes, de même que pour les
sciences à caractère empirique*UkFHjO·RXYUDJHGH5HQp%RLUHO, nous
pouvons classer d’une part, des cours en humanités obligatoires, précisément les cours de français et de langues étrangères, et les conférences, plus
ponctuelles, sur les grandes civilisations contemporaines ; d’autre part des
cours dans des disciplines comme la littérature, la philosophie, les arts,
la musique et le sport, qui étaient des matières optionnelles. Il répertorie
aussi des enseignements dans d’autres matières, qui ont une vocation plus
pratique selon nous, comme la sociologie industrielle, l’économie sociale
ou la législation du travail.
,E #ENTRE DES HUMANITmS DE L´).3! UNE UTOPIE mDUCATIVE
/H&HQWUHGHVKXPDQLWpVYRXOXSDU*DVWRQ%HUJHUHVWXQHVSDFHDXWRQRPHjpJDOLWpGHPR\HQVIDFHDX[VWUXFWXUHVGHVVSpFLDOLWpVWHFKQLTXHV
jO·,16$6RQEXWHVWGH©FRPSOpWHUªODIRUPDWLRQWHFKQLTXHGHO·LQJpnieur et de l’ouvrir aux problèmes humains et du monde de l’entreprise.
L’ambition de ce centre, qui s’appelait au commencement « département
GHVKXPDQLWpVªVHMXJHjVHVWHUPHVOHV©KXPDQLWpVª(QHIIHWOHFKRL[
GXQRPG·©KXPDQLWpVªUHQYRLHjXQSUREOqPHFODVVLTXHVXUODFXOWXUH
En référence aux débats de la Société française de philosophie, nous penVRQVTXHODYDOHXUGH©FXOWXUHªGDQVXQHVRFLpWpPRGHUQHVHPHVXUHj
'ASTON "ERGER ¦ ,´)NSTITUT NATIONAL DE ,YON § LOC CIT. P $ANS LE CADRE DE CET ARTICLE NOUS NOUS LIMITONS g L´EXPOSm DES INTITULmS DE COURS DE L´mPOQUE #EPENDANT
NOUS NOUS PROPOSONS DANS LE CADRE DE NOTRE THnSE DE RmALISER UNE SmRIE D´ENTRETIENS AVEC DES INGmNIEURS DES
PREMInRES PROMOTIONS SUR CET ENSEIGNEMENT EN SCIENCES HUMAINES ET SOCIALES A½N DE COMPLmTER D´UNE PART
LA CONNAISSANCE DES PROGRAMMES ET D´AUTRE PART DE RECUEILLIR LES IMPRESSIONS SUR L´ORIGINALITm ET L´OPPORTUNITm
DE CET ENSEIGNEMENT #ES ENTRETIENS DOIVENT COMPLmTER UNE RECHERCHE D´ARCHIVES DES PROGRAMMES DE COURS
AU #ENTRE DES HUMANITmS
2ENm "OIREL ,´AVnNEMENT DE L´).3!¨ OP CIT.
0ROPOS DU RECTEUR #APELLE DANS 2ENm "OIREL ,´AVnNEMENT DE L´).3!¨ OP CIT, P 3OCImTm FRANlAISE DE PHILOSOPHIE SmANCE DU DmCEMBRE ¦ ,ES HUMANITmS ET LA CIVILISATION MODERNE §
TmLmCHARGEMENT EN LIGNE SUR LE SITE HTTPWWWSOFRPHILOFR 'ASTON "ERGER DEVIENDRA MEMBRE ET PRmSI
DENT DE CETTE PRESTIGIEUSE INSTITUTION
# DE 2%#)43 0OLITIQUE DE L´ESPRIT CHEZ 'ASTON "ERGER O·DSSUHQWLVVDJH G·XQ KXPDQLVPH WDQW VFLHQWLÀTXH TXH OLWWpUDLUH$LQVL OH
Centre des humanités est un lieu où s’exerce la science dans un certain
rapport aux valeurs universelles (Science, Technique, Morale).
Par ailleurs, le fait de proposer un centre a une importance considérable, lorsque l’on considère que le rassemblement des sciences doit permettre à l’homme d’envisager des rapports avec le monde naturel et le
PRQGH VRFLDO 'DQV FH VHQV +HQUL /RQJFKDPERQ SUpVLGHQW GX &RQVHLO
VXSpULHXUGHODUHFKHUFKHVFLHQWLÀTXHHWGXSURJUqVWHFKQLTXHTXLDSDUWLFLSpjODFUpDWLRQGHO·,16$SHQVDLWJpQpUDOHPHQWTX·©XQUDSSURFKHPHQW
global [des sciences humaines] s’impos[ait], […] une mise en commun de
WRXWO·DFTXLVHWXQGpSDVVHPHQWV\VWpPDWLTXHGHVSRVLWLRQVDQFLHQQHVª.
3DUHLOOHPHQW SRXU * %HUJHU © 7RXWHV HQVHPEOH >OHV [email protected] VHUYHQW
l’homme et les valeurs auxquelles l’homme attache du prixª
+\SRWKpWLTXHPHQWFHWWHFUpDWLRQLOOXVWUHXQSURMHWXWRSLTXHTXLGRQQH
jODVFLHQFHOHSRXYRLUGHIDLUHODVRFLpWp*DVWRQ%HUJHUGRQQHXQFRQWHQX
précis au statut de l’ingénieur, dont le dessein, nous le rappelons, consiste
jGHYHQLU©XQFDGUHVXSpULHXUGHODQDWLRQª/·XWRSLHGRQWODGpÀQLWLRQ
HQYLVDJpH HVW GH VLJQLÀHU FH TXL FKHUFKH VRQ OLHX FH TXL VH WURXYH GDQV
O·LPDJLQDWLRQSURGXFWULFHHVWXQHQRWLRQTXH*DVWRQ%HUJHUIDLWWUDYDLOOHU
pour agir dans le concret. Alors que l’utopie impose de faire reposer l’action sur des fondements solides, il est désormais possible de fonder le
projet utopique de Berger sur la mise en œuvre de « sciences humaines et
VRFLDOHVSURVSHFWLYHVªSRXUODIRUPDWLRQGHVLQJpQLHXUV3UpFLVpPHQWOD
TXHVWLRQFHQWUDOHGHVÀQVHWGHVPR\HQVTXLGLULJHDLWVDUpÁH[LRQVXUOHV
sciences, nous permet de comparer sa pensée à une utopie. Le Centre des
humanités, au sein de cette formation technique théorique et pratique, en
permanente adaptation, propose clairement une visée réformatrice de la
société. Toutefois, nous convenons qu’il ne s’agit pas d’une nouveauté en
matière d’enseignement des sciences humaines et sociales dans les écoOHVG·LQJpQLHXUV&HODGLWO·,16$SRVVqGHXQHYDOHXUH[HPSODLUHGDQVOD
SHUVpYpUDQFHPHQpHSRXUDWWHLQGUHOHVÀQDOLWpVG·XQHQVHLJQHPHQWKXPDQLVWH(QRXWUHOHVHQVXWRSLTXHGHO·DFWLRQGH*DVWRQ%HUJHUHVWSUpVHQW
au sein d’une autre institution, le Centre d’études prospectives, qui, dans
une certaine mesure, prolonge les relations dans le temps (au cours des
carrières) entre la science et le monde de la vie.
(ENRI ,ONGCHAMBON ¦ ,ES SCIENCES SOCIALES EN &RANCE¨ § LOC CIT. P 'ASTON "ERGER ¦ %NSEIGNEMENT ET RECHERCHE § 'ASTON "ERGER ,´HOMME MODERNE¨, OP CIT. P $ANS LE CADRE DE NOTRE THnSE NOTRE Rm¾EXION S´APPUIERA SUR L´®UVRE D´%RNST "LOCH ,´ESPRIT DE L´UTOPIE 0ARIS
'ALLIMARD TRAD ,E PRINCIPE ESPmRANCE VOLUMES 0ARIS 'ALLIMARD TRAD AINSI QUE SUR
L´mTUDE DU '2%0( SUR ¦ 3CIENCE ET 5TOPIE § DANS !2!"%. REVUE mLECTRONIQUE DU '2%0( TmLmCHARGEMENT EN
LIGNE SUR LE SITE HTTPGREPHUNIVLYONFR
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD %3#5$)b -ARIE0IERRE Cet article a souhaité exposer les manifestations d’une pensée politique
KXPDQLVWHFKH]*DVWRQ%HUJHUjWUDYHUVO·pWXGHGHVHVUpDOLVDWLRQVGDQV
le domaine de l’éducation. En effet, notre penseur élabore une idée de
O·KRPPHFHTX·LPSOLTXHWRXWHSROLWLTXHVHORQ3DXO9DOpU\TXLHVWpJDOHment portée par la science et la philosophie.
1RXVDYRQVPRQWUpTXHSRXU*%HUJHUOHV©VFLHQFHVKXPDLQHVHWVRFLDOHVSURVSHFWLYHVªRXO·DQWKURSRORJLHSURVSHFWLYHVHUYHQWjPHWWUHHQ
±XYUH XQH KXPDQLWp HQ WDQW TXH VXMHW HW REMHW DSSX\pH j XQH WKpRULH
de la connaissance. De plus, il tente de recréer un ordre dans le domaine
GHO·HVSULWJUkFHjODVFLHQFHPDLVDXVVLHQUpWDEOLVVDQWODFRQÀDQFHHQOD
technique. Ainsi, par l’exemple concret de la création de l’Institut national
des sciences appliquées, nous avons soutenu que l’éducation d’un homme nouveau, qui permette le développement d’une culture républicaine,
passe par une institutionnalisation des sciences humaines et sociales dans
la formation des ingénieurs, ce qui se manifeste au sein de cette école par
le Centre des humanités. Cela témoigne aussi de l’idée que ces discipliQHVIRQGpHVVXUXQHPpWKRGHSURVSHFWLYHRQWODSRVVLELOLWpGHPRGLÀHU
ODSROLWLTXHHWOHPRQGHVRFLDOjYHQLUDÀQGHFUpHUGHQRXYHOOHVYDOHXUV
VXSpULHXUHVVWDEOHV'HFHIDLWOD©SROLWLTXHGHO·HVSULWªSUpVHQWHFKH]
*DVWRQ%HUJHUDXWUDYHUVQRWDPPHQWGHO·XWRSLHpGXFDWLYHjO·±XYUHGDQV
OHSURMHWGHO·,16$WHQGjLPSOLTXHUXQHWKpRULHGHO·DFWLRQGDQVXQUDSport renouvelé au temps.
# DE 2%#)43 Partie II
Politiques
de
la
mine
(OUILLnRES LIGmRIENNES ,´EXPLOITATION TECHNIQUE
DES HOUILLnRES LIGmRIENNES
DURANT LE PREMIER CON¾IT MONDIAL
,UC 2OJAS
D
LOIRE où l’on travaille depuis longtemps à la
fabrication d’armes de tous calibres, la guerre n’est jamais une
FDWDVWURSKH$ORUVTXHOHVEDVVLQVGX1RUGHWGHO·(VWVRQWRFFXSpVRXGpWUXLWVOD3UHPLqUH*XHUUHPRQGLDOHGRQQHDLQVLXQpODQLQHVSpUp
à l’extraction du charbon, stimule les secteurs sidérurgique, métallurgique
et mécanique, mobilise également le textile et la rubanerie pour la confection d’uniformes, de tissus élastiques, de masques à gaz. Le bassin ligéULHQRUJDQLVpSDUOH*URXSHPHQWLQGXVWULHOVXVFLWpSDUOHPLQLVWqUHGHOD
*XHUUHGHYLHQW©O·$UVHQDOGHOD)UDQFHªSURGXLVDQWDUPHPHQWVORXUGV
ou individuels et munitions de toutes natures. L’économie en guerre devient donc par la force des choses une économie de guerre et fait face de
mieux en mieux aux énormes besoins des armées.
ANS UN BASSIN DE LA
Ces années de guerre sont une période d’intense activité pour le bassin
houiller ligérien. En effet, le tonnage extrait en 1913, soit 3 800 000 tonQHVHVWODUJHPHQWLQIpULHXUDXWRQQDJHH[WUDLWjODÀQGXFRQÁLWHQ
VRLWWRQQHV6LWXDWLRQSDUDGR[DOHFDUSHQGDQWFHWWHSpULRGHOD
SURGXFWLRQQDWLRQDOHFKXWHGHjPLOOLRQVGHWRQQHV&HWHVVRUH[FHStionnel s’explique par la défaillance des autres sources, par l’invasion du
bassin du nord et l’arrêt brutal des importations allemandes et belges1.
'UILLAUME 0IERRE ¦ ,ES MINES DE LA ,OIRE APRnS LA 0REMInRE 'UERRE MONDIALE § DANS #ENTRE DE RECHERCHE
HISTORIQUE DIR (ISTOIRE DES ENTREPRISES 0ARIS 3%60%. P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC Les mines du nord de la France subissent un véritable calvaire. Dès le
PRLVG·RFWREUHXQHOLJQHGHWUDQFKpHVWUDYHUVHOHEDVVLQQRUGLVWH/HV
mines occupées, à l’est d’une ligne Arras-Béthune, très vite endommagées
par les bombardements, connaissent une extraction ralentie avant d’être
WRWDOHPHQWGpWUXLWHVSDUOHV$OOHPDQGVjODÀQGHODJXHUUH/HVFRQVpTXHQces sont partout dramatiques. Au fond, 100 millions de mètres cubes d’eau,
soit le débit de la Seine à Paris durant les mois d’été, inondent des milliers
de kilomètres de galeries désormais inaccessibles. En surface, dans 103 fosses sinistrées, règnent la désolation et le chaos. Au milieu des ferrailles
déchiquetées, des cratères remplis d’eau et de débris divers sont le plus
souvent les témoignages dérisoires de la présence des puits et des chevalePHQWVTXLpWDLHQWTXHOTXHVDQQpHVDXSDUDYDQWOHVV\PEROHVGHODYLWDOLWp
industrielle du nord de la France. La production de houille est supérieure
jPLOOLRQVGHWRQQHVjODGpFODUDWLRQGHJXHUUHHWQ·DWWHLQWTXHPLOOLRQV
de tonnes en 1918. Durant cette période, le charbon manque, les autres
bassins houillers français, notamment le bassin de la Loire, fournissent un
HIIRUWGHJXHUUHFRQVLGpUDEOHDÀQGHPDLQWHQLUODSURGXFWLRQQDWLRQDOH
7RXWHIRLVOHFRQÁLWVXUSUHQGOHVPLQHVGHOD/RLUHTXLQHVRQWSDVSUpparées à cet essor soudain. Ce manque de préparation peut être lourd de
conséquences, car l’industrie extractive est peu élastique et toute augmentation de production doit être prévue plusieurs années à l’avance.
,%3 #/.$)4)/.3 $% ,! 02/$5#4)/.
2Q LPDJLQH VRXYHQW j WRUW TXH O·DXJPHQWDWLRQ GH OD SURGXFWLRQ GX
EDVVLQKRXLOOHUGHOD/RLUHGXUDQWOD3UHPLqUH*XHUUHPRQGLDOHQHV·HVW
produit uniquement que grâce à l’utilisation intensive du matériel. Celui-ci, datant souvent du XIXe siècle, a bien été sollicité, certes de manière
intensive, mais il ne constitue pas l’unique paramètre. D’autres facteurs
sont à mettre en exergue.
Les dirigeants des compagnies ont pleinement conscience de leur rôle
DX VHLQ GH O·HIIRUW GH JXHUUH GH OD 1DWLRQ /H GLUHFWHXU GX FRQVHLO G·DGPLQLVWUDWLRQGHOD&RPSDJQLHGHV+RXLOOqUHVGH6DLQWeWLHQQHGDQVVRQ
UDSSRUWjO·DVVHPEOpHJpQpUDOHGH\IDLWDERQGDPPHQWUpIpUHQFH
« L’expérience de cette terrible guerre a démontré que la supériorité
UHVWHUDLWjFHOXLGHVGHX[DGYHUVDLUHVSRXYDQWGLVSRVHUGHVPR\HQVPDWpULHOVOHVSOXVSXLVVDQWV2UODKRXLOOHHVWjODEDVHPrPHGHWRXWHVOHV
fabrications de l’armement et des munitions. C’est dire, Messieurs, qu’une
entreprise industrielle telle que la nôtre avait l’impérieux et patriotique
# DE 2%#)43 (OUILLnRES LIGmRIENNES GHYRLUG·LQWHQVLÀHUDXPD[LPXPVRQDFWLYLWp1RXVDYRQVODVDWLVIDFWLRQ
de vous faire connaître que rien n’a été négligé, ni dans l’effort ni dans le
dévouement, pour atteindre ce résultat désirableª
Malgré l’aide des Britanniques qui augmentent de façon importante
leur exportation de charbon en direction de la France, les charbonnages ligériens sont tout de même obligés de produire intensivement pour l’armée.
$LQVLGXUDQWO·DQQpHOHEDVVLQH[WUDLWPHQVXHOOHPHQWWRQQHV
GHFKDUERQO·DUPpHDEVRUEHVXUFHWRWDOWRQQHVVRLWHQYLURQ
de la production mensuelle3. La répartition traditionnelle des charbons du
EDVVLQGH6DLQWeWLHQQHHVWGRQFQRWDEOHPHQWPRGLÀpHSDUO·LQWHUYHQWLRQ
du Bureau national des charbons, organe mis en place par l’État pour gérer l’état de guerre. Les charbons convenant particulièrement à la métallurgie sont réservés à l’État et expédiés plus loin que d’ordinaire. Ils sont
remplacés pour le chauffage domestique, dans la zone traditionnelle de
vente du bassin de la Loire, sinon dans la région houillère de la Loire, par
des charbons particulièrement désignés pour cet usage, mais venant de
bassins éloignés.
Les efforts des charbonnages sont conséquents mais ils seraient totalement vains sans l’aide de l’État. Le premier effort réglementaire effectué
SDUOHJRXYHUQHPHQWHVWGHVXVSHQGUHGqVO·DSSOLFDWLRQGHODORLVXU
les huit heures de travail. Les ouvriers-mineurs se montrent très compréhensifs vis-à-vis de cette décision gouvernementale, du fait du contexte et
GXU{OHTX·LOVRQWjMRXHU7RXWDXORQJGXFRQÁLWLOVFRQWLQXHQWG·DFFHSWHU
sans résistance les heures de travail supplémentaires qui leur sont demanGpHV7RXWHIRLVXQDFFRUGHVWFRQFOXOHDYULOGHYDQWOHSUpIHWSDUOHV
GLUHFWHXUVGHVFRPSDJQLHVHWOD)pGpUDWLRQGHVPLQHXUVDÀQGHWURXYHUXQH
rémunération adéquate aux efforts fournis par la corporation minière.
/HGpEXWGXFRQÁLWHWODPRELOLVDWLRQTX·HOOHHQJHQGUHSURYRTXHQWXQH
crise de la main-d’œuvre au sein des différentes industries ligériennes.
Très vite la main-d’œuvre devient un véritable goulot d’étranglement,
dans toutes les industries on mobilise sur place. Les femmes, « usineuVHV ª LPSURYLVpHV VRQW PDVVLYHPHQW HPEDXFKpHV QRQ VDQV GLIÀFXOWpV
dans les ateliers de petite métallurgie et de mécanique, et surtout, dans
OHVDWHOLHUVS\URWHFKQLTXHVRO·RQWUDYDLOOHSDUpTXLSHVMRXUHWQXLW(OOHV
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 2APPORT DU CONSEIL D´ADMINISTRATION DE LA #OMPAGNIE DES
(OUILLnRES DE 3AINTbTIENNE g L´ASSEMBLmE GmNmRALE DE ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES DE LA ,OIRE TOME )) 3AINTbTIENNE IMPRIMERIE 4HIOL
LIER P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC IRUPHQWHQGHVVDODULpVGHOD0DQXIDFWXUHQDWLRQDOHFKH]
0LPDUG GH OD S\URWHFKQLH VWpSKDQRLVH 'HV WUDYDLOOHXUV pWUDQJHUV
de toutes origines sont logés dans des cantonnements à proximité des usiQHV FDPS FKLQRLV GX 0DUDLV FDPS NDE\OH FKH] 9HUGLp« 'HV GRUWRLUV
sont improvisés dans les hangars abandonnés, des zones inondables, des
VDOOHVGHJ\PQDVWLTXH/HVFRQGLWLRQVGHWUDYDLOHWGHORJHPHQWGHFHWWH
main-d’œuvre sont souvent déplorables.
L’industrie minière connaît les mêmes mésaventures. Ainsi, après la
perte importante des mineurs ligériens mobilisés, les charbonnages reçoiYHQWXQDIÁX[GHPDLQG·±XYUHFRQVpTXHQWHSDUOHELDLVGHO·DUULYpHGHV
PLQHXUVGX1RUGGRQWOHEDVVLQHVWRFFXSpSDUOHV$OOHPDQGVSXLVSDU
l’apport des ouvriers étrangers et des prisonniers de guerre. Le département voit regrouper près du tiers des prisonniers de guerre travaillant dans
les houillères7. L’effectif des compagnies se rapproche alors de la normale.
L’État joue là un rôle important par le biais de la promulgation de textes
UpJOHPHQWDLUHV/DORLGXDR€WGLWHORL'DOELH]VXUODUpSDUWLWLRQHW
l’utilisation des mobilisés et des mobilisables, est suivie d’une instruction
GX VHSWHPEUH FRQFHUQDQW OHV KRXLOOqUHV HW G·XQH LQVWUXFWLRQ GX
VHSWHPEUHSRXUOHVXVLQHVGHO·DUPHPHQW/HVKRPPHVD\DQWMXVWLÀpGH
l’exercice de la profession de mineur pendant six mois au moins peuvent
rWUHDIIHFWpVDX[H[SORLWDWLRQV&HX[TXLVDQVUpXQLUFHWWHFRQGLWLRQ\VRQW
détachés, peuvent être maintenus sur l’avis d’une commission mixte, présidée par l’ingénieur en chef ou son délégué8/HVFRPSDJQLHVSURÀWHQWDX
maximum de ce texte pour compenser les effets de la mobilisation. C’est
d’ailleurs ce que précisent les journaux à propos de la Compagnie des
+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUH
« La mobilisation n’a pas causé de préjudice à l’extraction. Cela est dû au
IDLWTXHODFRPSDJQLHDSXUHFUXWHUGHVPLQHXUVGH%HOJLTXHHWGX1RUG9ª
1pDQPRLQVOHVHQWUHSULVHVQHVRQWSDVWRWDOHPHQWVDWLVIDLWHVGHFHUHcrutement. À l’instar du directeur du conseil d’administration de la SoFLpWpDQRQ\PHGHV0LQHVGHOD/RLUHTXLGpSORUHOHSHXG·H[SpULHQFHGHV
RXYULHUVHPEDXFKpV
9VES ,EQUIN DIR ANNmES LUMInRE MmMOIRE INDUSTRIELLE 0ARIS 0LON P *EAN ,OUIS %SCUDIER ¦ -UTATIONS mCONOMIQUES STRUCTURELLES ET CON¾ITS MONDIAUX L´INDUSTRIE HOUILLnRE
FRANlAISE § DANS 2EVUE HISTORIQUE JANVIERMARS P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT. , P #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , DOSSIER DE PRESSE SUR LA #OMPAGNIE DES (OUILLnRES DE
-ONTRAMBERT ET DE LA "mRAUDInRE COUPURE DE PRESSE DATmE DU AVRIL JOURNAL NON IDENTI½ABLE
# DE 2%#)43 (OUILLnRES LIGmRIENNES ©1RXVQ·DYRQVSXUHFUXWHUHQÀQTXHGHVRXYULHUVSHXH[SpULPHQWpV
dont l’effet utile est inférieur à celui des mineurs professionnels10ª
'HSOXVDX[PRELOLVpVUHQYR\pVjODPLQHHWDX[SULVRQQLHUVGHJXHUUH
les compagnies adjoignent des immigrés espagnols, marocains… Ce personnel, recruté en abondance et amené à grands frais, se montre très instable. Malgré les engagements pris, beaucoup de ces ouvriers quittent la
mine pour aller travailler dans les usines ou pour émigrer dans d’autres
régions. Mal entraînés, d’ailleurs, à un travail régulier, ce personnel ne
donne qu’un rendement assez faible11.
3RXUPHQHUjELHQOHFRQÁLWO·eWDWDEHVRLQGHFRQWU{OHUHWGHPLOLWDULser l’industrie. L’économie de marché n’est donc pas la réponse adéquate
jODVLWXDWLRQ'XSULQWHPSVGHjO·DXWRPQHGH$OEHUW7KRPDV
socialiste jaurésien, est l’artisan de la reconversion et de la militarisation
de l’industrie. Comme sous-secrétaire d’État à l’Artillerie puis, à compter
GH GpFHPEUH FRPPH PLQLVWUH GH O·$UPHPHQW LO PHW HQ SODFH OHV
structures du dirigisme qui atteindront leur apogée à l’hiver 1917, avec le
cabinet Clemenceau.
Ce dirigisme étatique s’exprime dans le domaine minier comme dans
OHVDXWUHVLQGXVWULHVSDUGHVWH[WHVRIÀFLHOVHWODFUpDWLRQG·RUJDQHVFKDUgés de réguler et de distribuer la production. Ainsi, la suppression de la
FRQFXUUHQFH OD QpFHVVLWp GH SURGXLUH j WRXW SUL[ PDLV DYHF XQ EpQpÀFH
DVVXUpVRQWGHVFRQGLWLRQVPLVHVHQSODFHSDUODORLGXDYULO&HOle-ci entrave la spéculation et la hausse en fournissant à tous le charbon
au même prix. Elle provoque l’exploitation de toutes les mines, quels que
soient leur prix de revient et la qualité des charbons livrés à la consommation13. Concernant ce dernier point, le ministre de l’Armement peut, après
s’être renseigné sur les prix de revient des différentes mines, accorder des
augmentations variables au prix de vente des charbons de ces houillères.
$X ÀO GX FRQÁLW FH GLULJLVPH pFRQRPLTXH V·DPSOLÀH 8QH FLUFXODLUH
PLQLVWpULHOOHGDWpHGXDYULORUJDQLVHXQFRPLWpGHUpSDUWLWLRQSRXU
régulariser et contrôler les ventes. Ce comité est présidé par l’ingénieur
HQ FKHI HW VH UpXQLW j OD ÀQ GH FKDTXH PRLV &KDTXH FRPSDJQLH FRQWLnue à recevoir directement pendant le mois les commandes de ses clients.
/HFRPLWpFRPSDUH WRXV OHV SURJUDPPHV GH OLYUDLVRQV HW OHV PRGLÀH DX
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT DU CONSEIL D´ADMINISTRATION DE LA 3OCImTm ANONYME
DES -INES DE LA ,OIRE g L´ASSEMBLmE GmNmRALE DE ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OPCIT P $ENIS 7ORONOFF (ISTOIRE DE L´INDUSTRIE EN &RANCE 0ARIS LE 3EUIL P 0IERRE 'UILLAUME ¦ ,ES MINES DE LA ,OIRE¨ § LOC CIT P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT , P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC besoin, les livraisons n’étant effectuées qu’après le contrôle. Le 1er août
1917, le ministère de l’Armement et des Fabrications de guerre organise,
HQ UHPSODFHPHQW GX V\VWqPH GH UpSDUWLWLRQ UpJLRQDOH XQ RUJDQLVPH j
SOXVLHXUV pFKHORQV D\DQW j VD WrWH OH %XUHDX QDWLRQDO GHV FKDUERQV &HW
RUJDQLVPHÀ[HSRXUFKDTXHFROOHFWLYLWpXQFRQWLQJHQWGHFKDUERQjDFKHWHUGDQVFKDTXHDUURQGLVVHPHQWPLQpUDORJLTXH/·LQJpQLHXUHQFKHID\DQW
sous ses ordres un bureau régional, désigne les mines devant livrer leurs
charbons. La collectivité passe les ordres de livraison aux mines pour chaTXHFRQVRPPDWHXU&HV\VWqPHIRQFWLRQQHjSOHLQjSDUWLUGXer octobre
1917. Telles sont les conditions d’exploitation qu’impose la guerre aux
compagnies minières de la Loire.
%.42% )../6!4)/. 4%#(.)15%
%4 2b/2'!.)3!4)/. $%3 #(!2"/..!'%3
Si la guerre est une période de régression technique, peu favorable au
progrès de l’industrie en dépit de l’intense demande de charbon, la situaWLRQUpFODPHWRXWGHPrPHXQHHIÀFDFLWpFURLVVDQWHGDQVXQGRPDLQHOH
traitement des charbons. En effet, les usines travaillant pour l’armement
VROOLFLWHQWGHVSURGXLWVDGDSWpVjOHXUVEHVRLQVVSpFLÀTXHV$LQVLOHVFRPpagnies minières doivent fournir de plus en plus de coke de fonderie à
basse teneur en cendres. Le traitement des charbons est donc au centre
GHVSUpRFFXSDWLRQVGHVFKDUERQQDJHVFRPPHOHIDLWUHPDUTXHUGqV
OHGLUHFWHXUGXFRQVHLOG·DGPLQLVWUDWLRQGHOD&RPSDJQLHGHV+RXLOOqUHV
GH6DLQWeWLHQQH
© /HV DWHOLHUV GH FDUERQLVDWLRQ RQW SURGXLW WRQQHV GH FRNH HQ
SOXVSDUUDSSRUWj1RXVDYRQVODUJHPHQWGpYHORSSpODIDEULFDWLRQ
des cokes de fonderie, à basse teneur en cendres, pour satisfaire, dans toute la mesure de notre capacité productive, aux nombreuses et importantes
demandes des usines travaillant pour la guerre ; le tonnage réalisé en cette
VRUWH>[email protected]ª
Les grandes compagnies ligériennes augmentent leur parc d’équipement destiné au traitement des charbons. Le rapport du conseil d’admiQLVWUDWLRQ GH OD 6RFLpWp DQRQ\PH GHV 0LQHV GH OD /RLUH GH SUpFLVH
que l’entreprise, après avoir réglé les sommes dues sur la construction
G·XQHEDWWHULHGHIRXUVjUpFXSpUDWLRQHWGHYDQWOHVUpVXOWDWVREWHQXVHW
les besoins de la Défense nationale, décide de commander quatorze nou
,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT. P !RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 2APPORT DU CONSEIL D´ADMINISTRATION DE LA #OMPAGNIE DES
(OUILLnRES DE 3AINTbTIENNE g L´ASSEMBLmE GmNmRALE DE # DE 2%#)43 (OUILLnRES LIGmRIENNES YHDX[IRXUVjFRNHGXPrPHV\VWqPH17. Cette même société répond égalePHQWDX[YXHVGHO·$GPLQLVWUDWLRQFDUHOOHGpFLGHGHGpEXWHUO·pGLÀFDWLRQ
G·XQH XVLQH GH GLVWLOODWLRQ GHV JRXGURQV HW GH UHFWLÀFDWLRQ GHV EHQ]ROV
bruts, dont tous les produits seront affectés aux besoins de la guerre18.
Le développement croissant des industries annexes telles que la fabrication du coke, la vente de gaz, la production d’énergie électrique, fournisVHQWSRXUFHUWDLQHVFRPSDJQLHVXQEpQpÀFHDWWHLJQDQWSUHVTXHODPRLWLpGH
FHOXLTXHOHXUSURFXUHO·H[WUDFWLRQPLQLqUHHOOHPrPH&HWWHGLYHUVLÀFDWLRQ
permet aux usines de guerre d’être alimentées en charbons et en cokes indispensables à leurs besoins et de procurer à l’Administration des poudres
et salpêtres, matières premières des puissants explosifs de l’époque. EnÀQO·LQVWDOODWLRQG·XVLQHVpOHFWURPpWDOOXUJLTXHVQRWDPPHQWSDUOD6RFLpWp
DQRQ\PHGHV0LQHVGHOD/RLUHSHUPHWGHFRXOHUGHVIRQWHVV\QWKpWLTXHV
dont une partie est moulée par les compagnies pour leurs propres usages,
et dont le surplus est usiné et transformé en obus pour leurs clients19.
Tout au long de la période, les compagnies vont augmenter leurs capacités à traiter les charbons, notamment en accroissant le nombre de
fours à coke à récupération. La pénurie de charbon subie par l’industrie
française oblige les charbonnages à optimiser les opérations concernant
le traitement des houilles. La rareté de la houille oblige les compagnies à
WLUHUDXPD[LPXPSURÀWGHVTXDOLWpVGXFKDUERQH[WUDLWGHOHXUWHUULWRLUH
1pDQPRLQVFHWWHUpÁH[LRQQ·HVWSDVQHXYHDXVHLQGHVFKDUERQQDJHVOH
problème de l’utilisation des mauvais combustibles, notamment, intéresse
depuis longtemps les industriels. Mais il ne peut être résolu que par la
collaboration étroite du laboratoire et de l’usine, du chimiste et de l’ingénieur. Bref, toutes les énergies doivent être dirigées dans la même direcWLRQ3DUDGR[DOHPHQWOHFRQÁLWGHIDFLOLWHFHOD
/D&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUHpWXGLHFHWWHTXHVWLRQGHSXLV­ODÀQGXFRQÁLWOHFKHIGXVHUYLFHGHV
usines de cette compagnie, M. Blache, croit avoir résolu au moins un cas
SDUWLFXOLHUFHOXLGHO·XWLOLVDWLRQSUDWLTXHHWORJLTXHG·XQFRPEXVWLEOHj
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT DU CONSEIL D´ADMINISTRATION DE LA 3OCImTm ANONYME
DES -INES DE LA ,OIRE g L´ASSEMBLmE GmNmRALE DE !RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT DU CONSEIL D´ADMINISTRATION DE LA 3OCImTm ANONYME
DES -INES DE LA ,OIRE g L´ASSEMBLmE GmNmRALE DE !RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT DU CONSEIL D´ADMINISTRATION DE LA 3OCImTm ANONYME
DES -INES DE LA ,OIRE g L´ASSEMBLmE GmNmRALE DE ,A 3OCImTm ANONYME DES -INES DE LA ,OIRE JUSTI½E EN LA CONSTRUCTION D´UNE BATTERIE DE QUARANTE NOUVE
AUX FOURS g COKE g RmCUPmRATION PAR LES RENDEMENTS mLEVmS QUE CES APPAREILS PROCURENT
,A LITTmRATURE PROFESSIONNELLE DE CES ANNmES Lg DmMONTRE L´INTmRoT GRANDISSANT DES INGmNIEURS DES -INES POUR
LES SCIENCES APPLIQUmES !INSI LES !NNALES DES MINES ET LE "ULLETIN DE LA SOCImTm DE L´INDUSTRIE MINmRALE RE¾nTENT
CET mTAT D´ESPRIT #ES PmRIODIQUES SONT PARSEMmS D´mCRIT RELATIFS g CETTE PRmOCCUPATION
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC GH FHQGUHV ULFKH HQFRUH HQ PDWLqUHV YRODWLOHV PDLV FROODQW HW j
FHQGUHVPR\HQQHPHQWIXVLEOHV.
&IGURE )NSTALLATION DE GAZOGnNE AVEC mPURATION ET RmCUPmRATION DES SOUSPRODUITS
3OURCE "LACHE ¦ 5TILISATION DES DmCHETS DE MINES ET DES MAUVAIS COMBUSTIBLES §
DANS "ULLETIN DE LA 3OCImTm DE L´INDUSTRIE MINmRALE P /·LGpHGH%ODFKHHVWGHFRNpÀHUFHVFRPEXVWLEOHVFHQGUHX[DYHFUpFXSpration des sous-produits et d’utiliser les chaleurs perdues pour la production de la vapeur nécessaire à la marche de l’usine d’une part et, d’autre
part, de traiter du coke impur au gazogène. Ces deux étapes sont réalisées
grâce à une usine constituée par une batterie de fours à coke et les gazogènes. Elle fournit mensuellement dans des conditions avantageuses de prix
GHUHYLHQWXQGpELWGHNLORZDWWVKHXUHXWLOLVpVGDQVOHVVHUYLFHVGH
la société ou versés sur le réseau de la Compagnie électrique de la Loire et
du Centre. L’usine permet en outre de récupérer avec le goudron et l’ammoniaque que produisent habituellement les fours à coke une proportion
intéressante d’ammoniaque provenant des gaz du gazogène.
L’usine d’essai de Montrambert est en marche continue depuis le
MXLQ/HSRLQWGHGpSDUWGHFHW\SHG·LQVWDOODWLRQLQGXVWULHOOHVHORQ
- & "LACHE ¦ 5TILISATION DES DmCHETS DE MINES ET DES MAUVAIS COMBUSTIBLES § DANS "ULLETIN DE LA 3OCImTm DE
L´)NDUSTRIE -INmRALE P # DE 2%#)43 (OUILLnRES LIGmRIENNES Blache est une centrale à gaz de gazogène tirant du combustible tous les
produits utilisables au point de vue chimique et thermique. Pour l’industrie houillère, cette centrale est destinée à l’utilisation sur place des déchets
et mauvais combustibles qui ne peuvent être transportés. Les gaz produits
pourront, après récupération des sous-produits, être usités, soit dans des
moteurs à gaz, soit sous des chaudières pour la production de la force
PRWULFH2QOLEqUHUDLWGHFHWWHIDoRQVHORQO·LQJpQLHXUGH0RQWUDPEHUW
jGHODSURGXFWLRQKRXLOOqUHHPSOR\pVDX[VHUYLFHVGHO·H[SORLWDWLRQHW
qui pourraient être réservés à d’autres usages.
La force ainsi produite serait bien supérieure à celle qui est nécessaire à
la marche d’une exploitation et l’on conçoit facilement dans un district minier la création de centrales à gaz et de centrales électriques, utilisant tous
les mauvais combustibles et alimentant non seulement les services des
exploitations, mais fournissant leur excédents sous ces deux formes aux
industries qui vivent et pourraient se développer dans leur voisinage.
Les retombées de cette innovation semblent très rapides dans le petit
monde industriel, d’ailleurs le journal le Messager économique français s’en
IDLWO·pFKRGDQVVRQpGLWLRQGXIpYULHU
« La question de l’utilisation des combustibles pauvres, des déchets de
triage et de lavage vient d’être résolue par cette société. Ces combustibles
sont d’abord traités au four à coke avec récupération des sous-produits,
les cokes sont ensuite traités au gazogène. La société récupère par tonne
GHFKDUERQNJGHJRXGURQNJGHVXOIDWHG·DPPRQLDTXH(QRXWUH
OH WUDLWHPHQW DX JD]RJqQH GH . GRQQH NLORZDWW DX PRWHXU j JD]
Malgré des installations sommaires, la société arrive à produire mensuelOHPHQWNLORZDWWVKHXUH/DSOXVJUDQGHSDUWLHHVWDEVRUEpHSDUOHV
services de la mine. L’excédent est pris par le réseau de l’Électrique de la
Loire et du Centreª
eYLGHPPHQW OH FRQWH[WH SDUWLFXOLHU GH OD 3UHPLqUH *XHUUH PRQGLDOH
favorise l’innovation technique dans le domaine du traitement des charERQV 1pDQPRLQV LO QH FUpH SDV GH WRXWHV SLqFHV FHWWH LQQRYDWLRQ /D
&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUHDHQJDJp
GHVUHFKHUFKHVFRPPHQRXVO·DYRQVGpMjVRXOLJQp GHSXLV GDQVFH
GRPDLQH/HFRQÁLWHWOHVFRQGLWLRQVLQGXVWULHOOHVSDUWLFXOLqUHVTXLHQGpcoulent n’ont fait qu’accélérer les événements. De plus, il est illusoire de
croire que les compagnies s’engouffrent dans la politique de guerre de
O·eWDWVDQV\WURXYHUXQDYDQWDJHÀQDQFLHU­O·LQVWDUGH0RQWUDPEHUWOHV
- & "LACHE ¦ 5TILISATION DES DmCHETS DE MINES¨ § LOC CIT P #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , DOSSIER DE PRESSE SUR LA #OMPAGNIE DES (OUILLnRES DE
-ONTRAMBERT ET DE LA "mRAUDInRE -ESSAGER mCONOMIQUE FRANlAIS FmVRIER 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC charbonnages ligériens investissent dans le domaine du traitement des
charbons car cela est rentable. Si l’effort des entreprises houillères dans ce
secteur est motivé par un sentiment patriotique, celui-ci est loin d’en être
la raison principale.
/HVDQQpHVVRQWPDUTXpHVSDUO·DUULYpHHQ)UDQFHGHVPRXYHPHQWVG·RUJDQLVDWLRQVFLHQWLÀTXHGXWUDYDLO/·LQÁXHQFHGHFHVGRFWULnes se fait sentir à travers les publications professionnelles. Ainsi, dès la
ÀQGHODJXHUUHHQ0/DOLJDQWLQJpQLHXUGXGLVWULFWG·$ODLVSXEOLH
dans le Bulletin de la Société de l’industrie minérale une étude concernant
le Taylorisme dans la houillère26 &HWWH FKURQLTXH D SRXU REMHFWLI G·DQDO\VHU OH V\VWqPH 7D\ORU HW GH FULWLTXHU VRQ DGDSWDWLRQ GDQV OH PRQGH GHV
houillères. L’ingénieur d’Alais retrace les conditions spéciales à l’exploitation et plus particulièrement aux travaux d’abattage qui restreignent le
GpYHORSSHPHQWGXPDFKLQLVPHHWUHQGHQWH[WUrPHPHQWGLIÀFLOHO·HPSORL
GHTXHOTXHVXQVGHVSURFpGpVFRQFUpWLVDQWOHWD\ORULVPH7RXWHIRLVLOHVW
toujours possible d’en user et de s’en inspirer très utilement. Ces courants
GHSHQVpHSU{QHQWXQWUDYDLOSOXVHIÀFDFHHWSOXVUHQWDEOHREMHFWLIWUqV
DWWUD\DQWGDQVOHFRQWH[WHFRQÁLFWXHOGH'XUDQWFHWWHSpULRGH
les charbonnages vont se restructurer. À l’instar de l’innovation technique,
cette réorganisation ne constitue pas une conséquence directe et exclusive
de la guerre mais elle est accélérée par cette dernière.
'qVOHVKRXLOOqUHVOLJpULHQQHVVHWURXYHQWFRQIURQWpHVjXQSUREOqPHGHSUHPLHURUGUHODSpQXULHGHERLV(QHIIHWOHPDQTXHG·pWDLVSRXU
les travaux souterrains entravent la production. Dépourvues de bois de
mines, les exploitations vivent au jour le jour. Les mines de la Loire, dont
OHVRXWqQHPHQWHVWWUqVGLIÀFLOHFRQVRPPHQWDYDQWODJXHUUHPqWUHV FXEHV GH ERLV SDU DQ SRXU XQH H[WUDFWLRQ GH WRQQHV VRLW
SDUWRQQHSURGXLWHVL[IRLVSOXVTXHFHOOHVGX1RUGHWGX3DVGH&DODLV
/RUVTX·DXPRLVG·DR€WODPRELOLVDWLRQYLHQWDUUrWHUOHVWUDQVSRUWVHW
UDUpÀHUODPDLQG·±XYUHGDQVOHVUpJLRQVIRUHVWLqUHVOHVFRPSDJQLHVQH
peuvent se procurer immédiatement les bois, reconstituer leur stock, et
accroître l’extraction qu’au prix de très grands efforts.
Les charbonnages se trouvent dans l’obligation d’entreprendre euxmêmes des exploitations forestières en achetant des coupes sur pied, non
,E TAYLORISME NOTAMMENT COMMENCE g IN¾UENCER LE MONDE DES HOUILLnRES ET DE NOMBREUSES RECHERCHES
THmORIQUES SUR L´ADAPTATION DE CETTE DOCTRINE AUX CHARBONNAGES SONT MENmES DURANT CES QUELQUES ANNmES
,ALIGANT ¦ $U 4AYLORISME DANS LA HOUILLnRE § DANS "ULLETIN DE LA 3OCImTm DE L´INDUSTRIE MINmRALE P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CIT P (, 3EURRE ET ( 6ERNEY ¦ ,ES BOIS DE MINES EMPLOYmS DANS LE BASSIN DE LA ,OIRE § DANS "ULLETIN DE LA 3OCImTm
DE L´INDUSTRIE MINmRALE P # DE 2%#)43 (OUILLnRES LIGmRIENNES VHXOHPHQWGDQVOHVUpJLRQVYRLVLQHVGXEDVVLQOD+DXWH/RLUHO·$UGqFKH
HWOH3X\GH'{PHROHXUVIRXUQLVVHXUVKDELWXHOVV·DSSURYLVLRQQHQWHX[
mêmes, mais dans des centres plus éloignés, tels que la Lozère, la Corrèze,
OHV$OSHVMXVTXHGDQVOHV/DQGHVOD6RORJQHHWO·2XHVWGHOD)UDQFH&HUtaines compagnies vont plus loin et songent, avec raison, que la propriété
boisée constitue un placement très rémunérateur et particulièrement indiqué. Ces entreprises se mettent à constituer de véritables domaines forestiers, comme l’ont déjà fait des entreprises d’autres bassins miniers, soit en
DFKHWDQWGHVIRUrWVVROHWVXSHUÀFLHVRLWHQSODQWDQWOHVWHUUDLQVGRQWHOOHV
sont propriétaires sur leurs concessions ou dans le voisinage.
Dans ce domaine, les nécessités créées par la guerre permettent de voir
plus loin et de voir plus grand et font réaliser pour l’avenir, proche ou
lointain, des progrès dont on n’aurait peut-être pas senti le besoin sans
HOOH/D&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUHVH
rend compte en 1918 de l’importance de ses domaines forestiers situés en
Sologne et dans les Landes. Ceux-ci permettent à la compagnie de se renGUHLQGpSHQGDQWHGHVÁXFWXDWLRQVGHVSUL[GXERLVHWGHODFRQMRQFWXUH
c’est d’ailleurs ce que dit en substance le directeur du conseil d’adminisWUDWLRQORUVGHO·DVVHPEOpHJpQpUDOHGH
« Pour les étais de mine et les écoins, notre situation a été relativement
favorable, grâce aux mesures de précaution prises et aux achats importants effectués en temps utiles, en Sologne et dans les Landes. Le conseil a
voulu assurer pour l’avenir une partie des fournitures de bois nécessaires
à la marche des exploitations. Le conseil a voulu se rendre aussi indépendant que possible du prix croissant des bois. Il a pu acheter en Sologne
GHX[ SURSULpWpV ERLVpHV IRUPDQW XQH VXSHUÀFLH G·XQ PLOOLHU G·KHFWDUHV
sur lesquelles il vient de commencer des exploitations forestières en même
temps qu’il fait procéder activement à des plantations et à des semis de
SLQVV\OYHVWUHV$XFRXUVGHO·DXWRPQHSOXVGHSLHGVG·DUEUHVRQW
ainsi été plantés30ª
/DUpRUJDQLVDWLRQGHVFKDUERQQDJHVVHWURXYHLQÁXHQFpHSDUOHVPRXYHPHQWVG·RUJDQLVDWLRQVFLHQWLÀTXHGXWUDYDLOHWDFFpOpUpHSDUOHFRQWH[WH
GHOD3UHPLqUH*XHUUHPRQGLDOH/HVKRXLOOqUHVVRQWGRQFGHSOXVHQSOXV
enclines à rendre leur activité plus stable économiquement et donc plus
SpUHQQH/·DFKDWGHGRPDLQHVIRUHVWLHUVDÀQGHFRQWU{OHUO·DSSURYLVLRQQHment en bois relève de cet objectif. Les entreprises minières ont tendance
jGLYHUVLÀHUOHXUDFWLYLWpSRXUV·DVVXUHUGHVVWRFNVGHPDWLqUHVSUHPLqUHV
(, 3EURRE ET ( 6ERNEY ¦ ,ES BOIS DE MINES¨ § LOC CIT P #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE
GmNmRALE DE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC VXIÀVDQWVDÀQG·H[HUFHUGDQVOHVPHLOOHXUHVFRQGLWLRQVSRVVLEOHVOHXUIRQFWLRQSULQFLSDOHO·H[WUDFWLRQGXFKDUERQ
5. #/-0,%8% 4%#(.)15% -).)%2 %8#%04)/..%,
$!.3 5.% 0b2)/$% $´%8#%04)/.
Les dispositions prises par l’État et les compagnies font naître des
conditions d’exploitation spéciales. Dans la Loire on en revient à des méthodes écartées depuis longtemps. À la faveur de la guerre, les travaux
DUWLVDQDX[VHPXOWLSOLHQW(QO·LQJpQLHXUGHV0LQHVGH6DLQWeWLHQQH
OHVGpFULWHQFHVWHUPHV
« Dans un département de la Loire, où un grand nombre de couches afÁHXUHQWRXSHXYHQWrWUHDWWHLQWHVSDUGHVWUDYDX[SHXSURIRQGVQ·H[LJHDQW
que des installations rudimentaires, les amodiations31 se sont multipliées
pendant la guerreǻ
Ce sont donc les conditions géologiques du bassin houiller de la Loire et les conditions économiques particulières créées par l’État durant ce
FRQÁLW TXL SHUPHWWHQW OD PXOWLSOLFDWLRQ GHV DPRGLDWLRQV HW GHV WUDYDX[
artisanaux qui les accompagnent. Cette multitude de petits exploitants ne
V·HVWSDVSUpVHQWpHGDQVOHEDVVLQKRXLOOHUGHSXLVGDWHGHODIRQGDtion du grand monopole houiller que constitue la Compagnie des Mines
GHOD/RLUH'qVOHVUHPLVHVHQDFWLYLWpGHVFRQFHVVLRQVLQH[SORLWpHV
GpEXWHQW HQ 0 7DUG\ UHSUHQG O·H[SORLWDWLRQ GH OD %DUDLOOqUH HQ
j 0RQWKLHX FH VRQW 00 5RFKHWDLOOpH TXL V·HQ FKDUJHQW OH 5HFOXV
est lui exploité par la Société des houillères de Saint-Étienne, Crozaque et
OH0RXLOORQSDUOD6RFLpWpQRXYHOOHGHVFKDUERQQDJHVGX*LHU&RXORX[HVW
GpYROXHj0+HUFHOLQ7UpPROLQj0*DUGRQ7DUWDUDVHW6DLQW-HDQGH
7RXODVj09HUQH\&RPEHVHWeJDUDQGHj00*XLOORWHWFRPSDJQLH33.
­O·LQVWDUGH07DUG\TXLOHPDUVHQYRLHXQHGHPDQGHG·RFFXpation temporaire de terrain de la concession de la Baraillère à l’ingénieur
GHV0LQHV/HEXWGHO·H[SORLWDQWHVWDORUVGHUHFRQQDvWUHOHVDIÁHXUHPHQWV
GHV WURLVLqPH TXDWULqPH HW FLQTXLqPH FRXFKHV GX V\VWqPH KRXLOOHU GH
Saint-Étienne, l’importance et la valeur réelle de celles-ci avant de comPHQFHUGHVWUDYDX[G·H[SORLWDWLRQSURSUHPHQWGLWV7DUG\GDQVVDOHWWUH
SRXVVHO·LQJpQLHXUGHV0LQHVjKkWHUVDGpPDUFKH
!MODIATION EXPLOITATION D´UNE MINE MOYENNANT UNE REDEVANCE PmRIODIQUE
0IERRE 'UILLAUME ¦ ,ES MINES DE LA ,OIRE¨ § loc. cit. P ,OUIS *OSEPH 'RAS (ISTOIRE mCONOMIQUE GmNmRALE DES MINES¨ OP CITP # DE 2%#)43 (OUILLnRES LIGmRIENNES « Je vous serais très obligés de vouloir bien hâter le plus possible l’autoULVDWLRQTXHMHVROOLFLWHDÀQGHPHSHUPHWWUHV·LO\DOLHXG·H[SORLWHUFHV
couches qui donneront très rapidement un appoint aux besoins réels en ce
moment de combustibles dans votre région comme ailleurs en Franceª
Ces petites exploitations reprennent généralement d’anciens travaux
TXLVRQWURXYHUWVGqVFRPPHOHSXLWV1HXIDXVHLQGHODFRQFHVVLRQ
GH*UDYHQDQG. L’ingénieur des Mines, quand il autorise ces amodiations
est tout à fait conscient du caractère artisanal, peu rémunérateur et éphémère de l’exploitation. Toutefois, il donne son accord en raison de l’intense demande de houille.
Les exploitants n’abordent pas ces anciens travaux comme les autres. Ils
se contentent uniquement d’enlever le charbon sans effectuer des travaux
préparatoires, comme l’exigeraient les règles de l’art. Ainsi, au sein des
exploitations rouvertes, on se contente de simples glanages. La concession
des Combes et Égarande, remise en activité en septembre 1917, nous livre
XQH[HPSOHIUDSSDQWGHFHWWHSUDWLTXH
©2QDURXYHUWO·DQFLHQQHIHQGXH d’Égarande. Une fois rouverte on a
établi une deuxième communication avec le jour par un petit puits, aménagé ensuite comme retour d’air. Entre la fendue et le niveau du puits
G·DpUDJHFRWHO·RQDHIIHFWXpTXHOTXHVJODQDJHVVDQVLPSRUWDQFHGDQV
ODJUDQGHFRXFKHGH5LYHGH*LHU$X6XGGHODIHQGXHFRWHO·RQD
poussé une reconnaissance, également en grande couche, qui s’est allongée sur 80 mètres de longueur sans sortir des vieux travaux. Un faux puits,
FUHXVpHQDYDOGXQLYHDXGHODIHQGXHDpWpDUUrWpjPqWUHVGHSURIRQdeur, après avoir traversé des vieux travaux sur presque toute sa hauteur.
8QWUDoDJHFRWHSULVGDQVXQHIRUPDWLRQGHFKDUERQWUqVLUUpJXOLqUHD
WURXYpDX1RUG(VWXQUHVVHUUHPHQWWRWDOGHODFRXFKHGDQVOHTXHOLOV·HVW
DUUrWp8QDXWUHWUDoDJHRSSRVpHQGLUHFWLRQGX6XG2XHVWSDUWLGDQVGHV
YLHX[WUDYDX[VHWURXYDLWOHRFWREUHHQSOHLQVWpULOHVXUPqWUHV
de longueur37ª
6LO·RQYHXWELHQUpVXPHUODVLWXDWLRQGHODIHQGXHG·eJDUDQGHLOQ·\
DMDPDLVSHQGDQWOD3UHPLqUH*XHUUHPRQGLDOHpWpIDLWDXFXQHH[SORLWDtion proprement dite. L’exploitant s’est contenté d’effectuer des travaux
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 DEMANDE D´OCCUPATION DE TERRAIN RAPPORT DE L´INGmNIEUR DES
-INES
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 DmCLARATION DE FERMETURE DES TRAVAUX DU PUITS .EUF DANS LA CON
CESSION DE 'RAVENAND RAPPORT DE L´INGmNIEUR DES -INES AVRIL &ENDUE OUVERTURE DANS LE GISEMENT CONSTITUmE D´UNE GALERIE PARTANT g ¾ANC DE COTEAU DIRECTEMENT DANS LES
COUCHES
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 DEMANDE DE VALIDITm D´AMODIATION NOVEMBRE ET DEMAN
DE D´ABANDON DES TRAVAUX OCTOBRE RAPPORT DE L´INGmNIEUR EN CHEF DES -INES
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC de recherche et d’aménagement, conduits d’ailleurs d’une façon intermittente, qui n’aboutissent à aucun résultat tangible et coûtent plus de
IUDQFV DX[ HQWUHSUHQHXUV38. Ces petites entreprises minières qui
VRQWFRQVWLWXpHVJUkFHDXFRQWH[WHSDUWLFXOLHUGHOD*UDQGH*XHUUHVXELVsent quelques années plus tard une situation économique catastrophique
qui les mène à la faillite.
Si les petites houillères se contentent de simples glanages, les grandes
entreprises minières élaborent un complexe technique minier plus adapté
à la situation et à leur structure.
Toutefois, les grandes compagnies peuvent en parallèle de leur complexe technique minier mettre en place une exploitation des anciens travaux se trouvant sur leur territoire. Ainsi, la Compagnie des Mines de
5RFKHOD0ROLqUHHW)LUPLQ\GpGLHjFHWWHDFWLYLWpXQHSDUFHOOHHQWLqUHGH
VDFRQFHVVLRQGXUDQWOD3UHPLqUH*XHUUHPRQGLDOH&HVHFWHXUSDUWGXSOktre39 du puits Lachaux d’où la compagnie creuse une fendue destinée à
reconnaître les piliers de charbon laissés par les anciennes exploitations de
la grande couche du Breuil. En un mot, on sape les piliers de charbon qui
servent au soutènement du toit des travaux datant du XVIIIe et XIXe siècle
TXLHPSOR\DLHQWODPpWKRGHGHVFKDPEUHVHWSLOLHUV.
+RUPLVFHVTXHOTXHVJODQDJHVFHFKDUERQQDJHFUHXVHGqVGDQVOH
SUp/DWRXUj)LUPLQ\XQHWUDQFKpHGHVWLQpHjSUpSDUHUO·H[SORLWDWLRQGX
FKDUERQUHVWDQWGDQVOHVDIÁHXUHPHQWVGHODJUDQGHFRXFKH/DWRXU. La
FRPPXQHGH)LUPLQ\YRLWSHQGDQWOD3UHPLqUH*XHUUHPRQGLDOHO·DSSDrition de fendues un peu partout sur son territoire. En 1917 neuf fendues,
galeries ou tranchées sont en activité. Voici la liste et le tonnage de charERQH[WUDLWSDUFHVRXYHUWXUHVGXUDQWO·DQQpH
©)HQGXHGHV*UDQJHVWRQQHV
)HQGXH&KDSRQRWWRQQHV
7UDQFKpH&KDSHORQWRQQHV
*DOHULHGX6ROHLOWRQQHV
7UDQFKpHGX6ROHLOWRQQHV
)HQGXH/DWRXUWRQQHV
)HQGXH&DPLOOHWRQQHV
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 DEMANDE DE VALIDITm D´AMODIATION NOVEMBRE ET DEMAN
DE D´ABANDON DES TRAVAUX OCTOBRE RAPPORT DE L´INGmNIEUR EN CHEF DES -INES
,E PLhTRE EST PLUS CONNU SOUS LE NOM DE CARREAU DE MINE )L S´AGIT DE L´ENVIRONNEMENT DIRECT D´UN PUITS DE
MINE BIEN SOUVENT COMPOSm DES MACHINES D´EXTRACTION D´AmRAGE DE LAVOIR¨
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT GmNmRAL DU DIRECTEUR DES -INES DE 2OCHELA-OLInRE ET
&IRMINY SUR L´EXERCICE DE !RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT GmNmRAL DU DIRECTEUR DES -INES DE 2OCHELA-OLInRE ET
&IRMINY SUR L´EXERCICE DE # DE 2%#)43 (OUILLnRES LIGmRIENNES )HQGXHGHOD7DUGLYHWRQQHV
*DOHULHGHV&KDQGHOOHVWRQQHV. »
Cette entreprise voit pendant cette période d’exception l’arrêt total de
ces travaux ordinaires pour se consacrer uniquement aux travaux. Ceuxci sont souvent composés de dépilage de lentilles et de mise en place de
PR\HQVGHURXODJHHWG·H[SpGLWLRQGXFKDUERQ/HVIHQGXHVFRQVWLWXHQW
l’élément essentiel de ce complexe technique minier d’exception, elles
VRQW G·DLOOHXUV SUHVTXH WRXMRXUV DVVRFLpHV j XQ SOkWUH GpMj H[LVWDQW DÀQ
GHSURÀWHUGHVLQVWDOODWLRQVGHFHOXLFL&HVRXYHUWXUHVH[SORLWHQWGHVOHQtilles, c’est-à-dire des amas de charbon, ou des piliers de charbon laissés
par les travaux du XVIIIe et XIXe siècle.
Le nombre de fendues diminue sensiblement sur le territoire commuQDO GH )LUPLQ\ FH TXL HVW G€ DX IDLW TXH FHV RXYHUWXUHV H[SORLWHQW GHV
parcelles minuscules de la grande couche Latour. II faut d’ailleurs remarquer que les quantités extraites de ces travaux d’art sont, à l’échelle de
O·LQGXVWULHPLQLqUHSUHVTXHLQVLJQLÀDQWHV,OIDXWDWWHQGUHOHMXLQ
pour que ce complexe technique minier d’exception disparaisse du terriWRLUHGHOD&RPSDJQLHGHV0LQHVGH5RFKHOD0ROLqUHHW)LUPLQ\. Quand
ODSKDVHGHSUpSDUDWLRQHVWWHUPLQpHRQSDVVHjO·H[WUDFWLRQF\FOHRXOH
rendement est maximal. Toutefois, celui-ci doit toujours être accompagné
par une autre phase de préparation pour assurer la stabilité économique
GHO·HQWUHSULVH2UORUVGXSUHPLHUFRQÁLWPRQGLDOXQHFRPSDJQLHSUHQG
OH ULVTXH GH VWRSSHU VHV WUDYDX[ SUpSDUDWRLUHV OD 6RFLpWp DQRQ\PH GHV
Mines de la Loire.
&HWWHKRXLOOqUHDÀQGHVDWLVIDLUHjODGHPDQGHGHO·LQGXVWULHGHO·DUPHment, augmente sa production de façon tout à fait classique en déhouillant
les quartiers des couches prévues à cet effet par les travaux préparatoires.
Ceci constitue une action qui relève à la fois d’un concours de circonstances et d’une intense activité dans le domaine des travaux préparatoires
GXUDQWOHVDQQpHVDQWpULHXUHVDXFRQÁLW&·HVWFHTXHQRXVGLWHQVXEVWDQFH
OHUDSSRUWGXFRQVHLOG·DGPLQLVWUDWLRQjO·DVVHPEOpHJpQpUDOHGH
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT GmNmRAL DU DIRECTEUR DES -INES DE 2OCHELA-OLInRE ET
&IRMINY SUR L´EXERCICE DE (ABITUELLEMENT LES CHARBONNAGES RmALISENT DES TRAVAUX ORDINAIRES CEUXCI SONT COMPOSmS DE DEUX TYPES DE
TRAVAUX LES TRAVAUX PRmPARATOIRES QUI SONT DESTINmS g PRmPARER UN mTAGE C´ESTgDIRE g METTRE EN PLACE LES
QUARTIERS D´EXPLOITATION POUR L´EXTRACTION PROPREMENT DITE CELLECI CONSTITUANT LE SECOND TYPE DE TRAVAUX ,ES
LENTILLES SONT DES AMAS DE CHARBON QUI NE CONSTITUENT PAS DE COUCHE DE HOUILLE
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT GmNmRAL DU DIRECTEUR DES -INES DE 2OCHELA-OLInRE ET
&IRMINY SUR L´EXERCICE DE !RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT GmNmRAL DU DIRECTEUR DES -INES DE 2OCHELA-OLInRE ET
&IRMINY SUR L´EXERCICE DE ET 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC ©1RXVDYRQVpWpHQPHVXUHGHUpSRQGUHjO·DSSHOGHVSRXYRLUVSXEOLFV
en augmentant notablement notre extraction, en 1917, et de faire face, de
la sorte, aux besoins en charbons de la Défense nationale. (…) La production a augmenté, la plus élevée que notre Société ait jamais réalisée en
WHPSVGHSDL[HWGpSDVVDQWGHFHOOHREWHQXHO·DQGHUQLHU&·HVWjQRV
WUDYDX[SUpSDUDWRLUHVV·pOHYDQWjSOXVGHPLOOLRQVGHSXLVKXLWDQVTXH
nous devons d’avoir pu obtenir un semblable résultat, qui serait dépassé
HQFRUHVLQRXVQHQRXVKHXUWLRQVSDVjGHVGLIÀFXOWpVWRXWHVSDUWLFXOLqUHV
de transports et d’approvisionnementsª
/D&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUHHVW
jODFURLVpHGHVFKHPLQV(QHIIHWHOOHFKRLVLWDXGpEXWGXFRQÁLWHQ
d’arrêter les chantiers les moins productifs, de ralentir les travaux préparatoires stériles et de concentrer les exploitations dans les tailles à grand
UHQGHPHQW DÀQ GH UpDOLVHU OD SURGXFWLRQ PD[LPDOH. Cette attitude est
d’ailleurs saluée par les journaux comme étant de bon aloi.
$XÀOGXFRQÁLWOHFKDUERQQDJHGHODYDOOpHGHO·2QGDLQHUpYLVHVDSRsition. L’extraction intense entraînant un véritable surmenage du matériel
et des installations, il décide de mettre en place un complexe technique
minier parallèle à base d’ouvertures temporaires destinées à exploiter les
DIÁHXUHPHQWVHWOHVOHQWLOOHV&HSURFpGpSHUPHWGHPDLQWHQLUXQQLYHDX
de production tout à fait correct et de ménager quelque peu le matériel et
les installations du complexe technique habituel. Le conseil d’administraWLRQIDLWG·DLOOHXUVUHPDUTXHUFHWpWDWGHIDLWGDQVVRQUDSSRUWHQ
« Il serait imprudent d’escompter, même pendant la période des hostilités, la permanence d’un déhouillement aussi rapide, si l’ouverture de
WUDYDX[SURGXFWLIVVXUOHVDIÁHXUHPHQWVQ·DSSRUWDLWVRQFRQFRXUVGDQVOD
production générale. Ils fournissent actuellement près de 800 bennes par
jour, soit environ 100 000 tonnes par anª
'DQVODGLYLVLRQGHOD%pUDXGLqUHO·H[SORLWDWLRQGHVDIÁHXUHPHQWVHVW
également intense, permettant ainsi de ménager le gisement en profondeur. La progression du tonnage est réalisée dans les exploitations seconGDLUHV RXYHUWHV VXU FHV DIÁHXUHPHQWV &HSHQGDQW FHV WUDYDX[ VRQW SDUticulièrement intéressants et paraissent également assez importants. Des
!RCHIVES DmPARTEMENTALES DE LA ,OIRE %40 RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE GmNmRALE
DE #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE
GmNmRALE DE #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , DOSSIER DE PRESSE SUR LA #OMPAGNIE DES (OUILLnRES DE
-ONTRAMBERT ET DE LA "mRAUDInRE JOURNAL NON IDENTI½ABLE mDITION DU AVRIL #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE
GmNmRALE DE # DE 2%#)43 (OUILLnRES LIGmRIENNES LQVWDOODWLRQVFRPPHFHOOHGXSXLWV6DLQW-RVHSKSURGXLVHQWWRQQHVSDU
jour, provenant de la grande couche et de la couche des trois gores. Le
IDLVFHDXGHV&RPEHVTXLGRQQHXQDSSRLQWGHWRQQHVSDUMRXUODLVVH
apparaître des perspectives d’avenir encourageantes et allant au-delà du
VLPSOHFRQWH[WHGHOD3UHPLqUH*XHUUHPRQGLDOH.
/HVLQVWDOODWLRQVVHFRQGDLUHVSODFpHVVXUOHVDIÁHXUHPHQWVGHODGLYLVLRQ
de la Béraudière, malgré leur taille conséquente pour des établissements
GHFHW\SHQHPRGLÀHQWSDVIRQGDPHQWDOHPHQWOHFRPSOH[HWHFKQLTXHPLQLHUGHOD&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXGLqUH
À partir de 1917, deux complexes techniques coexistent, le complexe techQLTXH G·DYDQWJXHUUH HVW PLV HQ VRPPHLO DX SURÀW GX FRPSOH[H WHFKQLque provisoire au sein duquel les fendues jouent un rôle central. Dès cette
pSRTXHO·H[SORLWDWLRQGHVDIÁHXUHPHQWVVHPXOWLSOLHDXVHLQGXFKDUERQnage et si certaines installations, notamment celle de la Béraudière, sont
conséquentes, elles ne représentent pas la majorité. L’essentiel des établissements miniers de l’époque sont à l’image de ceux qui se développent sur
OHWHUULWRLUHGHOD&RPSDJQLHGHV0LQHVGH5RFKHOD0ROLqUHHW)LUPLQ\
De nos jours, il reste sur le territoire de Montrambert les vestiges d’une
fendue engendrée par la guerre.
/HQRPXVXHOGHFHWWHLQVWDOODWLRQHVW©IHQGXHªFDUFHWWHRXYHUWXUH
H[SORLWHXQHOHQWLOOHGHFKDUERQVHWURXYDQWjPqWUHVGHSURIRQGHXU
*pRJUDSKLTXHPHQW HOOH HVW VLWXpH VXU OD FRPPXQH GX &KDPERQ)HXJHUROOHV SUqV GH OD FDUULqUH 5ROODQG HW GH O·DQFLHQ SXLWV 5ROODQG 1ƒ j
PqWUHVGHO·DQFLHQQHURXWHQDWLRQDOHHWGXSXLWVGX0DUDLV. Elle
exploite une lentille qui est en réalité un amas de charbon provenant des
DIÁHXUHPHQWV GH OD FRXFKH GHV &RPEHV VH WURXYDQW VXU OH V\QFOLQDO VpSDUDQW OH &KDPERQ)HXJHUROOHV GH 5RFKHOD0ROLqUH /D IHQGXH HVW
VLWXpHjPqWUHVDXVXGGHFHVDIÁHXUHPHQWV.
#ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE
GmNmRALE DE !RCHIVES DmPARTEMENTALES DE LA ,OIRE &I #0 PLAN DE LA CONCESSION DE -ONTRAMBERT ET DE LA "mRAUDInRE
DONT LA DATATION DOIT SE SITUER ENTRE ET 2ELEVmS ARCHmOLOGIQUES RmALISmS SUR LE TERRAIN
!RCHIVES DmPARTEMENTALES DE LA ,OIRE &I #0 PLAN DE LA CONCESSION DE -ONTRAMBERT ET DE LA "mRAUDInRE
DONT LA DATATION DOIT SE SITUER ENTRE ET #ENTRE DES ARCHIVES DU MONDE DU TRAVAIL !1 , RAPPORT DU CONSEIL D´ADMINISTRATION g L´ASSEMBLmE
GmNmRALE DE %UGnNE #OSTE .OUVELLES CONTRIBUTIONS g LA TOPOGRAPHIE SOUTERRAINE DU BASSIN DE LA ,OIRE 0ARIS IMPRIMERIE
NATIONALE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/*!3 ,UC 0HOTO 6ESTIGES DE LA FENDUE 3OURCE CRmDIT PERSONNEL
(QOD&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPEHUWHWGHOD%pUDXdière s’associe à la Compagnie des chemins de fer à voie étroite (CFVE) de
6DLQWeWLHQQHGDQVXQVRXFLG·LQWpUrWJpQpUDOSURSUHjOD3UHPLqUH*XHUUH
mondiale. Le directeur de l’exploitation de cette compagnie de transport
VWpSKDQRLVHHVWSOHLQHPHQWFRQVFLHQWGHODVLWXDWLRQHWGHVDJUDYLWp
« (…) vu l’engorgement des voies ferrées et des gares PLM dans la réJLRQLQGXVWULHOOHGHOD/RLUHHWODSpQXULHGHVDXWUHVPR\HQVGHWUDQVSRUW
LO\DXUDLWJUDQGLQWpUrWHQFHPRPHQWjLQWHQVLÀHUOHWUDQVSRUWGHVPDUchandises de toute nature dans Saint-Étienne et sa banlieue, à l’aide des
WUDPZD\VQRWDPPHQWHQWUHPLQHVHWXVLQHVQRPEUHXVHVHWLPSRUWDQWHV
travaillant pour la défense nationaleª
/DIHQGXHXWLOLVHOHSOkWUHGXSXLWVGX0DUDLVQRWDPPHQWHQPDWLqUHGHVWRFNDJHGXFKDUERQ/D&RPSDJQLHGHV+RXLOOqUHVGH0RQWUDPbert et de la Béraudière crée une installation permettant le chargement du
charbon, composée d’une bascule, de plusieurs trémies et d’un quai. Le
PDUVGDWHGHO·DSSUREDWLRQGHOD&)9(DXSURMHWODFRQVWUXFWLRQ
GHO·HPEUDQFKHPHQWGHWUDPZD\GpEXWH&HWWHLQVWDOODWLRQXQHIRLVUpDOL-
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 RAPPORT DES SUBDIVISIONNAIRES DE LA #&6%
# DE 2%#)43 (OUILLnRES LIGmRIENNES VpHSHUPHWDX[WUDPZD\VG·DFFpGHUGLUHFWHPHQWDXTXDLGHFKDUJHPHQWj
disposition sur le plâtre du Marais.
L’aiguillage de l’embranchement se trouve sur la route nationale 88 à
SUR[LPLWpGHODERUQHNLORPpWULTXH/DYRLHWUDYHUVHFHWWHURXWHHWIUDQFKLWOHUXLVVHDXGHO·2QGDLQHVXUXQSRQWPpWDOOLTXHHOOHSpQqWUHHQVXLWH
sur le terrain de la Compagnie des Mines de Montrambert. D’après la
CFVE, cet embranchement présente un caractère d’urgence dû au contexte
GHJXHUUHLOSHUPHWG·HQYR\HUOHFRPEXVWLEOHVDQVWUDQVERUGHPHQWGHOD
mine chez les industriels. La base de chargement, prévue verbalement le
PDUVV·pOqYHjFLQTXDQWHWRQQHVSDUMRXU
/DIHQGXHHVWUHSUpVHQWDWLYHGHVLQVWDOODWLRQVWHPSRUDLUHVTXHO·RQ
rencontre chez beaucoup de compagnies minières durant la Première
*XHUUH PRQGLDOH &H W\SH G·RXYHUWXUH FRQVWLWXH OD EDVH G·XQ FRPSOH[H
technique minier exceptionnel d’une période d’exception.
#/.#,53)/.
/HVSHWLWHVHQWUHSULVHVPLQLqUHVQpHVGHOD3UHPLqUH*XHUUHPRQGLDOH
VRQWDXQRPEUHGHGL[QHXIHWSURGXLVHQWHQHQFRUHWRQQHVGH
charbon. Toutefois, les conditions de vie de ces petites entités expliquent
qu’elles aient disparu avec la paix. Cependant, ce n’est pas leur existence
éphémère qui touche les forces vives de la région. Bien plus lourde de
conséquences est l’attitude de certaines grandes compagnies qui se sont
laissées aller à une dangereuse politique de facilité, notamment Villebœuf
HWOHV+RXLOOqUHVGH6DLQWeWLHQQH1pDQPRLQVLOQHIDXWSDVJpQpUDOLVHU
cette attitude à toutes les grandes compagnies dont certaines ont su plus
ou moins préserver leur complexe technique minier.
0DOKHXUHXVHPHQWO·HVVRXIÁHPHQWGHVPLQHVGXEDVVLQGHOD/RLUHDX
OHQGHPDLQ GH OD JXHUUH HVW LQpYLWDEOH OHV WUDYDX[ G·DYHQLU VRQW LQH[LVtants, l’équipement des puits est usé et, pour un temps, irremplaçable,
OHSHUVRQQHOPDQTXHTXDQWjODVLWXDWLRQÀQDQFLqUHGHVHQWUHSULVHVHOOH
n’est brillante qu’en apparence. Les conséquences lointaines de la guerre
accélèrent le vieillissement du bassin. Paradoxalement, la position privilégiée des années de guerre a des conséquences plus graves que les destrucWLRQVTXLGDQVOH1RUGSRXVVHQWjXQUDMHXQLVVHPHQWWRWDO
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 PROJET D´EMBRANCHEMENT INDUSTRIEL AU PUITS DU -ARAIS
!RCHIVES DmPARTEMENTALES DE LA ,OIRE 3 PROJET D´EMBRANCHEMENT INDUSTRIEL AU PUITS DU -ARAIS
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON ,A #OMPAGNIE DES -INES D´5RANIUM
DE &RANCEVILLE #/-5& GENnSE ET CONTRxLE DE L´ACTIVITm 2OBERT %DGARD .DONG
À
L’ISSUE DE LA
SECONDE GUERRE MONDIALE, la France entend deveQLUXQHSXLVVDQFHQXFOpDLUHjSDUWHQWLqUH&HSHQGDQWSRXU\
parvenir, il lui faut disposer, entre autres, de sources lui permettant d’assurer de manière certaine son indépendance en approvisionnement en uranium, matière première essentielle qui lui fait largement
défaut. En effet, aussi bien dans le sous-sol métropolitain qu’ultramarin,
les connaissances relatives aux disponibilités de cette substance minière
sont quasiment nulles12QFRPSUHQGGqVORUVSRXUTXRLOH&RPPLVVDULDW
jO·pQHUJLHDWRPLTXH&($RUJDQLVPHFUppOHRFWREUHHWVSpFLDOLVp
GDQVOHVTXHVWLRQVQXFOpDLUHVHQWUHSUHQGjSDUWLUGHXQYDVWHFKDQtier de prospection d’uranium dans les territoires africains sous obédience
française. Les résultats obtenus sont toutefois loin d’être satisfaisants, sauf
DX*DERQRHVWGpFRXYHUWOHJLVHPHQWpFRQRPLTXHPHQWYLDEOHGH0RXQDQD6XLYDQWODSROLWLTXHÀ[pHSDUVRQGLUHFWRLUHOHFRPLWpGHO·pQHUJLH
atomique, le CEA envisage aussitôt l’exploitation du gisement découvert
SDUOHELDLVG·XQHHQWUHSULVH&HWWHWkFKHVHUDFRQÀpHjOD&208)&RQVWLWXpHHQDSUqVPRXOWSpULSpWLHVDGPLQLVWUDWLYHVHWÀQDQFLqUHVOD&208)DSRXUREMHWVRFLDO©ODUHFKHUFKHODPLVHHQYDOHXUHWO·H[SORLWDWLRQ
directe ou indirecte de tout gisement de substances minérales métalliques
et plus particulièrement les substances utiles à l’énergie atomique et les
!VANT LA CRmATION DU #%! LA MINmRALOGIE DE L´URANIUM EN &RANCE EST RmDUITE g TROIS ESPnCES NETTEMENT IDENTI
½mES L´AUTUNITE DmCOUVERTE PAR DE #HAMPEAUX EN g 3AINT3YMPHORIENDE-ARMAGNE 3AxNEET,OIRE
LA CHALCOLITE DmCOUVERTE EN PAR "OISSE PRnS D´%NTRAIGUES !VEYRON ET LA PECHBLENDE DmCOUVERTE PAR $E
MARTY VERS g 3AINT2mMYSUR$UROLLES 0UYDE$xME #EPENDANT IL N´Y A PAS D´EXPLOITATION INDUSTRIELLE
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD substances connexes, ainsi que l’achat, la vente ou le traitement des ces
mêmes substances minéralesª(OOHGpPDUUHVRQDFWLYLWpHQ
/D SUpVHQWH UpÁH[LRQ D XQ GRXEOH REMHFWLI G·XQH SDUW UHYLVLWHU OHV
FRQGLWLRQVH[DFWHVGHODQDLVVDQFHGHOD&208)HWG·DXWUHSDUWYRLUVLOD
&208)HVWSUpVHQWHDX[GLIIpUHQWVVWDGHVLQGXVWULHOHWFRPPHUFLDOGHVRQ
activité pendant sa première période d’existence. Pour ce faire, l’étude se
FRQFHQWUHVXUODSpULRGH/DSUHPLqUHERUQHWHPSRUHOOH
FRQVWLWXH XQ SRLQW GH GpSDUW QpFHVVDLUH F·HVW O·DQQpH GH OD GpFRXYHUWH
du gisement de Mounana, résultat de huit années de labeur du CEA au
*DERQ8QHGpFRXYHUWHTXLGpFOHQFKHODSURFpGXUHGHFUpDWLRQGHOD&208) 4XDQW j OD VHFRQGH ERUQH WHPSRUHOOH HOOH PDUTXH OD ÀQ GH
l’exploitation du gisement de Mounana.
,! $b#/56%24% $5 ')3%-%.4 $´52!.)5- $% -/5.!.!
%4 ,! #/.34)454)/. $% ,! #/-5&
L’approvisionnement en matières premières constitue l’un des problèmes essentiels de l’établissement de toute nouvelle industrie. L’établissement de l’industrie nucléaire en France, comme ailleurs, n’échappe pas à
cette règle. Elle exige de très nombreuses matières premières, au premier
rang desquelles se place l’uranium. Raison pour laquelle le CEA – qui
GLVSRVH j VD FUpDWLRQ HQ G·XQ IDLEOH VWRFN G·XUDQLXP3 ne pouvant
lui permettre que les premiers essais –, entend maîtriser son approvisionnement en uranium. Dans cette optique, son service des Recherches et
H[SORLWDWLRQV PLQLqUHV 5(0 HQWUHSUHQG XQH SURVSHFWLRQ V\VWpPDWLTXH
dans les territoires africains sous obédience française. Si à Madagascar,
des gisements sont découverts et exploités, ils concernent des gisements
d’autres matières radioactives. Dans les autres territoires, des indices sans
JUDQGLQWpUrWVRQWPLVDXMRXUVDXIDX*DERQRYLHQWODVDWLVIDFWLRQDYHF
la découverte du gisement économiquement viable de Mounana, dont la
FRQVpTXHQFHSUHPLqUHHVWODQDLVVDQFHGHOD&208)
#ENTRE HISTORIQUE DES ARCHIVES NATIONALES #(!.0ARIS &ONDS *ACQUES,UCIUS STATUTS DE LA #OMPA
GNIE DES -INES D´URANIUM DE &RANCEVILLE
,ES SEULES RESSOURCES EN URANIUM DONT DISPOSE LA &RANCE POUR SES RECHERCHES SONT CONSTITUmES D´UNE PART
D´UN STOCK DE HUIT TONNES D´OXYDE PRoTm EN PAR L´5NION MINInRE DU (AUT+ATANGA g &RmDmRIC *OLIOT #E
STOCK A mTm CACHm PENDANT TOUTE LA GUERRE DANS UNE MINE DE PHOSPHATES DE +HOURIBGA AU -AROC $´AUTRE
PART ON RETROUVE EN GARE DU (AVRE O| IL A PASSm TOUTE LA GUERRE UN WAGON D´URANATE IMPUR CONSIDmRm COMME
UN COLORANT SANS VALEUR )L REPRmSENTE L´mQUIVALENT D´ENVIRON TROIS TONNES D´OXYDE
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON ,A DmCOUVERTE DU GISEMENT D´URANIUM DE -OUNANA
DmCLENCHEUR DE LA CONSTITUTION DE LA #/-5&
Le gisement d’uranium de Mounana n’est pas découvert dès le début
des recherches. Il est le résultat de huit années de persévérance. C’est en
HIIHWHQTXHOH&($HQWUHSUHQGOHVUHFKHUFKHVG·XUDQLXPDX*DERQ
(OOHV SRUWHQW G·DERUG XQLTXHPHQW VXU OH VRFOH FULVWDOOLQ GX &KDLOOX 2Q
SHQVH TX·j O·H[HPSOH GHV PDVVLIV KHUF\QLHQV IUDQoDLV R GHV GpFRXYHUtes intéressantes viennent d’être effectuées, cette région est susceptible de
FRQWHQLU GHV JLVHPHQWV ÀORQLHQV &HV WUDYDX[ GH UHFKHUFKH VH GpURXOHQW
SULQFLSDOHPHQWGDQVOHVUpJLRQVFLDSUqV
©5pJLRQVG·(WpNp²%DVVLQGHODKDXWH1\DQJDHWGHVHQYLURQVGH
%RXQJRX²0DVVLIJUDQLWLTXHGHODUpJLRQGH0D\DNR
5pJLRQGHODPR\HQQH1\DQJD²%DVVLQVGHODKDXWH/RXHVVpHW
GHODKDXWH1\DQJD²9HUVDQWVVXGRXHVWGHV0RQWV%LUURJRX²=RQHFRPprise entre Mimongo et Boué.
5pJLRQVVLWXpHVDXQRUGRXHVWjO·HVWHWDXVXGGH0LPRQJR
Étude des granites et de leur zone de contact (régions des anciens permis
GHODVRFLpWpPLQLqUHGH.RXODPRXWRXeWXGHGXV\VWqPHPpWDPRUSKLTXHGHO·2IIRXp
eWXGH GX 0RQW *RXW]L1\DQJD UpJLRQ GH 7FKLEDQJD0D\RXPED
Étude détaillée du granite de Fougamou. Étude détaillée de la région des
0RQWVGH.RXQRXUD%RXDOLª
Tous ces travaux n’aboutissent qu’à la découverte de quelques gîtes
alluvionnaires de monazite. Les seules faibles anomalies rencontrées
concernent des pegmatites ou des croûtes organiques noires sans intérêt ;
d’où l’abandon de ces premiers travaux de recherche.
7RXWHIRLV HQ V·LQVSLUDQW GHV UpFHQWHV GpFRXYHUWHV FDQDGLHQQHV
dans les terrains sédimentaires précambriens, le CEA change alors la méthode et l’orientation de ses prospections. Il commence la prospection déWDLOOpHGXFHQWUHHVWGX*DERQQRWDPPHQWOHVIRUPDWLRQVSUpFDPEULHQQHV
TXL ERUGHQW OH PDVVLI GX &KDLOOX F·HVWjGLUH OHV UpJLRQV GH 0D\XPED
Tchibanga et Franceville. À cet effet, deux reconnaissances sont lancées.
/DSUHPLqUHSRUWHVXUOHVVpULHVSUpFDPEULHQQHVGX0D\RPEpGDQVODUpJLRQGH7FKLEDQJD0D\XPED/DVHFRQGHSRUWHVXUO·pWXGHGHVIRUPDWLRQV
sédimentaires au contact du socle granitique7. L’étude de ces formations
aboutit très vite à la découverte d’un conglomérat radioactif dans les grès
!RCHIVES DU MINISTnRE DES -INES 'ABON PLAN MINmRAL 0ARTIE PRINCIPALE P )BIDEM
#(!.0ARIS &ONDS *ACQUES,UCIUS !0 DIRECTION DES PRODUCTIONS DU #%! L´URANIUM AU 'ABON
!RCHIVES DU MINISTnRE DES -INES PLAN MINmRAL 0ARTIE PRINCIPALE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD de base des formations francevilliennes du Mont-Iboundji, situé au nordRXHVW GH .RXODPRXWRX UpJLRQ GH O·2JRRXp/ROR &H UpVXOWDW HQFRXUDJHDQWSURYRTXHODPLVHHQSODFHHQMXLQG·XQHpTXLSHVSpFLDOHPHQW
chargée de l’étude du Francevillien8. C’est lors des travaux de détail visant
à préciser l’endroit où seraient éventuellement effectuées des investigaWLRQVSURIRQGHVVXUFHFRQJORPpUDWTX·HVWGpFRXYHUWOHGpFHPEUH
à proximité immédiate de celui-ci, l’indice de Mounana9 2EMHW G·XQH
prospection intensive menée par une équipe de deux géologues et de huit
SURVSHFWHXUV GRQW GHX[ VSpFLDOLVpV GDQV OHV PpWKRGHV GH JpRSK\VLTXH
et de géochimie, l’indice découvert se révèle être un gisement d’uranium
IRUWLQWpUHVVDQW
« Ce gisement, dont la minéralisation urano-vanadifère est essentielOHPHQWFRQVWLWXpHGHIUDQFHYLOOLWHVHWGHVR[\GHVQRLUVG·XUDQLXPVHSUpsente comme un amas extrêmement ramassé, localisé dans les grès grossiers hétérogènes du Francevillien inférieur et est évalué à plus de deux
PLOOLRQV GH WRQQHV GH PLQHUDLV FRQWHQDQW HQ UpDOLWp WRQQHV
G·XUDQLXP>«@/HVpWXGHVSUpOLPLQDLUHVD\DQWSURXYpO·LQWpUrWpFRQRPLque du gisement de Mounana, le moment est donc venu de constituer une
société de recherches et d’exploitation […]10ª
5NE CONSTITUTION DE LA #/-5& EN TROIS mTAPES
Au lendemain de la découverte du gisement d’uranium de Mounana,
le CEA entreprend des démarches auprès des pouvoirs publics et des asVRFLpVSRWHQWLHOVHQYXHGHFRQVWLWXHUXQHHQWUHSULVHXUDQLIqUHDX*DERQ
(QHQWURLVpWDSHVOD&208)HVWFRQVWLWXpH
,ES PRmLIMINAIRES g LA CONSTITUTION
Dès la découverte du gisement de Mounana, le CEA envisage la constiWXWLRQG·XQHHQWUHSULVHGHUHFKHUFKHVHWG·H[SORLWDWLRQG·XUDQLXPDX*Dbon. Toutefois, la réalisation de ce projet n’est possible qu’à condition de
lever les inquiétudes liées principalement à la large autonomie accordée,
SDUODORLFDGUH'HIIHUUHDX[7206L[PRLVDYDQWODGpFRXYHUWHGH0RXQDQDHQHIIHW*DVWRQ'HIIHUUHPLQLVWUHGHOD)UDQFHG·2XWUHPHUGDQVOH
FDELQHWGH*X\0ROOHWIDLWYRWHUODORLFDGUHTXLDFFRUGHXQHODUJHDXWRnomie aux territoires de l’Union française. Cette loi-cadre Defferre est une
)DEM P #(!.0ARIS &ONDS *ACQUES,UCIUS !0 #%! 0ROJET DE CONSTITUTION D´UNE SOCImTm DE RECHERCHES ET D´EX
PLOITATION AU 'ABON JUILLET )BIDEM.
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON pWDSHFDUSRXUOH*RXYHUQHPHQWHWODKDXWHDGPLQLVWUDWLRQO·DXWRQRPLH
ne peut que s’élargir jusqu’à l’indépendance.
3RXUOH&($jTXLOHVRUGRQQDQFHVGXJpQpUDOGH*DXOOHGRQQHQWGHV
droits quasi régaliens11, il est temps de s’interroger sur l’intangibilité de
ces droits. D’où, au sein de cet organisme, des questions en rapport avec
O·HQWUHSULVHjFUpHUIDXWLOGHPDQGHUXQSHUPLVGqVODSUHPLqUHGpFRXYHUte ou après de nouvelles découvertes ? L’entreprise de droit local offre-tHOOHODPHLOOHXUHJDUDQWLHFRQWUHOHVULVTXHVSROLWLTXHVG·XQHYLROHQWHÀqYUH
nationaliste ? Quelle forme exacte pour une telle entreprise ? Quel risque
GHYRLUOHQRXYHOeWDWVDLVLUO·XUDQLXPSURGXLW"(QMXLOOHWOHSUHPLHU
DFWHRIÀFLHOHVWSRVpOH&($GpSRVHXQHGHPDQGHGHSHUPLVG·H[SORLWDWLRQjVRQQRP'HX[PRLVSOXVWDUGFHOXLFLOXLHVWDFFRUGp
©3DUDUUrWpQƒELV60*GXVHSWHPEUHLOHVWDFFRUGpDX
FRPPLVVDULDWjO·pQHUJLHDWRPLTXHGDQVODUpJLRQGX+DXW2JRRXpGLVWULFWGH)UDQFHYLOOHXQSHUPLVG·H[SORLWDWLRQSRUWDQWQƒ*$YDODEOHSRXUO·XUDQLXPHWGpÀQLVXUXQFDUUpGHNLORPqWUHVGHF{WpGRQWOHV
F{WpVVRQWRULHQWpV1RUG6XGHW(VW2XHVWJpRJUDSKLTXHVHWGRQWOHFHQWUH
est matérialisé par un poteau-signal situé à l’extrémité d’un segment de
GURLWHPGHORQJXHXUD\DQWSRXURULJLQHODERUQHQLYHOOHPHQWJpQpUDO GX YLOODJH 1RXYHO 2PRw HW IDLVDQW DYHF OH 1RUG JpRJUDSKLTXH XQ
angle de 178,18 gr compté dans le sens de la rotation des aiguilles d’une
montre ª
&IGURE 0ERMIS DE -OUNANA EN 3OURCE !RCHIVES DU MINISTnRE DES -INES 'ABON
,ES TEXTES INSTITUANT LE #%! NOMMANT LE #OMITm DE L´mNERGIE ATOMIQUE ET CEUX RmGLEMENTANT L´EXPLOITATION
DES SUBSTANCES RADIOACTIVES ACCORDENT AU #%! DES DROITS TRnS LARGES
*OURNAL OF½CIEL DE L´!FRIQUE mQUATORIALE FRANlAISE */!%& DmCEMBRE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD Dès l’obtention de ce permis, le CEA se prépare à passer la main à
une entreprise d’exploitation. Cependant, en raison de l’impossibilité des
pouvoirs publics à réaliser avec leurs seules ressources les gros projets
d’outre-mer, notamment miniers, le CEA doit trouver des associés privés
pour la réalisation de son projet de création d’une entreprise uranifère au
*DERQPLVVLRQTXH3LHUUH*XLOODXPDWDGPLQLVWUDWHXUJpQpUDOGX&($
FRQÀHj+HQUL/DIRQG
Ingénieur des Mines, président de la Banque de l’Union parisienne
(BUP), président de la Compagnie des minerais de fer magnétique de
0RNWD(O+DGLGHWPHPEUHGXFRUSVGHV0LQHV+/DIRQGHVW©>«@XQGH
FHVJUDQGVDQFLHQVG·H[SpULHQFH1HFRQQDvWLOSDVjODIRLVOHVPLOLHX[GH
ODKDXWHÀQDQFHHWGHVFHUFOHVSROLWLTXHVDIULFDLQV",OHVWWUqVSUpVHQWDX
comité et hors du comité, sur l’élaboration de la politique minière vers les
exploitants privés et vers tout le continent noir13ª
Ainsi, dans le cadre du traité de la Communauté européenne de l’énerJLHDWRPLTXH(XUDWRPVLJQpOHPDUV par les six ministres des
Affaires étrangères de la Communauté économique du charbon et de
l’acier (CECA), et qui encourage ses membres à une utilisation commune
GHOHXUVPDWLqUHVÀVVLOHV+/DIRQGRSWHUDSLGHPHQWHQDR€WSRXU
un partenariat CEA-groupes européens. À cet effet, il offre des particiSDWLRQVjOD6RFLpWpDOOHPDQGH%D\HUHWjOD6RFLpWp*pQpUDOHEHOJH&HWWH
SURSRVLWLRQHVWUHIXVpHSRXUGHVUDLVRQVÀQDQFLqUHVFRPPHO·pFULW+/DIRQGOXLPrPHj3*XLOODXPDWGDQVXQHOHWWUHHQGDWHGXRFWREUH
« […] Ainsi que je vous l’ai dit, j’ai offert à des groupes belges et allePDQGVXQHSDUWLFLSDWLRQGDQVODUHFKHUFKHDX*DERQ&HWWHSURSRVLWLRQD
pWpGpFOLQpHSRXUGHVUDLVRQVÀQDQFLqUHVª Cependant, outre cette raison
RIÀFLHOOHRQSHXWpJDOHPHQWVXERGRUHUODFUDLQWHGHO·KpJpPRQLHIUDQoDLVH
FKH]OHVDXWUHVSD\VGHOD&(&$(QHIIHW©ODFUDLQWHGHO·KpJpPRQLHIUDQoDLVH HVW >G·[email protected] JpQpUDOH SDUPL OHV DXWUHV SD\V HW HQ SDUWLFXOLHU HQ
Allemagne, qui ont des vues bien différentes de celles de la France sur le
rôle de l’entreprise nucléaire commune, beaucoup d’entre eux axant leur
développement sur les accords de coopération avec les États-Unisª
)DFHDXUHIXVGHV$OOHPDQGVHWGHV%HOJHV+/DIRQGEkWLWÀQRFWREUH
XQHVROXWLRQIUDQoDLVHDXWRXUGHOD&RPSDJQLHGHVPLQHUDLVGHIHU
!NTOINE 0AUCARD ,ES MINES ET LES MINEURS FRANlAIS 4OME ,E TEMPS DES CONQUoTES "RIVE 4 0ARQUET
P #E TRAITm RENTRE EN APPLICATION LE ER JANVIER !RCHIVES DU #%! &ONDS DE LA $2) ,ETTRE DE (ENRI ,AFOND g 0IERRE 'UILLAUMAT 0ARIS LE OCTOBRE #YRILLE &OASSO (ISTOIRE DE LA S}RETm DE L´mNERGIE NUCLmAIRE CIVILE EN &RANCE TECHNIQUE D´INGmNIEUR
PROCESSUS D´EXPERTISE QUESTION DE SOCImTm THnSE DE DOCTORAT D´HISTOIRE CONTEMPORAINE 5NIVERSITm ,YON 6OL P # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON PDJQpWLTXHGH0RNWD(O+DGLGTX·LOSUpVLGH17. Cette société, déjà actionQDLUH GDQV OD FRPSDJQLH PLQLqUH GH O·2JRRXp &20,/2* HVW DSSHOpH
j H[SORLWHU OH PDQJDQqVH GX *DERQ 8Q SHX SOXV WDUG OH QRYHPEUH
GHVSDUWLFLSDWLRQVVRQWRIIHUWHVjSOXVLHXUVJURXSHVIUDQoDLVGRQWRQ
SHXWpWDEOLUODW\SRORJLH,O\DG·XQHSDUWOHVJURXSHVEDQFDLUHVOD%83
et la Banque Rothschild frères et, d’autre part, les groupes industriels et
FKLPLTXHV OD &RPSDJQLH GHV PLQHUDLV GH IHU PDJQpWLTXH GH 0RNWD (O
+DGLGOD6RFLpWpGHV0LQHVGX+XDURQOD6RFLpWpPLQLqUHHWPpWDOOXUJLTXH3HxDUUR\DOHVeWDEOLVVHPHQWV.XKOPDQQOD&RPSDJQLHIUDQoDLVHGHV
PLQHUDLVG·XUDQLXP&)08HWOD6RFLpWp/H1LFNHO18.
,QWpUHVVpV SDU OH SURMHW FHV JURXSHV DFFHSWHQW G·\ SDUWLFLSHU VRXV UpVHUYHTXHODIXWXUHHQWUHSULVHVRLWDWWUD\DQWH19 ; question déjà en discussion
HQWUHOH&($HWOHVSRXYRLUVSXEOLFV(QHIIHWWRXMRXUVHQMXLOOHWOH
SUREOqPHGHODUHQWDELOLWpGHODIXWXUHHQWUHSULVHXUDQLIqUHGX*DERQHVW
SRVp 3DU FUDLQWH GH YRLU XQH PRGLÀFDWLRQ GH O·DVVLHWWH GH O·LPS{W IDLUH
EDVFXOHU OD UHQWDELOLWp GH FHWWH HQWUHSULVH 3 *XLOODXPDW SUpFRQLVH GH OD
IDLUHEpQpÀFLHUGXUpJLPHÀVFDOH[FHSWLRQQHOGHORQJXHGXUpHpODUJLSDU
O·$VVHPEOpHWHUULWRULDOHGX*DERQOHGpFHPEUHDX[LQGXVWULHVPLQLqUHVDX[LQGXVWULHVGHWUDLWHPHQWSK\VLTXHFKLPLTXHHWPpWDOOXUJLTXH
DLQVLTX·DX[LQGXVWULHVGHUDIÀQDJHHWGHVK\GURFDUEXUHV.
/HVQpJRFLDWLRQVÀVFDOHVFRPPHQFHQWVDQVGpODLDYHFOHVDXWRULWpVGH
O·$()HWGX*DERQ&HSHQGDQWHOOHVQ·DERXWLVVHQWSDVUDSLGHPHQWFRPPHOHVRXKDLWHOH&($FDU©SRXUEpQpÀFLHUGXUpJLPHÀVFDOH[FHSWLRQQHO
de longue durée, les entreprises devront être agréées par arrêté du ministre de la France d’outre-mer et du ministre des Finances. L’application
GX UpJLPH ÀVFDO GH ORQJXH GXUpH DX[ HQWUHSULVHV DJUppHV VHUD OLPLWpH j
XQHSpULRGHPD[LPDOHGHDQVª2UMXVTXHOjLOQ·H[LVWHSDVHQFRUHDX
*DERQXQHHQWUHSULVHXUDQLIqUHFRQVWLWXpHPDLVXQHDVVRFLDWLRQEDSWLVpH
Uranium Franceville. En outre, les réserves du gisement de Mounana sont
estimées à dix ans, ce qui correspond à l’espérance de vie initiale de l’entreprise appelée à l’exploiter.
Le décalage entre l’espérance de vie initiale de la future entreprise uraQLIqUHHWOHUpJLPHÀVFDOGHORQJXHGXUpHGHPDQGpSDUOH&($FRQVWLWXHOH
principal point d’achoppement des négociations. Pour certains adminisWUDWHXUVQRWDPPHQW7URXYpHW5HPXUUHVSHFWLYHPHQWGLUHFWHXUGHVÀQDQces et directeur général adjoint des Mines de l’AEF, il n’est pas question
2OBERT "ODU ,ES SECRETS DES CUVES D´ATTAQUE ANS DE TRAITEMENT DES MINERAIS D´URANIUM 6mLIZY6ILLACOUBLAY
#/'%-! P #(!.0ARIS FONDS *ACQUES,UCIUS !0 PROJET DE PROTOCOLE P )BIDEM.
*OURNAL OF½CIEL DE L´!FRIQUEbQUATORIALE FRANlAISE P #(!.0ARIS FONDS *ACQUES,UCIUS !0 RAPPORT DE VOYAGE AU 'ABON ET AU -OYEN#ONGO DU JUIN AU
JUILLET 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD GHSURSRVHUDX[DVVHPEOpHVG·DFFRUGHUXQUpJLPHÀVFDOVWDELOLVpGHYLQJW
cinq ans à une entreprise qui n’aura que dix ans de réserves. Ils proposent
une stabilisation de dix ans, renouvelable automatiquement si l’entreprise
IDLWSUHXYHjODÀQGXSUHPLHUWHUPHG·XQHDFWLYLWpVXIÀVDQWHHWXQHGXUpH
ferme de l’ordre de quinze ans. Évoquant le cas de la Société des pétroles
de l’AEF (SPAEF), qui ne dispose certainement pas encore de vingt-cinq
DQVGHUpVHUYHVPDLVEpQpÀFLHGpMjGXUpJLPHÀVFDOVWDELOLVpGHYLQJWFLQT
ans, le CEA juge cette proposition injuste et inacceptable. Finalement,
DSUqVGHORQJVPRLVGHQpJRFLDWLRQVF·HVWOD&208)FRQVWLWXpHSHQGDQW
FHWHPSVTXLREWLHQWHOOHPrPHOHGpFHPEUHOHUpJLPHÀVFDOGH
YLQJWFLQTDQVDSSOLFDEOHjFRPSWHUGXGpFHPEUH
,A CONSTITUTION PROVISOIRE
/HIpYULHUj3DULVVHUpXQLVVHQWHQSUHPLqUHDVVHPEOpHJpQpUDOH
constitutive les futurs actionnaires de l’entreprise en création sous la déQRPLQDWLRQGH&208)DXFDSLWDOGHPLOOLRQVGHIUDQFV&)$)&)$
UpSDUWLVHQDFWLRQVGH)&)$FKDFXQH. Lors de cette assemblée générale, les deux principaux points à l’ordre du jour donnent lieu,
chacun, à une résolution prise à l’unanimité des participants. En premier
OLHXO·DVVHPEOpHJpQpUDOHDSUqVYpULÀFDWLRQUHFRQQDvWVLQFqUHHWYpULWDEOH
la déclaration de souscription et de versement faite par acte devant maître
5LJDXOW JUHIÀHUQRWDLUH j /LEUHYLOOH OH MDQYLHU . En second lieu,
O·DVVHPEOpHJpQpUDOHQRPPH3DXO*DGLOKHLQJpQLHXUHQFKHIGHV0LQHV
commissaire, à l’effet d’apprécier l’apport en nature effectué aux termes
des statuts de la société par le CEA ainsi que les attributions et avantages
particuliers stipulés en rémunération et de faire un rapport à ce sujet à la
seconde assemblée générale constitutive.
À l’issue de cette première assemblée générale, qui est en fait une prise
GHFRQWDFWRIÀFLHOOHHQWUHOHVIXWXUVDFWLRQQDLUHVOD&208)Q·HVWTXHSURYLVRLUHPHQW FRQVWLWXpH 3RXU TX·HOOH OH VRLW GpÀQLWLYHPHQW G·DXWUHV IRUPDOLWpVOpJDOHVGRLYHQWrWUHDFFRPSOLHVDXSOXVWDUGOHPDUVGDWH
programmée pour la seconde assemblée générale constitutive.
)BIDEM.
!NCoTRE D´%LF 'ABON
#/-5& PROCnSVERBAL DE LA PREMInRE ASSEMBLmE GmNmRALE CONSTITUTIVE DU FmVRIER #(!.0ARIS FONDS *ACQUES,UCIUS !0#/-5& PROCnSVERBAL DE LA SECONDE ASSEMBLmE GmNmRALE CONSTI
TUTIVE DU MARS )BIDEM.
)BIDEM.
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON ,A CONSTITUTION Dm½NITIVE
/H PDUV j 3DULV VH UpXQLVVHQW FRPPH SUpYX HQ VHFRQGH DVVHPEOpHJpQpUDOHFRQVWLWXWLYHOHVIXWXUVDFWLRQQDLUHVGHOD&208)/RUV
de cette assemblée générale deux actes sont accomplis. Le premier, c’est
O·DPRGLDWLRQGXSHUPLVGH0RXQDQDSDUOH&($jOD&208)HWO·pYDOXDWLRQÀQDQFLqUHGHO·DSSRUWHQQDWXUHGX&($&HWDFWHFRQVWLWXHXQSRLQW
QRGDOSRXUODFRQVWLWXWLRQGpÀQLWLYHGHFHWWHFRPSDJQLHXUDQLIqUHFDUOD
OpJLVODWLRQ PLQLqUH GHV 720 VLQJXOLqUHPHQW FHOOH GH O·$() GLVSRVH TXH
toute entreprise voulant exercer une activité doit être détentrice d’un permis d’exploitation. Raison pour laquelle, dès l’ouverture de la seconde
DVVHPEOpHFRQVWLWXWLYH-DFTXHV$VW\UHSUpVHQWDQWGX&($UHPHWDXSUpVLGHQWGHVpDQFHXQHOHWWUHGX&($GDWpHGXPDUVHWWUDQVPHWWDQWjOD
compagnie le texte du contrat à intervenir pour l’amodiation du permis de
Mounana. Par cette lettre, le CEA informe la compagnie de son intention de
réserver à cette dernière l’amodiation de tous titres miniers qu’il pourrait
être amené à prendre à la suite de découvertes d’indices d’uranium dans le
carré de 100 kilomètres de côté autour du gisement de Mounana.
/HFRQWUDWSURSUHPHQWGLWLQWHUYLHQWOHPDUV30. D’après ce contrat,
en acceptant du CEA l’amodiation du permis de Mounana, la compagnie
s’engage ipso facto à développer tous les gisements commercialement exploitables situés sur le périmètre de ce permis et à en assurer l’exploitation
au mieux de l’intérêt général. Elle accorde au CEA une option pour acquérir sa production sous forme de tout-venant ou de concentré, au choix de
la compagnie et sur la base des prix du marché mondial. Dans l’exercice
de son droit d’option, le CEA peut substituer pour certaines livraisons
tout autre acquéreur de son choix. La compagnie est libre de vendre le
VXUSOXVGHVDSURGXFWLRQQ·D\DQWSDVIDLWO·REMHWGHODOHYpHG·RSWLRQDFcordée au CEA.
Pour sa part, le CEA s’engage à demander le renouvellement des permis d’exploitation amodiés à la compagnie et à solliciter les concessions
minières qu’elle désirerait voir établir. En outre, le CEA s’engage à ne pas
DEDQGRQQHUVRQSHUPLVJpQpUDOGHUHFKHUFKHVDX*DERQVDQVDYRLUDYLVp
en temps utile, la compagnie de façon que celle-ci puisse préserver ses
droits et intérêts.
Par ailleurs, l’assemblée générale prend acte et adopte le rapport de
3DXO*DGLOKHFRPPLVVDLUHQRPPpSDUODSUHPLqUHDVVHPEOpHFRQVWLWXWLve, à l’effet d’apprécier l’apport en nature effectué par le CEA ainsi que les
!RCHIVES NATIONALES DU 'ABON !.'&ONDS PRmSIDENCE DE LA 2mPUBLIQUE CARTON RmGLEMENTATION MINIn
RE ET STRUCTURE DE L´ADMINISTRATION MINInRE EN !%&
#(!.0ARIS FONDS *ACQUES,UCIUS !0 #/-5& PROCnSVERBAL DE LA SECONDE ASSEMBLmE GmNmRALE CON
STITUTIVE DU MARS P #(!.0ARIS FONDS *ACQUES,UCIUS !0 #ONVENTION D´AMODIATION LE MARS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD attributions et avantages particuliers stipulés en rémunération. D’après ce
UDSSRUWOHVWUDYDX[HIIHFWXpVDX*DERQDQWpULHXUHPHQWDXMXLQ
GRQFDYDQWOHVSUHPLqUHVGpPDUFKHVRIÀFLHOOHVHQYXHGHODFRQVWLWXWLRQGH
OD&208)SHXYHQWVHGpFRPSRVHUFRPPHVXLW
.ATURE DES INVESTISSEMENTS
-ONTANTS INVESTIS EN &#&!
4RAVAUX DE PROSPECTION GmNmRALE AU 'ABON
MILLIONS
4RAVAUX DE PROSPECTION DU &RANCEVILLIEN ET TRAVAUX PRmPA
RATOIRES JUSQU´AU DmCEMBRE #HAILLU )BOUNDJI
©
&RANCEVILLIEN
¡
$U ER JANVIER AU JUIN -OUNANA
¡
MILLIONS
MILLIONS
MILLIONS
-ATmRIEL ET INSTALLATIONS AU JUIN DmDUCTION FAITE
DES AMORTISSEMENTS FACTURmS AU CHANTIER
MILLIONS
4OTAL
MILLIONS
4ABLEAU ) !PPORT EN NATURE DU #%! ANTmRIEUREMENT AU JUIN 3OURCE #(!.0ARIS FONDS *ACQUES,UCIUS !0 RAPPORT DE -ONSIEUR 0AUL 'ADILHE
/HPRQWDQWWRWDOGHVGpSHQVHVGLUHFWHVD\DQWDERXWLjODFRQQDLVVDQFH
GXJLVHPHQWGH0RXQDQDWHOTX·LOHVWDSSRUWpjOD&208)V·pOqYHj
millions de FCFA sans réévaluation. Une partie de ce montant va constituer la participation du CEA au capital social de cette entreprise.
Le second acte, c’est la composition du capital social et du conseil d’administration. La composition du capital social est quasiment réalisée lors
GHVQpJRFLDWLRQVPHQpHVSDU+/DIRQG,OUHVWHWRXWHIRLVjODUHQGUHRIÀFLHOOHDSUqVFRQÀUPDWLRQSDUFKDTXHDVVRFLpGHVDSULVHGHSDUWLFLSDWLRQ
C’est chose faite lors de la seconde assemblée générale constitutive. Le caSLWDOVRFLDOGHOD&208)HVWUpSDUWLFRPPHSUpVHQWpGDQVOH7DEOHDX,,
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON !CTIONNAIRES
0OURCENTAGES
DES ACTIONS
!DRESSES
#OMPAGNIE DE MINERAIS DE FER MAGNmTIQUE
-OKTA %L (ADID
2UE DE LA VICTOIRE 0ARIS #%!
2UE 6ARENNE 0ARIS "ANQUE DE L´5NION 0ARISIENNE
"OULEVARD (AUSSMANN 0ARIS "ANQUE DE 2OTHSCHILD
2UE ,AF½TTE 0ARIS #OMPAGNIE DES -INES DU (UARON
2UE 0IERRE #HARRON 0ARIS 3OCImTm -INERAIS ET -mTAUX
!VENUE (OCHE 0ARIS 3OCImTm ,E .ICKEL
2UE DE #OURCELLES 0ARIS 3OCImTm MINInRE ET MmTALLURGIQUE DE 0ENARROYA
0LACE 6ENDxME 0ARIS #OMPAGNIE FRANlAISE DES MINERAIS D´URANIUM
0LACE 6ENDxME 0ARIS bTABLISSEMENTS +5(,-!..
2UE DE LA "AUME 0ARIS 4ABLEAU )) 2mPARTITION DU CAPITAL SOCIAL ORIGINEL DE LA #/-5& EN 3OURCE #(!.0ARIS FONDS *ACQUES,UCIUS !0 DOSSIER &RANCEVILLE 6DQVGRXWHOD&208)HVWXQHDIIDLUHIUDQFRIUDQoDLVH6RQFDSLWDOVRcial est issu du mariage des intérêts publics et privés. L’État français, par le
&($GpWLHQWDFWLRQVGH)&)$HQWLqUHPHQWOLEpUpHVVRLW
GXFDSLWDOGHODFRPSDJQLH/HVDLQVLDWWULEXpVDX&($FRQVWLWXHQWOD
contrepartie de son apport composé par31
– les études, plans, rapports, des travaux effectués en vue de l’obtention du permis d’exploitation de Mounana ainsi que le matériel et les insWDOODWLRQVH[LVWDQWVXUSODFHDXMXLQ
– les droits miniers attachés au permis d’exploitation de Mounana et
aux concessions qui pourraient lui être éventuellement substituées et qui
vont faire l’objet d’une amodiation jusqu’à l’épuisement des gisements
existants ou à découvrir.
7RXWFRPSWHIDLWODSDUWLFLSDWLRQGX&($DXFDSLWDOVRFLDOGHOD&2MUF représente 80 millions de FCFA, soit près des deux tiers des 130 millions de FCFA de dépenses effectuées pour la connaissance du gisement
GH0RXQDQD/D&208)OXLHVWGRQFUHGHYDEOHGHPLOOLRQVGH)&)$
$ÀQGHV·DFTXLWWHUGHFHWWHGHWWHHOOHHVWDVWUHLQWHDXYHUVHPHQWDX&($
G·XQHUHGHYDQFHUDSSRUWpHjODWRQQHH[WUDLWHFDOFXOpHjUDLVRQGH
de la valeur à la sortie de l’usine de concentration des produits expédiés.
Toutefois, cette redevance peut ne pas être due sur la production initiale de
la compagnie. Elle cessera d’être due lorsque le tonnage total d’uranium
FRQWHQXGDQVOHVSURGXLWVVRXPLVjUHGHYDQFHDWWHLQGUDWRQQHVRX
#(!.0ARIS FONDS *ACQUES,UCIUS !0 3TATUTS DE LA CAMPAGNE DES MINES D´URANIUM DE &RANCEVILLE
4ITRE 6!RTICLE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD TXHODYDOHXUFXPXOpHGHVUHGHYDQFHVDXUDHOOHPrPHDWWHLQWPLOOLRQV
de FCFA, le choix entre ces limites étant laissé au CEA.
/HVDFWLRQVUHVWDQWHVVRLWGXFDSLWDOVRFLDOVRQWGpWHQXHV
SDUGHVLQYHVWLVVHXUVSULYpVEDQTXHVHQWUHSULVHVLQGXVWULHOOHVHWFKLPLques33. Les actions souscrites par ces investisseurs privés sont libérées en
numéraire.
/DSDUWLFLSDWLRQPDMRULWDLUHGHVFDSLWDX[SULYpVjODFUpDWLRQGHOD&2MUF, comme à celle de certaines entreprises minières et industrielles telOHV TXH OD &20,/2* DX *DERQ HVW IDYRULVpH SDU OH &RPPLVVDULDW JpQpUDODX3ODQ&HOXLFLHVWFUppHQVRXVO·LPSXOVLRQGH-HDQ0RQQHW
DÀQGHFRRUGRQQHUODUHFRQVWUXFWLRQHWODPRGHUQLVDWLRQG·XQHpFRQRPLH
IUDQoDLVHIRUWHPHQWpEUDQOpHSDUOHFRQÁLWPRQGLDO'DQVVRQVHFRQG3ODQ
TXDGULHQQDO FHW RUJDQLVPH pWDEOLW XQ SODQ G·LQYHVWLVVHPHQW
des gros projets miniers et industriels d’outre-mer. Ainsi, dans la note accompagnant le tableau d’investissement un certain nombre de mesures
VRQWpYRTXpHV
« Il convient, notamment, que les exploitations minières et industrielles
qu’on prévoit, gardent le caractère d’entreprises privées, c’est-à-dire que
OHXUÀQDQFHPHQWVRLWODUJHPHQWDVVXUpSDUGHVFDSLWDX[SULYpVHWTXHFHV
FDSLWDX[QHEpQpÀFLHQWSDVGHJDUDQWLHVGHUHPERXUVHPHQWGHODSDUWGH
l’État, de collectivités ou d’organismes publics. En revanche, les affaires
GHFHW\SHSRXUUDLHQWEpQpÀFLHUGHFHUWDLQHVPHVXUHVGHVRXWLHQSHQGDQW
OHXUSpULRGHGHGpPDUUDJH'HVJDUDQWLHVG·RUGUHÀVFDOOHXUVHUDLHQWpJDlement indispensables. Les entreprises qui se créeront mettront, en effet,
quelques années à s’installer et elles n’atteindront leur niveau de production normal qu’après un délai supplémentaire. Elles exigeront, dans chaque cas, des investissements considérables et ces investissements ne pourront s’amortir qu’à longue ou très longue échéance. Les entreprises de ce
W\SHQHSHXYHQWGRQFVHFRQFHYRLUVDQVGHODUJHVGpJUqYHPHQWVG·LPS{WV
pendant leur installation et leurs premières années de marche. Il paraît
même nécessaire qu’elles obtiennent également des garanties de stabilité
ÀVFDOHSHQGDQWXQHSpULRGHSOXVLPSRUWDQWHHQFRUHª
Mais ces dégrèvements ou garanties ne peuvent être accordés que par
les territoires, avec l’accord des assemblées locales et des ministres compétents. Les membres de la section AEF du Comité central de la France
)BIDEM
6OIR 4ABLEAU ))
#RmmE EN SEPTEMBRE SON CAPITAL SOCIAL EST COMPOSm COMME SUIT POUR L´53 3TEEL #ORPORATION EN
TREPRISE mTASUNIENNE ET POUR LES INTmRoTS PUBLICS ET PRIVmS FRANlAIS
#ENTRE D´ARCHIVES D´OUTREMER #!/- #ARTON -1 #OMITm CENTRAL DE LA &RANCE D´OUTREMER SECTION !%&
SmANCE DU MARS # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON G·RXWUHPHU &&)20 QRWDPPHQW FRQFHUQpV HQ WDQW TXH UHSUpVHQWDQWV
GXPLOLHXG·DIIDLUHVDFFRUGHQWOHXUIDYHXUDX[PHVXUHVHQYLVDJpHV©7RXW
ceci est fort intéressant. Il est certain que si ces idées étaient mises en pratique dans les territoires d’outre-mer, il en résulterait une aide puissante et
HIÀFDFHGRQQpHjODFUpDWLRQHWDXGpYHORSSHPHQWGHVHQWUHSULVHVª
$XGpEXWGHFHVPHVXUHVVRQWPDWpULDOLVpHVSDUXQHORLTXLDXWRULVH OD VLJQDWXUH GH FRQWUDWV ÀVFDX[ GH ORQJXH GXUpH HQWUH XQ WHUULWRLUH
HW XQH HQWUHSULVH GpWHUPLQpH ­ FHW HIIHW$QGUp 3RVWHO9LQD\ GLUHFWHXU
JpQpUDOGX&&)20HVWLPHTX·©HOOHDSSDUDvWDLQVLFRPPHXQHLQQRYDtion juridique d’une très grande portée37ª'HIDLWHOOHKDELOLWHOHVDXWRULtés locales des territoires à aménager et à stabiliser pendant cette période
SRXYDQWDOOHUMXVTX·jTXLQ]HDQVVDQVSRVVLELOLWpGHPRGLÀFDWLRQSHQGDQW
XQHSpULRGHGRQQpHOHUpJLPHÀVFDODSSOLFDEOHDX[HQWUHSULVHVGHJUDQGH
envergure, dont la création présenterait une importance particulière pour
l’économie des territoires38. Finalement, c’est seulement à ces conditions
que les investissements privés, nécessaires à la réalisation des grands projets miniers et industriels, peuvent concourir au développement des terULWRLUHV/D&208)FHODDGpMjpWpVRXOLJQpREWLHQWFHUpJLPHÀVFDOWUqV
IDYRUDEOHOHGpFHPEUH(QRXWUHF·HVWORUVGHFHWWHVHFRQGHDVVHPblée constitutive que sont nommés les douze membres du premier conseil
d’administration.
#ENTRE D´!RCHIVES D´OUTREMER #!/- &)$%3 E SmRIE #ARTON DOSSIER - EXTRAIT DE L´ARTICLE ¦ ,ES FON
CTIONS MONmTAIRES ET BANCAIRES DE LA ##&/- EN !FRIQUE NOIRE § #ONFmRENCE FAITE AU #ENTRE D´bTUDES "ANCAIRES
g "RUXELLES LE MARS PAR ! 0OSTEL6INAY
)BIDEM.
)BIDEM.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD .OMS
&ONCTIONS
/BSERVATIONS
*ACQUES ,UCIUS
0RmSIDENT DU CONSEIL
D´ADMINISTRATION
6ICEPRmSIDENT DE LA #OMPAGNIE DE
MINERAIS DE FER MAGNmTIQUE -OKTA %L
(ADID
*ACQUES -ABILE
!DMINISTRATEUR
DIRECTEUR GmNmRAL
2ESPONSABLE DES 2ECHERCHES ET EXPLOITA
TIONS MINInRES DU #%!
'EORGES 0ARRINEAU
!DMINISTRATEUR
#OMPAGNIE DE MINERAIS DE FER MAGNmTI
QUE -OKTA %L (ADID
*ACQUES !STY
!DMINISTRATEUR
#%!
"ERNARD "EAU
!DMINISTRATEUR
$IRECTEUR ADJOINT DE LA "50
2OLLAND 2ITTER
!DMINISTRATEUR
$IRECTEUR GmNmRAL ADJOINT DE LA #OMPA
GNIE MINInRE ET MmTALLURGIQUE 0ENARROYA
*EAN ,mGER
!DMINISTRATEUR
bTABLISSEMENTS +UHLMANN
2ENm &ILLON
!DMINISTRATEUR
0RmSIDENT DE LA #&-5
0IERRE 2OBERTIE
!DMINISTRATEUR
3OCImTm ,E .ICKEL
3OCImTm -INERAIS ET MmTAUX
!DMINISTRATEUR
*EAN 'AUTHIER
!DMINISTRATEUR
2EPRmSENTANT DE 2OTHSCHILD
2ENm 4ALIS
!DMINISTRATEUR
#OMPAGNIE DES -INES DU (UARON
4ABLEAU ))) #OMPOSITION DU PREMIER CONSEIL D´ADMINISTRATION DE LA #/-5&
3OURCE #(!.0ARIS FONDS *ACQUES,UCIUS !0 DOSSIER &RANCEVILLE $X WHUPH GH OD VHFRQGH DVVHPEOpH JpQpUDOH FRQVWLWXWLYH OD &208)
a sa pleine capacité juridique. Par conséquent, l’assemblée la déclare déÀQLWLYHPHQW FRQVWLWXpH HW GpVLJQH OH &($ FRPPH VRQ RSpUDWHXU WHFKQLque39&HSHQGDQWODUpJOHPHQWDWLRQPLQLqUHGHV720QHSHUPHWSDVjOD
nouvelle compagnie uranifère d’exercer en titre son activité avant que ne
OXLVRLWGpOLYUpHSDUOHJRXYHUQHXUGX*DERQO·DXWRULVDWLRQSHUVRQQHOOH.
&HWWHDXWRULVDWLRQOXLHVWDFFRUGpHOHPDL.
5NE ACTIVITm CLAIREMENT SCINDmE EN DEUX PARTIES GmRmES SmPARmMENT
­ODVXLWHGHO·REWHQWLRQGXUpJLPHÀVFDOSULYLOpJLpOHFRQVHLOG·DGPLQLVWUDWLRQ GX GpFHPEUH HVWLPH OD FRPSDJQLH UHQWDEOH HW GpFLGH
GHODPLVHHQH[SORLWDWLRQ GX JLVHPHQW GH 0RXQDQD$LQVL GpEXW OH YDVWH FKDQWLHU G·LPSODQWDWLRQ HVW RXYHUW 'HX[ DQV DSUqV HQ OD
#(!.0ARIS FONDS *ACQUES,UCIUS !0 #/-5& 0ROCnSVERBAL DE LA PREMInRE ASSEMBLmE GmNmRALE CON
STITUTIVE DU MARS P 0OUR oTRE HABILITm g SE LIVRER g UNE ACTIVITm MINInRE TOUT PARTICULIER OU SOCImTm DOIT oTRE DmTENTEUR D´UNE AU
TORISATION PERSONNELLE MINInRE )NSTITUmE PAR LES TEXTES DE LOI DE LA ½N DU 8)8E SInCLE L´AUTORISATION PERSONNELLE
MINInRE EST DmLIVRmE SUR AVIS DU SERVICE DES -INES APRnS ENQUoTE ET PRmSENTATION D´UN DOSSIER RmGLEMENTAIRE
#(!.0ARIS FONDS *ACQUES,UCIUS !0 2APPORT DE L´ASSEMBLmE ORDINAIRE DU DmCEMBRE # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON FRPSDJQLHGpPDUUHRIÀFLHOOHPHQWVRQDFWLYLWp&HOOHFLV·DUWLFXOHDXWRXU
GHGHX[D[HVLQGXVWULHOHWFRPPHUFLDO
,ES MOYENS DE L´ACTIVITm INDUSTRIELLE LES INSTALLATIONS INDUSTRIELLES
LE PERSONNEL ET LES MOYENS ½NANCIERS
,E COMPLEXE INDUSTRIEL ET L´mVOLUTION DE LA PRODUCTION
L’exploitation du gisement
0HVXUDQWHQYLURQPqWUHVGHORQJPqWUHVGHODUJHHWGHSURIRQGHXUOHJLVHPHQWGH0RXQDQDHVWH[SORLWpGHj6RQH[SORLWDWLRQ
PL[WH
HVW
V\QWKpWLVpH
GDQV
OH
7DEOHDX
,9
%XPLOITATION g CIEL OUVERT
%XPLOITATION EN SOUTERRAIN
,´EXPLOITATION DE LA PARTIE SUPmRIEURE SE FAIT EN
DEUX TEMPS ET %LLE EST
RmALISmE DANS UNE CARRInRE EN ENTONNOIR ELLIPTI
QUE DONT LES CARACTmRISTIQUES SONT ¯ EMPRISE AU SOL M EN ESTOUEST SUR
M EN NORDSUD ¯ PROFONDEUR M ¯ OUVERTURE EN FOND DE FOUILLE M SUR
M ¯ INCLINAISON HORIZONTALE DES ¾ANCS DE FOSSE € DANS LES TERRAINS ALTmRmS DU SOCLE € DANS
LES PmLITES ET € DANS LES GRnS ¯ PISTE D´ACCnS LARGEUR M PENTE g !U TOTAL LA PRODUCTION DE CETTE CARRInRE EST DE
TONNES DE MINERAI EXTRAIT CONTENANT
TONNES D´URANIUM
,´EXPLOITATION DE LA PARTIE LA PLUS PROFONDE EST
RmALISmE EN MINE SOUTERRAINE GRhCE g UN PUITS
DE M DE DIAMnTRE ET M DE PROFONDEUR
,´EXPLOITATION QUI S´mTEND DE g EST
FAITE EN CHAMBRES ET PILIERS DE RESPECTIVEMENT
ET M DE LARGE g LA BASE LES CHAMBRES SONT
PRISES EN TRANCHES DESCENDANTES REMBLAYmES
EN UTILISANT COMME REMBLAI LES RmSIDUS DE
TRAITEMENT DES MINERAIS TANDIS QUE LES PILIERS
SONT ENSUITE DmPILmS EN DESCENDANT AVEC UN
SOUTnNEMENT BOISm
,E TOTAL DE PRODUCTION DE CETTE MINE SOUTER
RAINE EST DE TONNES DE MINERAI EXTRAIT
RENFERMANT TONNES D´URANIUM
4OTAL EXPLOITm LE GISEMENT FOURNIT TONNES DE MINERAI DONT POUR LA PARTIE SUPm
RIEURE ET POUR LA PARTIE PROFONDE ,A QUANTITm D´URANIUM MmTAL PRODUITE EST DE TONNES
DONT POUR LA MINE g CIEL OUVERT ET POUR LA MINE SOUTERRAINE
4ABLEAU )6 3YNTHnSE DE L´EXPLOITATION DU GISEMENT DE -OUNANA
3OURCE !RCHIVES !2%6! .# ¯ "ESSINES #/-5& FERMETURE DES SITES MINIERS 3DUDOOqOHPHQWjODPLVHHQYDOHXUGXJLVHPHQWGH0RXQDQDOD&208)
mène, seule ou en association avec le CEA, des recherches qui aboutisVHQWjODGpFRXYHUWHG·DXWUHVJLVHPHQWV0LNRXORXQJRXHQ%R\LQG]L
HQ2NORHQHW2NpORERQGRHQ&HVQRXYHOOHVGpFRXYHUWHV
viennent accroître les réserves de la concession minière du Francevillien,
GpVRUPDLVHVWLPpHVjWRQQHV. Cela permet un allongement de l’espérance de vie de la compagnie uranifère. Cependant, dans l’intervalle de
!RCHIVES DU MINISTnRE DES -INES 'ABON 0ROSPECTUS #/-5& 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD WHPSVTXLQRXVRFFXSHVHXOOHJLVHPHQWG·2NORGDQVVDSDUWLH
supérieure, connaît un début d’exploitation à partir de 1970 ; cela de façon
à prendre le relais du gisement de Mounana.
/·RXWLOGHSURGXFWLRQHWOHVÁXFWXDWLRQVGHODSURGXFWLRQ
$ÀQGHYDORULVHUVXUSODFHj0RXQDQDOHVPLQHUDLVH[WUDLWVOD&208)
FRQÀHHQDX[pWDEOLVVHPHQWV.XKOPDQQXQHPLVVLRQG·DUFKLWHFWHLQdustriel portant sur l’étude, la direction technique du montage et la mise
en état de marche industrielle d’une usine de traitement chimique. Mise
HQURXWHOHPDUVHWLQDXJXUpHOHPDUVGHODPrPHDQQpHSDU
Léon Mba, président gabonais, cette première usine d’une capacité de traiWHPHQWOLPLWpHjWRQQHVGHPLQHUDLSDUDQFRPSUHQG
– les bâtiments de fabrication nécessaires pour traiter les minerais et les
trémies d’alimentation du concasseur primaire où sont déversés les minerais fournis par l’exploitation jusqu’à l’obtention d’un concentré chimique
jG·XUDQLXP/HFKRL[GHSURGXLUHGHVFRQFHQWUpVjFHWDX[HVWPRWLYpSDUOHIDLWTXHOH&($GLVSRVHj*XHXJQRQG·XQHXVLQHSHUPHWWDQWOH
UDIÀQDJHGHVSURGXFWLRQVGHOD&208)VRXVIRUPHGHQLWUDWHG·XUDQ\OH
'·DSUqVOD&208)©cette solution est plus avantageuse que celle d’une usine
classique produisant du yellow cake (uranate de magnésie), en raison, notamment
du montant des investissements supplémentaires qui auraient été nécessaires, et
que l’on ne pouvait amortir en 10 ansª
²OHVDQQH[HVGHFHVEkWLPHQWVFXYHVUpVHUYRLUVGpFDQWHXUVSUpSDUDtions des réactifs ;
– le laboratoire de contrôle de fabrication ;
²OHVDWHOLHUVGHSUpSDUDWLRQGHVUpDFWLIVDFLGHVXOIXULTXHSDUSURFpGp
GHFRQWDFWELR[\GHGHPDQJDQqVHFKDX[RXPDJQpVLHDLQVLTXHOHVEkWLments et les trémies de stockage des divers réactifs, l’atelier de séchage et
l’exploitation des uranates et les installations électriques.
0HOTO 5SINE ) DE TRAITEMENT DES MINERAIS
3OURCE !RCHIVES DU MINISTnRE DES -INES #/-5& 0ANORAMA N€ P #(!.0ARIS FONDS *AQUES,UCIUS !0 .OTE D´INFORMATION SUR L´mVOLUTION DE LA PRODUCTION DE LA #/
-5& # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON 0HOTO 0REMIER ATELIER DE FABRICATION D´ACIDE SULFURIQUE
3OURCE )BIDEM
5NE PRODUCTION ¾UCTUANTE
&IGURE bVOLUTION DE LA PRODUCTION DE LA COMPAGNIE
3OURCE 2OBERT %DGARD .DONG ,ES MULTINATIONALES EXTRACTIVES AU 'ABON LE CAS DE LA #/-5& THnSE DE DOCTORAT D´HISTOIRE
5NIVERSITm ,YON P /DSURGXFWLRQDQQXHOOHPR\HQQHHVWGHWRQQHVG·XUDQLXP&H
niveau est principalement lié au fait que durant cette première période
GH O·H[LVWHQFH GH OD &208) VD SURGXFWLRQ HVW GHVWLQpH j OD )UDQFH TXL
développe essentiellement le nucléaire militaire. L’évolution de cette production modérée peut s’articuler ici en trois sous-périodes.
La première sous-période 1961-1964 :ODSURGXFWLRQDQQXHOOHPR\HQQH
HVWGHWRQQHVG·XUDQLXP1RQREVWDQWODGHUQLqUHDQQpHR
HOOHHVWHQEDLVVHGHSDUUDSSRUWjOHUHVWHGXWHPSVODSURduction est croissante.
La deuxième sous-période 1965-1972 :ODSURGXFWLRQDQQXHOOHPR\HQQHHVWGHWRQQHVG·XUDQLXPVRLWXQHKDXVVHGHSDUUDSSRUW
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD j OD SUHPLqUH VRXVSpULRGH 'HX[ IRUWV LQÁpFKLVVHPHQWV PDUTXHQW FHWWH
GHX[LqPHVRXVSpULRGH/HSUHPLHUDOLHXHQ/DEDLVVHHVWGH
SDUUDSSRUWj&·HVWODFRQVpTXHQFHGHO·DFFLGHQWVXUYHQXOHPDUV
dans la mine souterraine de Mounana qui entraîne l’arrêt de l’exploitaWLRQSHQGDQWTXHOTXHVMRXUV/HVHFRQGLQÁpFKLVVHPHQWDOLHXHQOD
EDLVVHHVWGHSDUUDSSRUWj&·HVWODFRQVpTXHQFHGHODGpFRXYHUWHGXSKpQRPqQHG·2NOR qui a pour conséquence une suspension de
ODSURGXFWLRQ©(QODPLVHHQpYLGHQFHG·XUDQLXPDSSDXYUL provenant des réacteurs fossiles perturbe sérieusement et l’exploitation de la
mine à ciel ouvert et celle de l’usine. La production est arrêtée en attendant
TXHGHVFRQWU{OHVDQDO\WLTXHVIDLWVHQ)UDQFHGHPDQLqUHDSSURIRQGLHSXLV
VXUSODFHGHIDoRQVRPPDLUHPDLVSOXVUDSLGHHWVXIÀVDQWHF·HVWO·´2NORmètre”) permettent de délimiter les zones d’uranium appauvriª
La troisième sous-période 1973-1975 :ODSURGXFWLRQDQQXHOOHPR\HQQHHVWGHWRQQHVVRLWXQHKDXVVHGHSDUUDSSRUWjODGHX[LqPH
sous-période. C’est là un effet manifeste du premier choc pétrolier.
,E PERSONNEL UN RECRUTEMENT MULTIFORME
ET UN EFFECTIF ¾UCTUANT
Le recrutement du personnel français et africain revêt plusieurs formes. La compagnie ne recrute pas directement son personnel français.
Celui-ci est affecté par les divers actionnaires. C’est ainsi qu’à la constitution de la compagnie, le personnel français travaillant pour le CEA lui
est directement transféré. En dehors de quelques rares ingénieurs issus
des grandes écoles françaises telles l’École des mines de Paris, l’École des
PLQHVGH1DQF\HWFLOVHFRPSRVHHVVHQWLHOOHPHQWGHSHUVRQQHVIRUPpHV
au Muséum national d’histoire naturelle. Plusieurs font partie des perVRQQHVDX[TXHOOHV)-ROLRWGLWOHGpFHPEUHjO·,QVWLWXWIUDQoDLVGX
radiumORUVGXSUHPLHUVWDJH©9RXVrWHVOHVSUHPLHUVPDLOORQVG·XQH
chaîne représentée par une gigantesque entreprise qui travaille pour notre
,E BILAN DE CET ACCIDENT PROVOQUm PAR UNE TORNADE EST DE CINQ MORTS
$mCOUVERT EN ET EXPLOITm g PARTIR DE DE SORTE g PRENDRE LE RELAIS DU GISEMENT DE -OUNANA LE
GISEMENT D´/KLO A PERMIS DE METTRE AU JOUR LE NUCLmAIRE PRmHISTORIQUE SEIZE RmACTEURS NUCLmAIRES NATURELS
DATANT DE DEUX MILLIARDS D´ANNmES #ETTE DmCOUVERTE A SUSCITm LA CURIOSITm DE LA COMMUNAUTm SCIENTI½QUE
INTERNATIONALE QUI A CHERCHm g COMPRENDRE COMMENT DES RmACTEURS NUCLmAIRES FOSSILES ONT PU SE CONSTITUER Lg
ET FONCTIONNER SANS QU´IL N´Y AIT DES PERTURBATIONS DE L´ENVIRONNEMENT
,´URANIUM APPAUVRI EST DE L´URANIUM DONT LA COMPOSITION ISOTOPIQUE COMPORTE UNE FAIBLE ABONDANCE DES
ISOTOPES LmGERS COMPRISE ENTRE ET D´URANIUM ABRmGm 5 L´URANIUM NATUREL A UNE TENEUR DE
EN 5 #´EST UN SOUSPRODUIT DES USINES D´ENRICHISSEMENT DE L´URANIUM ET DES CENTRES DE TRAITE
MENT DU COMBUSTIBLE USm
2OBERT "ODU OP CIT P )L S´AGIT DES ACTIONNAIRES MENTIONNmS AU 4ABLEAU )))
,E -USmUM NATIONAL D´HISTOIRE NATURELLE EST CHOISI COMME SITE DE FORMATION PARCE QUE C´EST Lg QUE SE TROU
VENT LES PRINCIPALES COMPmTENCES EN MATInRE DE GmOLOGIE ET DE MINmRALOGIE
#´EST LE PREMIER LIEU O| SE DmROULE LA FORMATION PUIS LE -USmUM NATIONAL D´HISTOIRE NATURELLE
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON SD\V7URXYH]GHO·XUDQLXPQRXVDXURQVGHVFUpGLWV«6LYRXVQHWURXvez rien je n’en dis pas plus ! Je sais que vous êtes enthousiastes pour vos
IXWXUVWUDYDX[)RXLOOH]SDUWRXWVDQVFRPSOH[H1·D\H]DXFXQFRPSOH[H
pour vos méthodes de recherches […]ª
Au personnel transféré par le CEA, viennent s’ajouter des agents administratifs et techniques affectés par les actionnaires privés. Certaines perVRQQHVDLQVLGpWDFKpHVOHVRQWHQPR\HQQHSRXUXQHGXUpHOLPLWpHGHX[
à trois ans en général.
Ensuite, s’agissant du personnel africain, il convient d’abord de souligner que c’est un personnel très jeune dont l’âge oscille entre seize et
YLQJWFLQT DQV ,O FRPSUHQG HVVHQWLHOOHPHQW GHV SD\VDQV GRQW QRPEUH
VRQW DQDOSKDEqWHV 2XWUH OHV *DERQDLV FRPSRVDQWH PDMRULWDLUH LO FRPprend une faible part de Congolais, représentant le personnel d’exécution
TXDOLÀp+RUPLVO·H[LJHQFHGHTXDOLÀFDWLRQTXLFRQFHUQHSULQFLSDOHPHQW
les Congolais, le mode de recrutement de la main-d’œuvre africaine est
IRQGpVXUODIRUFHSK\VLTXHHWXQH[DPHQVDQLWDLUHVRPPDLUHGHVFDQGLGDWV©XQDJHQWHXURSpHQpWDLWFKDUJpG·XQHVpOHFWLRQSK\VLTXHGHVFDQGLdats. Les candidats les moins aptes étaient éliminésª
/·HIIHFWLIGHODFRPSDJQLHHVWSRXUVDSDUWÁXFWXDQWDLQVLTX·HQWpPRLgne le Tableau V.
'ABONAIS
%XPATRImS
4OTAL
6ARIATIONS EFFEC
TIF TOTAL
!NNmES
4ABLEAU 6 2mPARTITION DES EFFECTIFS #/-5& 'ABONAIS ET EXPATRImS 3OURCE !RCHIVES !2%6! .#"ESSINES #/-5& 0ANORAMA N€ !NTOINE 0AUCARD¨ TOME OP CIT P )L FAUT NOTER QU´EN SUITE AUX INCIDENCES D´UN MATCH DE FOOTBALL #ONGO'ABON g "RAZZAVILLE ON ASSISTE g
UN DmPART MASSIF DES #ONGOLAIS
2OBERT %DGARD .DONG OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD 'HjO·HIIHFWLIFURvWUpJXOLqUHPHQW/HUHVWHGXWHPSVH[FHSWp
HQLOHVWGpFURLVVDQW&HVGHX[JUDQGHVWHQGDQFHVV·H[SOLTXHQWSDUOH
fait qu’après la mise en place des installations industrielles, la compagnie
passe en phase d’exploitation. Contrairement à la phase de mise en place,
la phase de mise en exploitation requiert moins de main-d’œuvre. Par
ailleurs, dans les premières années de l’exploitation, de nombreux jeunes
mineurs désertent leur poste par peur du danger et des rudes conditions
GHWUDYDLO©OHVMHXQHVELHQTXHFRXUDJHX[RQWWUqVSHXUGXWUDYDLOVRXV
la mine ; beaucoup travaillent même pendant deux ou trois années ; mais
DSUqVLOVQHWLHQQHQWSOXVOHFRXS4XDQWLOVDSSUHQQHQWTX·LO\DGXWUDYDLO
à Franceville, ils démissionnent… Souvent ils prolongent leurs vacances
et ne reviennent plusª
/HVPR\HQVÀQDQFLHUVOHVDXJPHQWDWLRQVGXFDSLWDOVRFLDO
/·DXWRÀQDQFHPHQWHVWOHSULQFLSDOPRGHGHÀQDQFHPHQWGHODFRPSDgnie. C’est pourquoi l’attention est focalisée ici sur son capital social, augPHQWpjGHX[UHSULVHVDSUqV$LQVLHQPDUVDÀQGHFRQVWUXLUHOHV
installations industrielles et sociales qui lui sont indispensables, la compagnie porte son capital à un milliard de FCFA. Cette augmentation fait suite
à « une déclaration de souscription et de versement reçue par maître DU)285QRWDLUHj3DULVOHFDSLWDOVRFLDOHVWSRUWpGH)&)$SDU
pPLVVLRQDXSDLUGHDFWLRQVQRXYHOOHVGHQXPpUDLUHGH)&)$
chacuneª/DVHFRQGHDXJPHQWDWLRQHVWOLpHjO·RXYHUWXUHGXFDSLWDOj
l’État gabonais. À cet effet, le capital social est porté à 1 333 330 000 FCFA
SDU pPLVVLRQ GH DFWLRQV QRXYHOOHV. La prise de participation de
O·eWDWJDERQDLVDXFDSLWDOVRFLDOGHOD&208)FRQVWLWXHO·DSSOLFDWLRQGH
O·RUGRQQDQFH Qƒ GX MXLQ UHQGDQW REOLJDWRLUH OD FHVVLRQ j
O·eWDWG·XQHSDUWLHGXFDSLWDOGHVVRFLpWpVV·LQVWDOODQWDX*DERQ7RXWHIRLV
HQVRQDUWLFOHFHWWHRUGRQQDQFHSUpYRLWTXH©OHVVRFLpWpVGpMjLQVWDOOpHV
SRXUURQW DSUqV QpJRFLDWLRQV DYHF OH *RXYHUQHPHQW DFFpGHU DX UpJLPH
créé par la présente ordonnanceª
Cette prise de participation de l’État gabonais au capital social de la
&208)VHPEOHV·LQVFULUHGDQVODG\QDPLTXHGHVSD\VVRXVGpYHORSSpV
QRWDPPHQWFHX[SURGXFWHXUVGHPDWLqUHVPLQpUDOHVTXLYLVHjV·DIÀUPHU
sur la scène internationale, et ce, depuis la reconnaissance solennelle par
OHV1DWLRQVXQLHVHQGXSULQFLSHGH©VRXYHUDLQHWpSHUPDQHQWHGHV
'UILLAUME -OUTOU )NDUSTRIALISATION ET TRANSFORMATIONS SOCIOCULTURELLES DANS LE (AUT/GOOUm 'ABON THnSE
DE DOCTORAT E CYCLE DE 3OCIOLOGIE .ANTERRE P #(!.0ARIS FONDS *ACQUES,UCIUS !0 0ROCnSVERBAL DU CONSEIL D´ADMINISTRATION DE #/-5& DU
MARS #(!.0ARIS FONDS *ACQUES,UCIUS !0 #OMPTE RENDU D´EXERCICE DE #/-5& *OURNAL OF½CIEL DE LA 2mPUBLIQUE GABONAISE /RDONNANCE N€ DU JUIN # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON États sur leurs ressources naturellesª. Toutefois, compte tenu du patriPRQLDOLVPHG·eWDWH[LVWDQWDX*DERQLO\DOLHXGHVHGHPDQGHUVLO·eWDW
est réellement actionnaire dans la compagnie uranifère ou s’il s’agit d’un
SUrWHQRPGHUULqUHOHTXHOVHWURXYHUDLWODFODVVHGLULJHDQWH1HGLVSRVDQW
SDVG·LQIRUPDWLRQVFRQWUDGLFWRLUHVQRXVFRQVLGpURQVTXHO·eWDW\HVWHIfectivement actionnaire. Avec la formule juridique qu’est la coentreprise
(joint venture O·eWDW JDERQDLV HVSqUH YUDLVHPEODEOHPHQW LQÁXHQFHU OHV
décisions de la compagnie. Toutefois, cela est-il réellement possible ? La
UpSRQVHHVWSHXDLVpH/·LQÁXHQFHGHO·eWDWVXUOD&208)SDUOHELDLVGHOD
FRHQWUHSULVHSDUDvWSOXW{WGLIÀFLOHYRLUHLPSRVVLEOH(QHIIHWVRQDFWLRQQDriat ne lui donne droit qu’à trois sièges au sein du conseil d’administration
de la compagnie ce qui paraît loin de gêner ce dernier, composé de douze
membres et dont les décisions sont adoptées à la majorité. Par conséquent,
nous sommes enclins à avancer que les titres détenus par l’État constituent
GHVWLWUHVGHSODFHPHQWVHWQRQGHVPR\HQVGHSDUWLFLSDWLRQjODGLUHFWLRQ
des affaires.
,´ACTIVITm COMMERCIALE UNE AFFAIRE SOUS CONTRxLE DE LA &RANCE
$ES EXPORTATIONS DESTINmES PRIORITAIREMENT g LA &RANCE
&IGURE bVOLUTION DES EXPORTATIONS DE LA #/-5&
3OURCE 2OBERT %DGARD .DONG OP CIT P /DPR\HQQHDQQXHOOHGXQLYHDXGHYHQWHVHVWGHWRQQHV/HVH[SRUWDWLRQVGHOD&208)QHGpFROOHQWSDVFDUVRQVHXOFOLHQWOD)UDQFHj
O·LQVWDUGHWRXVOHVJUDQGVSD\VLQGXVWULDOLVpVGpYHORSSHSULQFLSDOHPHQW
le nucléaire militaire. Le monopole français tient au contrat d’achat de
)L S´AGIT DE LA RmSOLUTION 86)) ADOPTmE LE PAR L´ASSEMBLmE GmNmRALE %N FAIT LE CONCEPT APPARAsT
DmJg DANS LA RmSOLUTION 6) DU JANVIER 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD FRQFHQWUpV XUDQLIqUHV LQWHUYHQX OH MXLOOHW HQWUH OD &208) HW OH
&($ /H FRQWUDW SRUWH VXU OD OLYUDLVRQ GH WRQQHV SDU DQ G·XUDQLXP
FRQWHQXGDQVGHVFRQFHQWUpVG·XQHWHQHXUVXSpULHXUHj/HSUL[HVW
À[pVHORQXQHIRUPXOHFODVVLTXHGDQVOHGRPDLQHGXFRPPHUFHGHPLQHrais, rapportée au prix de concentré chimique (uranate de magnésie) de
HWWHQDQWFRPSWHGXUHQGHPHQWGHVRSpUDWLRQVXOWpULHXUHVHWGXFR€W
GHWUDQVSRUWHWGXUDIÀQDJHGHVFRQFHQWUpVGHO·HQWUHSULVH.
-XVTX·HQ OD FRPSDJQLH EpQpÀFLH j FRQFXUUHQFH GH WRQQHV
G·XUDQLXPFRQWHQXG·XQSUL[pTXLYDOHQWjGROODUVSDUOLYUHG·R[\GH
d’uranium (U328SUL[GRQWEpQpÀFLHQWHQPR\HQQHOHVPLQHXUVG·DXWUHV
SD\VSDUH[HPSOHGDQVOHFDGUHGHVFRQWUDWVSDVVpVSDUODCombined Developement Agency, organisme responsable des achats américains et anglais.
$SUqVOHSUL[GHUHSULVHGX&($HVWFDOFXOpVXUODEDVHGHKXLW
dollars par livre d’U328SRXUGHVDFKDWVGHFRQFHQWUpVjTXHO·United
States Atomic Energy Commission (USAEC) garantit aux mineurs domestiques américains. Toutefois, dans le cas où il apparaîtrait que le cours mondial est nettement supérieur à ce prix, la compagnie uranifère pourrait en
obtenir la révision ; de même, le CEA pourrait demander la révision en
baisse s’il apparaissait que le prix mondial devenait notoirement inférieur
à ce cours de huit dollars.
Diverses possibilités de résiliation protègent la compagnie contre les
aléas de variations économiques brutales et imprévues
– la résiliation peut intervenir à la demande de la compagnie si le prix
de base, calculé sur référence mondiale au taux de change alors en vigueur,
devenait nettement inférieur au prix qui résulterait de l’actualisation, par
le jeu d’une formule faisant intervenir des prix industriels français, du
prix valable à la signature du contrat ;
²OD&208)SHXWREWHQLUODUpVLOLDWLRQVLODUpYLVLRQSDUODUpIpUHQFH
DXSUL[PRQGLDOWHQGDLWjGpÀQLUXQSUL[QRWRLUHPHQWLQIpULHXUDXSUL[GH
huit dollars par livre d’U328EDVHYDODEOHDSUqV
– le CEA a, pour sa part, la possibilité de résilier ce contrat au terme des
cinq premières années.
'DQV FHV GLYHUV FDV GH UpVLOLDWLRQ OD &208) REWLHQGUDLW OH EpQpÀFH
d’une indemnité égale au solde non amorti d’un compte d’amortissement
dont l’actif est égal au montant des investissements évalué forfaitairement
#(!.0ARIS FONDS *ACQUES,UCIUS !0 .OTE SUR LE CONTRAT D´ACHAT SIGNm AVEC LE #%! LE SEPTEMBRE
)BIDEM
)BIDEM
)BIDEM
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON j))HWDXSDVVLIGXTXHOVHUDLWSRUWpXQDPRUWLVVHPHQWIRUIDLWDLUH
au kilogramme d’uranium livré.
,A VENTE DIRECTE g D´AUTRES PAYS DOIT oTRE SOUMISE
g L´AVIS DES AUTORITmS FRANlAISES
Le projet de vente israëlo-gabonais et les objections françaises
/RUVG·XQYR\DJHHQ,VUDsOHQGH/0EDODSRVVLELOLWpGHYHQGUH
l’uranium gabonais à l’État israélien est évoquée avec les autorités de ce
SD\V&HSURMHWVHIRQGHVXUOHVXSSOpPHQWGHSURGXFWLRQGHOD&208)
c’est-à-dire après livraison des quatre cents tonnes annuelles à la France.
/HVQpJRFLDWLRQVPHQpHVDYHFO·DXWRULVDWLRQGH/0EDHQWUH,VUDsOHW
OD&208)DERXWLVVHQWjXQSURMHWGHFRQWUDWGHYHQWHSRUWDQWVXUYLQJW
tonnes d’uranium métal avec possibilité d’un second contrat portant à cinquante tonnes la quantité d’uranium livré. Ce projet de contrat de vente,
qui porte sur une valeur de 190 millions de FCFA, ne soulève pas d’objections de la part du Président gabonais. Toutefois, conformément aux
accords de coopération franco-gabonais en matière de produits stratégiques (pétrole, uranium) selon lesquels la République française est tenue
informée des programmes et projets concernant l’exportation hors du territoire de la République gabonaise des matières et produits stratégiques,
L. Mba informe Paul Cousseran, ambassadeur de France. Ce dernier attire
l’attention du président gabonais sur les inconvénients politiques majeurs
pouvant résulter de cette vente, compte tenu de la situation politique insWDEOHH[LVWDQWGDQVODUpJLRQjODTXHOOHDSSDUWLHQWOHSD\VDFTXpUHXUHWIDLW
savoir que le gouvernement français estime que les avantages commerFLDX[TXHOH*DERQHVWVXVFHSWLEOHGHUHWLUHUGHO·H[pFXWLRQGXFRQWUDWQH
compensent pas ces inconvénients politiques. Une position française qui
VXUSUHQGOHSUpVLGHQWJDERQDLV
« Je dois vous dire que cette récente position m’étonne. Je n’ignorais pas
en effet que la Compagnie des Mines d’Uranium de Franceville qui n’est
qu’amodiataire d’un permis d’exploitation détenu par le Commissariat à
#(!.0ARIS FONDS *ACQUES,UCIUS !0 ,ETTRE CON½DENTIELLE DE ,mON -BA AU PRmSIDENT DE LA 2mPUBLI
QUE FRANlAISE #HARLES DE 'AULLE ,IBREVILLE LE FmVRIER ,ES ACCORDS DE COOPmRATION FRANCOGABONAIS SONT SIGNmS LE AO}T JOUR DE L´INDmPENDANCE DU 'ABON ,E
'ABON EST TENU DE RESPECTER LESDITS ACCORDS #´EST LA CONDITION sine qua non DE SON ¦ INDmPENDANCE § !INSI
DANS UNE CORRESPONDANCE ADRESSmE g LA VEILLE DE L´INDmPENDANCE AU FUTUR PRmSIDENT GABONAIS ,mON -BA LE
0REMIER MINISTRE FRANlAIS -ICHEL $EBRm NE S´EMBARRASSE PAS DE CIRCONVOLUTIONS DIPLOMATIQUES POUR CLAIRE
MENT LUI SIGNI½ER QUE LA SIGNATURE DES ACCORDS DE COOPmRATION EST PRmALABLE g L´ACQUISITION DE L´INDmPENDANCE
L´UN N´ALLANT PAS SANS L´AUTRE )L mCRIT NOTAMMENT QU´¦ ON DONNE L´INDmPENDANCE g CONDITION QUE L´bTAT S´ENGA
GE UNE FOIS INDmPENDANT g RESPECTER LES ACCORDS DE COOPmRATION SIGNmS ANTmRIEUREMENT IL Y A DEUX SYSTnMES
QUI ENTRENT EN VIGUEUR EN MoME TEMPS L´INDmPENDANCE ET LES ACCORDS DE COOPmRATION ,´UN NE VA PAS SANS
L´AUTRE § 6OIR !LFRED 'ROSSER ,A POLITIQUE EXTmRIEURE DE LA 6E 2mPUBLIQUE bDITIONS *EAN -OULIN 0ARIS ,E 3EUIL
P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD O·pQHUJLHDWRPLTXHHWTXLDGHPXOWLSOHVOLHQVÀQDQFLHUVHWWHFKQLTXHVDYHF
FHGHUQLHURUJDQLVPHQ·DYDLWQpJRFLpFHFRQWUDWGHYHQWHDYHF,VUDsOTX·HQ
OLDLVRQHWDSSDUHPPHQWDYHFO·DFFRUGGX&RPPLVVDULDW2UOH&RPPLVVDriat relevant directement du Premier ministre de la République française,
il m’avait paru évident que, du fait de cette liaison et de cet accord, le gouYHUQHPHQWIUDQoDLVQHYR\DLWSDVG·REMHFWLRQVDXSULQFLSHGHFHWWHYHQWH
Aussi les objections majeures tardives soulevées me surprennent-ellesª
Devant les objections françaises, le président gabonais décide de différer l’approbation de ce contrat et suivant en cela les suggestions de l’ambassadeur de France, de commencer par demander au gouvernement israélien de donner l’assurance que cet uranium gabonais ne serait utilisé
TX·jGHVÀQVSDFLÀTXHVDVVXUDQFHTXLGHYUDLWrWUHDVVRUWLHG·XQFRQWU{OH
sur l’utilisation qui en serait faite.
1HYRXODQWSDVSRUWHUVXUODSODFHSXEOLTXHXQFRQWUDWGRQWOHVSDUWLHVVRXKDLWHQWYLYHPHQWTX·LOUHVWHFRQÀGHQWLHOHWOH*DERQQHGLVSRVDQW
pas de techniciens pour effectuer lui-même ce contrôle, L. Mba suggère
DX JRXYHUQHPHQW LVUDpOLHQ TX·LO VRLW FRQÀp DX &($ SOXW{W TX·j O·$JHQFHLQWHUQDWLRQDOH GHO·pQHUJLHDWRPLTXH$,($7RXWHIRLVRIÀFLHOOHPHQW
OHPDQTXHGHWUDQVSDUHQFHG·,VUDsOjFRPPXQLTXHUVXU VRQGRVVLHUQXFOpDLUHDPqQHOD)UDQFHjIDLUHSDUWDX*DERQGHVRQSHVVLPLVPHTXDQWj
l’utilisation civile de son uranium. D’où la décision du président gabonais
d’abandonner le projet de vente.
La vente exceptionnelle aux Pays-Bas
/DYHQWHDX[3D\V%DVGHO·XUDQLXPJDERQDLVHVWGHVWLQpHjODFHQWUDOH
QXFOpDLUHGH%RUVHOOHH[SORLWpHSDUODVRFLpWp6LHPHQVGRQWe de la proGXFWLRQHVWGHVWLQpHjXQHXVLQHG·DOXPLQLXPGH3HFKLQH\&·HVWG·DLOOHXUV
cette dernière entreprise qui conduit les négociations, tant vis-à-vis des
DFKHWHXUVTX·DYHFOH&($&HSHQGDQWOD&208)GHPDQGHjrWUHpWURLWHPHQW DVVRFLpH j WRXWHV OHV GLVFXVVLRQV FRQFHUQDQW OD À[DWLRQ QRQ VHXlement du prix de vente mais également des frais de transformation par
le CEA en raison de l’importance que ces déterminations présentent tant
pour les prix de contrat de 1970 à 1971 que pour le coût de transformation
des préconcentrés en yellow cake /HV QpJRFLDWLRQV DERXWLVVHQW OH PDL
jODVLJQDWXUHG·XQFRQWUDW/HSUL[À[pHVWGHGROODUVSDUNLORgramme. Ce prix tient compte des frais de transport et de transformation
des préconcentrés en yellow cake.
,OIDXWGLUHTXHODYHQWHGHO·XUDQLXPJDERQDLVDX[3D\V%DVHVWQRQ
VHXOHPHQWIDFLOLWpHSDUOHIDLWTX·HOOHHVWGHVWLQpHjXQHÀOLDOHGH3HFKLQH\
)BIDEM.
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON entreprise française, mais aussi qu’elle apparaît comme une application
GX WUDLWp (85$720 TXL HQFRXUDJH OHV SD\V PHPEUHV j XQH XWLOLVDWLRQ
FRPPXQHGHOHXUVPDWLqUHVÀVVLOHVQRWDPPHQWjGHVÀQVSDFLÀTXHV. Dans
XQHOHWWUHDGUHVVpHOHQRYHPEUHDXPLQLVWUHGHV0LQHVGHO·pQHUJLHHWGHVUHVVRXUFHVK\GUDXOLTXHVGX*DERQOXLGHPDQGDQWO·DXWRULVDWLRQ
G·H[SRUWDWLRQ-/XFLXVSUpFLVHO·HQJDJHPHQWGHO·XWLOLVDWLRQSDFLÀTXHGH
O·XUDQLXPYHQGX
« Les matières premières fournies dans le cadre du présent contrat
QHSRXUURQWrWUHXWLOLVpHVTX·jGHVÀQVSDFLÀTXHV7RXWDFTXpUHXUGHYUD
donc s’engager pour lui-même, et s’engager à obtenir d’un acquéreur ulWpULHXUTX·LOQ·HPSORLHFHVPDWLqUHVTX·jGHVXVDJHVSDFLÀTXHV/HUHVSHFW
de ces engagements sera assuré par un contrôle international approprié.
Sur le territoire des six États membres de la Communauté européenne de
O·pQHUJLHDWRPLTXH(85$720FHFRQWU{OHVHUDFHOXLSUpYXSDUOHWUDLWp
GHO·(85$7206XUOHWHUULWRLUHGHVSD\VTXLQ·DSSDUWLHQQHQWSDVjFHWWH
communauté, l’utilisation de ces matières devra être soumise à un contrôle international équivalentª
En juin 1970 a lieu le premier embarquement de préconcentrés destinés
j rWUH WUDQVIRUPpV HQ QLWUDWH G·XUDQ\OH SXLV HQ KH[DÁXRUXUH G·XUDQLXP
par les soins du CEA et de la Société des usines de Pierrelatte, avant d’être
livré à l’usine d’enrichissement. Les embarquements suivants ont lieu en
septembre 1970 et janvier 1971.
URANEX est seul habilité à vendre
l’uranium malgré les tentatives gabonaises
85$1(; HVW XQ FRPSWRLU FRQVWLWXp VRXV OD IRUPH G·XQ JURXSHPHQW
d’intérêt économique créé le 1erRFWREUHSDUOH&($&)08HWOD6RFLpWp PLQLqUH 3pFKLQH\0RNWD 6030. Sa mission est d’écouler sur le
PDUFKpPRQGLDOODSDUWGHSURGXFWLRQGHVPLQHVIUDQoDLVHVGHOD&208)
HW GH OD 6RFLpWp GHV 0LQHV GH O·$wU 620$Î5, et plus tard celle de la
&RPSDJQLHGHV0LQHVG·$NRXWD&20,1$., non absorbée par les besoins français.
85$1(;VHFKDUJHGHIDLUHHIIHFWXHUOHVWUDQVIRUPDWLRQVGHPDQGpHV
QRWDPPHQW OD FRQYHUVLRQ GHV FRQFHQWUpV G·KH[DÁXRUXUH TX·LO FRQÀH HQ
particulier à la société pour la conversion de l’uranium en métal d’hexaÁXRUXUH&2085+(;FUppHOHRFWREUHSDUODVRFLpWpGHVXVLQHV
#(!.0ARIS FONDS *ACQUES,UCIUS !0 ,ETTRE DE *ACQUES ,UCIUS AU MINISTRE GABONAIS DES -INES DE
L´bNERGIE ET DES 2ESSOURCES HYDRAULIQUES DU 'ABON 0ARIS LE NOVEMBRE ,ES DEUX DERNIERS ACTIONNAIRES DmTIENNENT RESPECTIVEMENT ET DU CAPITAL
,A 3/-!Ë2 EST CRmmE LE ER FmVRIER POUR EXPLOITER L´URANIUM D´!RLIT AU .IGER
,A #/-).!+ EST CRmmE LE JUIN POUR EXPLOITER L´URANIUM D´!KOUTA AU .IGER
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD chimiques et Pierrelatte (UCP), le CEA, la société Azote et produits chimiTXHV$3&HWODVRFLpWp6DLQW*REDLQ7HFKQLTXHVQRXYHOOHV70.
85$1(; JDUDQWLW O·H[pFXWLRQ GHV OLYUDLVRQV DX[ XVLQHV GHV XWLOLVDWHXUV3RXUO·KH[DÁXRUXUHOHVSUL[GHYHQWHLQFOXHQWOHVIUDLVGHWUDQVSRUW
jusqu’aux usines d’enrichissement et l’assurance71. /D&208)DGKqUHj
85$1(;OHMXLOOHW&HWWHDGKpVLRQOXLGRQQHDFFqVjXQTXRWDGH
j GHV FRQWUDWV REWHQXV SDU 85$1(; TXDQWLWp TXH OD &208)
s’engage évidemment à livrer.
D’après la compagnie uranifère, « ce groupement des producteurs était
nécessaire (sic) par la situation très déprimée du marché de l’uranium naturel. Il a permis de limiter l’effondrement des prix tout en apportant aux
PLQHVXQYROXPHGHYHQWHVXIÀVDQWSRXUDVVXUHUXQHXWLOLVDWLRQFRQYHQDble de leurs capacités de production73 ª$LQVL RIÀFLHOOHPHQW 85$1(;
est créé pour contribuer à réguler le marché mondial de l’uranium, plus
SUpFLVpPHQWDÀQGHSHUPHWWUHOHSODFHPHQWGHVVXUSURGXFWLRQVGHVFRPpagnies à participation française en Afrique. Il constitue toutefois aussi un
LQVWUXPHQWSHUPHWWDQWjOD)UDQFHGHFRQWUHFDUUHUOHVYHOOpLWpVGX*DERQ
HWGX1LJHUGHYHQGUHFHWWHPDWLqUHVWUDWpJLTXHTX·HVWO·XUDQLXPDXSUHmier venu. Par exemple, que ce soit sous le président Mba, et surtout,
sous le président Bongo, aux premières années de son arrivée au pouvoir,
OH*DERQPDQLIHVWHVRQGpVLUGHYHQGUHVRQXUDQLXPjG·DXWUHVSD\V
(Q HIIHW VHPEODQW VXLYUH OH PRXYHPHQW GHV SD\V HQ GpYHORSSHPHQW
dans leur volonté de se réapproprier la souveraineté de leurs richesses
naturelles, le président Bongo prend lui-même des contacts avec des acheteurs potentiels. C’est ainsi que lors d’une visite aux États-Unis, Union
Carbide se dit intéressée par les concentrés uranifères gabonais. D’où
OD GHPDQGH GH FRQFHQWUpV IDLWH SDU OH SUpVLGHQW %RQJR j OD &208) OH
MXLOOHWDÀQGHOHVSUpVHQWHUDX[eWDWV8QLHQV. Toutefois, le rapSURFKHPHQWGLUHFW8QLRQ&DUELGH*DERQRIIXVTXHOHVUHVSRQVDEOHVGHOD
&208)SRXUWDQWFHQVpVGpIHQGUHOHVLQWpUrWVGHODFRPSDJQLH'DQVXQH
OHWWUHDGUHVVpHOHGpFHPEUHj3HFFLD*DOHWWRGLUHFWHXUJpQpUDOGH
0RNWD(O+DGLG+HQUL%DVVHWGLUHFWHXUJpQpUDOGHOD&208)pFULW
©-·DLUHQFRQWUpj/LEUHYLOOHOHVHWGpFHPEUHGHUQLHUV0RQVLHXU'$9,'+3$5(17GLUHFWHXUJpQpUDOSRXUO·$IULTXH&HQWUDOH
!RCHIVES DU #%! FONDS 'OUVENET #%! L´INDUSTRIE FRANlAISE DU CYCLE DES COMBUSTIBLES NUCLmAIRES 0ARIS P )BIDEM
#(!.0ARIS FONDS *ACQUES ,UCIUS !0 !IDEMmMOIRE SUR LA COMMERCIALISATION DE L´URANIUM NATUREL DE
LA #/-5&
)BIDEM
6OIR LE PROJET DE VENTE ISRApLOGABONAIS ABORDm DANS LE PRmSENT ARTICLE
#(!.0ARIS FONDS *ACQUES ,UCIUS !0 ,ETTRE DE ( "ASSET g 0ECCIA 'ALETTO -OUNANA LE DmCEMBRE
# DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON HW2FFLGHQWDOHGH7(03(/0$11621TXLDFFRPSDJQDLWOHVGLULJHDQWVG·81,21&$5%,'(ORUVGHOHXUYLVLWHj0RXQDQDOHQRYHPEUH-·HQDLSURÀWpSRXUOXLGHPDQGHUGHVH[SOLFDWLRQVDXVXMHW
G·81,21 &$5%,'( >«@ -H PH VXLV pWRQQp TX·81,21 &$5%,'(
ait emprunté une voie aussi “tortueuse” pour se porter acquéreur
de concentrés uranifères alors qu’il était très simple de s’adresser à
85$1(;
0RQVLHXU 3$5(17 QH P·D SDV GRQQp G·H[SOLFDWLRQ VL FH Q·HVW
´TX·LOVµ7(03(/0$11HW81,21&$5%,'(QHIDLVDLHQWTXHUpSRQGUHjXQVRXKDLWGXSUpVLGHQW%21*2GHGLYHUVLÀHUOHVLQYHVWLVVHPHQWVDX*DERQHWTXHOHVSUHPLHUVSDVQ·pWDLHQWSDVGHOHXUIDLW
,OP·DFRQÀUPpSDUDLOOHXUVTX·81,21&$5%,'(DOODLWHIIHFWLYHPHQWVRXPHWWUHDX3UpVLGHQW%21*2GHVSURSRVLWLRQVSRXUXQH
SURGXFWLRQGH´\HOORZFDNHµj0RXQDQD
,O P·D DQQRQFp GH PrPH OD YLVLWH GH ´WHFKQLFLHQVµ G·81,21
&$5%,'(TXLYLHQGUDLHQWj0281$1$FRXUDQWMDQYLHUSRXUYRLU
sur place ces problèmes.
-·DLGLWDORUVj0RQVLHXU3$5(17TXHMHWURXYDLVSRXUOHPRLQV
VXUSUHQDQWH OD PDQLqUH GH SURFpGHU G·81,21 &$5%,'( pWDQW
donné que ses dirigeants ne semblaient pas éprouver le besoin de
GHPDQGHU DX SUpDODEOH DX[ SDUWLFLSDQWV PDMRULWDLUHV GH &208)
(autre que l’État gabonais) ce qu’ils pensaient de cette affaire, ajoutant que pour ma part je n’aurais pas grand-chose à dire aux “techniciens” qui viendront en janvier hors instructions reçues de mon
conseil d’administration.
0RQVLHXU 3$5(17 V·HQ HVW WLUp SDU XQH SODLVDQWHULH VXU OHV
mauvaises habitudes des “Amerlocks comme disent les Belges” et
DFRQYHQXTX·HIIHFWLYHPHQWOHVGLULJHDQWVG·81,21&$5%,'(GHvraient prendre contact au préalable avec le conseil d’administraWLRQGH&208)²,OP·DGHPDQGpOHVDGUHVVHVQpFHVVDLUHVTXHMHOXL
ai données – […]ª
0DOJUp O·DYDQWDJH ÀQDQFLHU TX·HVW VXVFHSWLEOH GH UHWLUHU OD &208)
G·XQpYHQWXHOFRQWUDWDYHF8QLRQ&DUELGH+HQUL%DVVHWVHSRVLWLRQQHFODLUHPHQWFRQWUHWRXWDFKDWHQGHKRUVG·85$1(;
Cette position peut être vue comme une défense des intérêts français.
D’autre part, c’est une application des accords de coopération franco-gabonais qui obligent Libreville à demander l’avis de Paris avant de vendre
VRQXUDQLXPjG·DXWUHVSD\V'·XQHSDUWF·HVWXQHGpIHQVHGHODVWUDWpJLH
FRPPHUFLDOHGXFDUWHOGHO·XUDQLXPGRQWHVWPHPEUH85$1(;(QFRUH
appelé le club, le cartel de l’uranium HVWFRQVWLWXpHQIpYULHUj3DULVSDU
GHVHQWUHSULVHVGHTXDWUHSD\VSURGXFWHXUVG·XUDQLXP$IULTXHGX6XG
$XVWUDOLH)UDQFHHWODVRFLpWpEULWDQQLTXH5LR7LQWR=LQF57=6RQREMHW
)BIDEM.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD .$/.' 2OBERT %DGARD HVWGRXEOHDWWULEXHUGHVTXRWDVG·H[SRUWDWLRQHWÀ[HUGHVSUL[FRPPXQV
(QSUHQDQWDWWDFKHGLUHFWHPHQWDYHF8QLRQ&DUELGHOH*DERQV·LQVFULWHQ
IDX[SDUUDSSRUWjFHWWHVWUDWpJLH2UGDQVOHFDUWHOWRXWHLQGLVFLSOLQHG·XQ
membre entraîne une diminution de ses quotas de vente. Comme c’est le
FDVGH57=77/·DWWLWXGHGX*DERQSRXUUDLWGRQFSURYRTXHUXQHGLPLQXWLRQGHVTXRWDVG·85$1(;HWSDUFRQVpTXHQWRFFDVLRQQHUXQPDQTXHj
JDJQHUÀQDQFLHUFHUWDLQSRXUODSDUWLHIUDQoDLVH&HFLMXVWLÀHO·pFKHFGHOD
QpJRFLDWLRQHQWUHOH*DERQHWO·8QLRQ&DUELGH
7RXWHIRLV GHYDQW O·LQVLVWDQFH GX *DERQ DÀQ GH SDUWLFLSHU DX[ GpFLsions relatives à la commercialisation de son uranium, une réunion franFRJDERQDLVHVXUOHVXMHWVHWLHQWHQDYULOj/LEUHYLOOH/HVGLVFXVVLRQV
HQWUH*DERQDLVHW)UDQoDLVSRUWHQWVXUGHX[SRLQWVGRQWOHSUHPLHUHVWOD
QpJRFLDWLRQHQWUHOH*DERQHWOD)UDQFH&HWWHQpJRFLDWLRQIDLWVXLWHjFHOOHV
TXLVHVRQWGpURXOpHVHQHQWUHOH*DERQOH1LJHUHWOD)UDQFHVXUOH
prix de l’uranium et les revenus que l’exploitation de l’uranium rapporte
aux États et les effets induits qui en découlent. Fidèle à sa position de voir
rehausser le prix de l’uranium, le président Bongo obtient au cours de ces
FRQYHUVDWLRQVTXHO·XUDQLXPTXHOH*DERQOLYUHjOD)UDQFHVRLWGpVRUPDLV
YHQGX j )&)$ OH NLORJUDPPH QDWXUHO FRQWHQX SRXU O·DQQpH et ce, malgré l’existence de contrats anciens en cours d’exécution dont les
prix sont sensiblement inférieurs. Le second point est la négociation entre
OH*DERQHWOD&208)/HJRXYHUQHPHQWJDERQDLVGRQQHPDQGDWjOD&2MUF de ne pas livrer de l’uranium à un prix inférieur à 10 000 FCFA78.
#/.#,53)/.
'DQVO·KLVWRLUHGHOD&208)ODPLVHDXMRXUGXJLVHPHQWG·XUDQLXP
de Mounana est, indiscutablement, l’événement déclencheur de sa procédure de constitution. La constitution intervient au terme de trois étapes au
cours desquelles le CEA trouve des formules juridiques protégeant l’uranium et la compagnie des éventuelles velléités nationalistes, eu égard à
O·LQGpSHQGDQFHTXLVHSURÀOHDX*DERQ$XVVLSDUFHTXHÀQDQFLqUHPHQW
limité, le CEA propose-t-il à des associés privés de participer à la constituWLRQGHOD&208)$SUqVO·pFKHFGHODVWUDWpJLHIUDQFRHXURSpHQQHG·DFtionnariat, c’est la stratégie franco-française qui s’avère fructueuse. Des
groupes privés bancaires, chimiques et industriels français acceptent de
participer au projet, et ce, après obtention de garanties les protégeant des
ULVTXHVÀQDQFLHUVTX·LOVYRQWHQFRXULU-XJpHUHQWDEOHSDUVRQGLUHFWRLUHOD
*EAN0IERRE /LSEM ,´mNERGIE DANS LE MONDE STRATmGIE FACE g LA CRISE 0ARIS (ATIER P 'ABON MATIN NUMmRO D´AVRIL P # DE 2%#)43 #OMPAGNIES DES MINES D´URANIUM DE &RANCEVILLE 'ABON &208)GpPDUUHHQXQHDFWLYLWpFODLUHPHQWVFLQGpHHQGHX[SDUWLHV
qui sont gérées séparément.
D’une part, la partie industrielle est l’affaire de la compagnie. PriviléJLDQWO·DXWRÀQDQFHPHQWOD&208)UHFUXWHHOOHPrPHO·HVVHQWLHOGHVRQ
SHUVRQQHO FRVPRSROLWH FRPSRVp PDMRULWDLUHPHQW GH *DERQDLV 7HFKQLquement, c’est elle qui met en valeur le gisement d’uranium de Mounana
et traite les minerais par les méthodes classiques utilisées dans les mines métallifères et dans l’industrie uranifère. D’autre part, la partie commerciale, quant à elle, est sous contrôle d’autres entités françaises. Une
IRLV SDUWLH GX *DERQ OD SURGXFWLRQ GH OD FRPSDJQLH HVW LQWpJUDOHPHQW
HQYR\pHHQ)UDQFHRHOOHHVWSULRULWDLUHPHQWGHVWLQpHDX&($0DOJUpOHV
WHQWDWLYHVVXFFHVVLYHVGX*DERQGHPXOWLSOLHUOHVFOLHQWVGHVRQXUDQLXP
WRXWHYHQWHjG·DXWUHVSD\VGHPHXUHVRXPLVHjO·DYLVGX&($HWGHVDXWRrités françaises.
En réalité, plus largement, l’activité de l’uranium gabonais est, aussi
bien dans sa partie industrielle que commerciale, sous contrôle de la FranFH$LQVLOH*DERQSURSULpWDLUHOpJDOGXVROHWGXVRXVVROGLVSRVHG·XQH
marge de manœuvre marginale.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 1.
Partie III
Techniques
maritimes
0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE 5NE PROPULSION mLECTRIQUE !LSTHOM
POUR LE PAQUEBOT .ORMANDIE
0ASCAL 2OBERT
C
qui a conduit au choix
de la propulsion électrique pour le paquebot Normandie. C’est
en janvier 1931, après plus de deux années d’études et d’intenVHVQpJRFLDWLRQVTXHFHWWHGpFLVLRQVHUDHIIHFWLYH/HPDLDSUqVTXDtre années de construction dans une époque troublée par la grande crise
pFRQRPLTXHGHOHNormandie, navire de plus de trois cents mètres de
ORQJHWGHSOXVGHWGHGpSODFHPHQWGpSDVVHODYLWHVVHSURGLJLHXVH
GHWUHQWHGHX[Q±XGVVXUODEDVHG·HVVDLVGHV*OpQDQV8QPRLVSOXVWDUG
le 3 juin, cette propulsion électrique permet au Normandie de remporter le
Ruban bleu, trophée prestigieux qui récompense le navire transatlantique
le plus rapide. Ces succès confortent les options techniques sélectionnées
par les ingénieurs ainsi que les nombreux arbitrages rendus par les dirigeants de talent en charge de ce projet.
ET ARTICLE PRÉSENTE LE PROCESSUS DE DÉCISION
5. #/.4%84% b#/./-)15% &!6/2!",%
%4 5.% #/.6%.4)/. 0/34!,%
(Q OHV GpFLGHXUV GH OD &RPSDJQLH JpQpUDOH WUDQVDWODQWLTXH1,
SRXUVXLYHQW OHXU SROLWLTXH G·LQYHVWLVVHPHQW DÀQ GH JDUGHU XQH SRVLWLRQ
FRPPHUFLDOHLPSRUWDQWHVXUOHVOLJQHVGHO·$WODQWLTXH1RUG.
#ETTE COMPAGNIE MARITIME CONNUE SOUS LE SIGLE #'4 EST SOUVENT APPELmE ¦ ,A TRANSAT §
,ES &RANlAIS S´EXPATRIANT PEU LA #'4 AVAIT MIS EN PLACE UN RmSEAU D´AGENCES DE RECRUTEMENT DES mMIGRmS EN
)TALIE EN !UTRICHE DANS LES "ALKANS ET AU 0ROCHE/RIENT *USQU´AU DmBUT DES ANNmES mPOQUE g LAQUELLE
LES bTATS5NIS ½XENT DES QUOTAS LA #'4 AFFRnTE DES TRAINS CONDUISANT LES mMIGRmS AU PORT DU (AVRE $E g
MILLIONS D´%UROPmENS ONT MIGRm VERS LE .OUVEAU -ONDE
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL C’est ainsi qu’ils ont passé commande des paquebots Lafayette, destiné
jODOLJQHGH1HZ<RUNColombie, pour celle des Antilles, et Président Dal
Piaz, pour la Méditerranée. Le paquebot dit à classe unique3 Champlain
HVWPLVHQVHUYLFHOHMXLQ/D&*7 dispose depuis la mise en service du paquebot Île-de-France HQ G·XQ WULR GH QDYLUHV KRPRJqQHV
en vitesse avec les paquebots Paris et France. Il faut souligner que ces
trois paquebots ont été construits en application d’une convention postale
SDVVpHHQWUHO·eWDWHWOD&*7HQ&HOOHFLVWLSXOHTXHO·DUPDWHXUGRLW
DVVXUHUXQHOLDLVRQKHEGRPDGDLUHHQWUHO·$PpULTXHGX1RUGHWOD)UDQFH
$XWHUPHGHFHWWHFRQYHQWLRQF·HVWjGLUHHQLOHVWSUpYXTXHOD&*7
devra avoir construit un quatrième paquebot, ce sera le Normandie.
,! #/-0b4)4)/. 352 ,´!4,!.4)15% ./2$
Pour satisfaire à l’obligation liée à la convention postale, les armateurs
français se trouvent devant un choix aux conséquences économiques très importantes pour l’avenir. Faut-il construire un navire remplissant uniquement
le rôle de ses prédécesseurs au risque de se voir distancer par la concurrence,
ou bien innover en imaginant un navire surclassant tous les autres ?
(QHIIHWOHV$OOHPDQGVGX1RUGGHXWVFKHU/OR\G ont déjà commandé
HQDX[FKDQWLHUV$*:HVHU de Brême, le Bremen et aux chantiers Blohm und VossGH+DPERXUJO·Europa7­ODÀQGHVDQQpHVOHV,WDOLHQV
inspirés par les navires allemands, s’affairent sur les projets de paquebots
de grand luxe Rex et Conte di Savoia8. Tous ces navires marquent une rupture dans la construction navale, tant sur le plan des formes de coque, de
l’aménagement intérieur que sur leur propulsion. La propulsion de ces
navires fait appel aux turbines à engrenages et à des chaudières à tubes
d’eau chauffées au mazout. Les pressions plus élevées et les températures de surchauffe ont permis de doubler la puissance de ces navires par
$ANS LES ANNmES LES ¾UX D´mMIGRANTS SE TARISSENT ET LES COMPAGNIES MARITIMES POUR MAINTENIR LEUR
NIVEAU D´ACTIVITm COMMANDENT DES NAVIRES MOINS LUXUEUX ET MOINS RAPIDES QUE LES PAQUEBOTS DE GRAND LUXE
#ES ¦ CABIN SHIPS § SmDUISENT UNE NOUVELLE CLIENTnLE LES TOURISTES QUI SONT EN RmALITm RmPARTIS EN TROIS CLASSES LA CLASSE ¦ CABIN § LA CLASSE TOURISTE ET LA E CLASSE
,E PAQUEBOT #HAMPLAIN DE LA #OMPAGNIE GmNmRALE TRANSATLANTIQUE IN 'mNIE #IVIL 4OME #) P -IS EN SERVICE EN MAIS DE CONCEPTION ANTmRIEURE g !QUITANIA EST MIS EN SERVICE EN ET &RANCE EN 2EBAPTISm Liberté IL NAVIGUERA SOUS LE PAVILLON DE LA &RENCH ,INE APRnS LA 3ECONDE 'UERRE MONDIALE SUITE AUX
ACCORDS "LUM"YRNES )L COMPENSERA EN PARTIE LA PERTE DU .ORMANDIE DmTRUIT PAR UN INCENDIE DANS LE PORT DE
.EW 9ORK LE FmVRIER ,E CONTE DI 3AVOIA EST DOTm D´UN SYSTnME DE STABILISATION RmVOLUTIONNAIRE COMPOSm DE TROIS GYROSTABILISATEURS
#E SYSTnME A mTm PEU RmUTILISm g NOTRE CONNAISSANCE SUR DES NAVIRES ,ES CONTRAINTES MmCANIQUES EXERCmES PAR
LES GYROSTABILISATEURS FATIGUENT LE NAVIRE #EPENDANT CETTE TECHNOLOGIE SERA EMPLOYmE SUR LE PORTEAVIONS
JAPONAIS (OSCHO
# DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE UDSSRUWjOHXUVDvQpVHWGHSRUWHUOHXUYLWHVVHMXVTX·jQRHXGVSRXUOHV
jumeaux allemands et italiens.
1RXVVRPPHVDORUVHQSUpVHQFHVXUFHWWHOLJQHWDQWFRQYRLWpHGHO·$WODQWLTXH1RUGGHGHX[W\SHVGHQDYLUHVFHX[PDUFKDQWjQ±XGVFRPme les navires français France, Paris et Île-de-France ou encore britanniques
comme l’Aquitania et l’Olympic HWFHX[PDUFKDQWjSOXVGHQ±XGVFRPme le Bremen, l’Europa ou encore le Rex et Conte di Savoia.
$LQVLGHYDQFpVSDUOHV$OOHPDQGVVXUO·$WODQWLTXH1RUGOHV%ULWDQQLTXHV
QHUHVWHQWSDVLQDFWLIVOD&XQDUG9 a un projet très ambitieux de construire
GHX[©PpJDSDTXHERWVªOHVIXWXUVQueen Mary et Queen Elisabeth/D:KLWH
Star Line10 a dans ses cartons, le projet Oceanic11, un autre géant des mers qui
VHUDÀQDOHPHQWDEDQGRQQpHQFRXUVGHFRQVWUXFWLRQ/DPDULQHEULWDQQLTXH
est la plus grande concurrente de la marine française. C’est pourquoi le
projet de la Cunard est regardé avec beaucoup d’attention.
Les armateurs britanniques sont arrivés à la même conclusion que les
GLULJHDQWVGHOD&*7GHX[QDYLUHVFDSDEOHVG·REWHQLUXQHYLWHVVHGHSOXV
de trente nœuds pourraient, même à la vitesse commerciale de vingt-huit
nœuds, traverser l’Atlantique en quatre jours, ce qui, compte tenu de la
durée des escales, assurerait un service hebdomadaire jadis réalisé par
trois navires.
,! '%.È3% $5 02/*%4 ¦ 350%2 Ê,%$%&2!.#% §
Le projet de construction d’un nouveau grand paquebot fait l’objet de
GLVFXVVLRQVLQWHUQHVDXSOXVKDXWQLYHDXGHOD&*7DXSULQWHPSV
&·HVWWRXWQDWXUHOOHPHQWTXHOD&*7VHWRXUQHYHUVVRQDQFLHQFKDQWLHUQD-
,A #UNARD ALIGNE EN SUR L´!TLANTIQUE .ORD LE -AURITANIA DE LE "ERENGARIA EX )MPERATOR ALLEMAND
DE ET LE -AJESTIC EX "ISMARCK ALLEMAND DE ,A 7HITE 3TAR ,INE DISPOSE DE L´/LYMPIC LANCm EN )L FAIT PARTIE AVEC LE 'IGANTIC, DE LA MoME SmRIE QUE LE
Titanic !PRnS LA CATASTROPHE DU 4ITANIC LE 'IGANTIC SERA BAPTISm "RITANNIC NOM DE L´UN DE SES PRmDmCESSEURS g
LA CARRInRE PLUS CHANCEUSE
%N SOUVENIR DE L´/CEANIC DE QUI FUT g SES DmBUTS LE PLUS GRAND PAQUEBOT DU MONDE %CHOUm EN IL
FUT FERRAILLm APRnS LA GUERRE
,´IMMENSE ¾OTTE BRITANNIQUE JAUGE PLUS DE VINGT MILLIONS DE TONNEAUX EN ,A ¾OTTE FRANlAISE DISPOSE
DE MILLIONS DE TONNEAUX g CETTE mPOQUE 3I LA TECHNOLOGIE GERMANIQUE INNOVE ET OFFRE DE BELLES RmUSSITES
g LA MARINE ALLEMANDE DE L´ENTREDEUXGUERRES LES PERTES DUES AU PREMIER CON¾IT MONDIAL ET LA SAISIE PAR LES
ALLImS DES NAVIRES ALLEMANDS g TITRE DE DOMMAGE DE GUERRE L´ONT FAIT PASSER DE SIX g CINQ MILLIONS DE TONNEAUX
DE JAUGE ENTRE ET 3UR LA LIGNE DE L´!TLANTIQUE .ORD LES "RITANNIQUES SONT LES CONCURRENTS DIRECTS DES &RANlAIS 3EULES LES COM
PAGNIES MARITIMES DE CES DEUX NATIONS SITUmES LES PLUS g L´OUEST DE L´%UROPE PEUVENT PRmTENDRE REJOINDRE LES
bTATS5NIS AVEC DES PAQUEBOTS DE ¦ JOURS § ,ES NAVIRES AMmRICAINS mTANT SOUMIS g LA PROHIBITION LES PAQUEBOTS EUROPmENS ET EN PARTICULIER FRANlAIS SONT ALORS TRnS EN VOGUE
%N ATTENDANT DE RECEVOIR SON NOM DE BAPToME .ORMANDIE LE PROJET S´APPELLE 4 OU ENCORE 3UPER ÊLEDE&RANCE
EN HOMMAGE AU ¾EURON DE LA ¾OTTE DE LA #OMPAGNIE GmNmRALE TRANSATLANTIQUE DE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL YDOOHFKDQWLHUGH3HQKRsW, pour lui passer commande. Il est en fait le seul
chantier capable de lancer de très grands navires. Le chantier va alors se
tourner vers ses fournisseurs pour répondre à la demande de son client.
Le début des études constitue une activité intense de recherche de solutions si ce n’est d’idées car il faut bien le reconnaître, les ingénieurs de haut
niveau qui portent le projet sont quelque peu désemparés par l’absence de
GRQQpHVSUpFLVHVGHODSDUWGHOD&*7/HVYLVLWHVGHQDYLUHVHWGHFKDQWLHUV
YRQWGRQQHUOLHXjO·DFTXLVLWLRQGHVDYRLUV/HVVRFLpWpV*(&, Babcock et
:LOFR[17, CEM18, Alsthom19 proposent leurs avant-projets, échangent des
courriers, envoient leurs délégués rencontrer les donneurs d’ordres et les
ingénieurs. Les questions techniques se multiplient, chaque exigence enWUDvQDQWDYHFHOOHXQHVpULHGHFRQVpTXHQFHVTXLjOHXUWRXULQÁXHQFHQWOHV
©SDUDPqWUHVG·HQWUpHª/·DSSURFKHVHIDLWSDUHVVDLVSDUWkWRQQHPHQWV
par expériences ou par calculs lorsque cela est possible, le tout, sous les
FRQWUDLQWHVÀQDQFLqUHVHWWHPSRUHOOHV,OIDXWSRXUOHVIRXUQLVVHXUVWHQLU
les délais et atteindre les performances contractuelles pour échapper aux
pénalités. Mais dans l’instant, pour les entreprises répondant à l’appel
G·RIIUHVLOV·DJLWVXUWRXWG·DPHQHUOHFDKLHUGHVFKDUJHVGHVVSpFLÀFDWLRQV
au niveau des capacités de leurs fournitures.
/CTOBRE #ON½RMATION DE L´INTENTION DE COMMANDE
/D&*7FRQÀUPHVRQLQWHQWLRQGHFRPPDQGHDXFKDQWLHUGH3HQKRsW.
Si l’objectif de vitesse de vingt-huit nœuds du Super Île-de-France est préFLVpOHÁRXGXSURMHWVXVFLWHGHODSDUWGXGLUHFWHXUGXFKDQWLHUGX3HQKRsW, Fernand Coqueret, les remarques suivantes, adressées à son direcWHXUJpQpUDOj3DULV$QGUp/pY\
7RXWG·DERUG&RTXHUHWGHPDQGHjFHTXHOD&*7 fournisse des indiFDWLRQVGHSULQFLSHHWGHVSUpFLVLRQVDÀQG·RULHQWHUOHVUHFKHUFKHVGHGRcumentation, car l’étendue des solutions possibles nécessiterait un travail
très long.
,ES DEUX PLUS GRANDES COMPAGNIES BRITANNIQUES LA #UNARD ET LA 7HITE STAR AVANT LEUR FUSION EN MAI SONT RESPECTIVEMENT ASSOCImES AUX #HANTIERS BRITANNIQUES *OHN "ROWN ET (ARLAND 7OLFF
,A CALE DE LANCEMENT DE L´ÊLEDE&RANCE LONGUE DE MnTRES EST INSUF½SANTE 5NE NOUVELLE CALE DE PLUS DE
MnTRES DE LONGUEUR SERA COMMANDmE EN FmVRIER $ES TRAVAUX D´EXTENSION DE LA CAPACITm DU PORT DE
3AINT.AZAIRE COMMENCENT CETTE MoME ANNmE PAR LA CRmATION DE LA FORME *OUBERT SAS DE M X M
'ENERAL %LECTRIC #OMPANY
&ABRICANT DE CHAUDInRES
#OMPAGNIE bLECTRO-mCANIQUE
0ARFOIS SURNOMMmE DANS LES DOCUMENTS D´ARCHIVES DU 0ENHOpT ¦ L´!LSACIENNE §
,E FUTUR .ORMANDIE GARDE CE NOM JUSQU´AU OCTOBRE SOIT ONZE JOURS AVANT SON LANCEMENT
$IRECTEUR DE L´mTABLISSEMENT DES !TELIERS ET #HANTIERS DU 0ENHOpT IL SERA NOMMm 0$' DE g
$IRECTEUR DE L´mTABLISSEMENT DES !TELIERS ET #HANTIERS DU 0ENHOpT IL SERA NOMMm DIRECTEUR GmNmRAL
DE g ET DE g # DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE /HSUHPLHUSRLQWSRUWHVXUODGpÀQLWLRQGHODYLWHVVH(VWFHXQHYLWHVVH
DX[ HVVDLV RX HQ VHUYLFH " (VWHOOH XQH GRQQpH © IHUPH ª RX ELHQ HVWFH
seulement une indication qui pourrait se transformer en une vitesse de
©Q±XGVDX[HVVDLVSRXUrWUHV€UG·REWHQLUQ±XGVHQVHUYLFH"ª
/HVHFRQGSRLQWTXLFRQFHUQHODORQJXHXUHVWOXLDXVVLWRXWDXVVLÁRX
6·DJLWLO GH SLHGV GH ORQJXHXU j OD ÁRWWDLVRQ RX ELHQ KRUV WRXW " /j
DXVVLHVWFHXQHGRQQpH©IHUPHªRXELHQXQHLQGLFDWLRQVXMHWWHjXQHVHQVLEOHPRGLÀFDWLRQVL©O·pWXGHPRQWUHO·LQWpUrWGXFKDQJHPHQW"ª
/HWURLVLqPHSRLQWpYRTXHOHW\SHGHO·DSSDUHLOPRWHXUHWpYDSRUDWRLUH
2YDODSUpIpUHQFHGHO·DUPDWHXU",OIDXWQRWHUTXHO·DXWHXUFLWHXQLTXHment des solutions à base de turbines à engrenages alimentées par des
chaudières Prudhon-CapusGHW\SHVF\OLQGULTXHVRXjWXEHVG·HDXDYHF
surchauffe.
5N OUTIL g LA BASE DU PROJET LES CONFmRENCES DE DIRECTION
Elles sont véritablement l’outil du management qui permet de jalonner
OHSURMHWHQÀ[DQWOHVSDUDPqWUHVGXQDYLUHHWHQSHUPHWWDQWG·RULHQWHUOHV
recherches.
DmCEMBRE UNE PREMInRE CONFmRENCE POUR LANCER LE PROJET
(OOHVHUpXQLWVRXVODSUpVLGHQFHGH0+RPEHUJSUpVLGHQWGHOD&*7,
DX[FKDQWLHUVGX3HQKRsWj6DLQW1D]DLUH
/D&*7 est aussi représentée par son administrateur, directeur général M. Tillier et par MM. Romano5RWWGH&DWDODQR&DVWHOOL*XLOORQHW
Ducroux.
M. Fould SUpVLGHQW GH OD 6RFLpWp DQRQ\PH GHV &KDQWLHUV HW$WHOLHUV
GH6DLQW1D]DLUHHVWDFFRPSDJQpGHVRQpTXLSHGLULJHDQWHFRPSRVpHGH
0*RGDUGDGPLQLVWUDWHXULQVSHFWHXUJpQpUDOHWGH0/pY\, directeur
général et des principaux ingénieurs des chantiers, MM. Coqueret, Pinczon, Lambert, Conard et Sée.
0 +RPEHUJ après avoir examiné la documentation fournie par les
&KDQWLHUVGH3HQKRsWHWOHVUHPDUTXHVGH0/pY\ « signale que le chantier doit se borner à étudier un projet dans les conditions imposées par la
Compagnieª
,ES PROCnSVERBAUX DE CES CONFmRENCES FONT PARTIE DES ARCHIVES PRIVmES DES #HANTIERS DE L´!TLANTIQUE
)NGmNIEUR EN CHEF DES SERVICES TECHNIQUES DE LA #'4
$IRECTEUR DE L´mTABLISSEMENT DES !TELIERS ET #HANTIERS DU 0ENHOpT $IRECTEUR DES #HANTIERS DE L´!TLANTIQUE PUIS PRmSIDENT DES #HANTIERS DE L´!TLANTIQUE $IRECTEUR DE L´mTABLISSEMENT DES !TELIERS ET #HANTIERS DU 0ENHOpT 0ROCnSVERBAL DE LA CONFmRENCE DU DmCEMBRE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL Les considérations commerciales, d’emménagements et de port impoVHQWOHVGLPHQVLRQVVXLYDQWHV
‡/RQJXHXUHQWUHSHUSHQGLFXODLUHV P
‡/DUJHXUPLQLPDOH P
‡Tirant d’eau = 11 m.
/HQRPEUHGHSDVVDJHUVHVWGpÀQLGHPDQLqUHLPSpUDWLYHSRXUOHV©SUHPLqUHFODVVHªjQHXIFHQWVHWSRXUOHV©VHFRQGHFODVVHªjFHQWVRL[DQte-quinze. Il serait désirable que le nombre de passagers soit porté à six
FHQWV SRXU FHX[ YR\DJHDQW HQ © FODVVH WRXULVWH ª HW j VL[ FHQWV SRXU OHV
©WURLVLqPHFODVVHª
La vitesse demandée est de vingt-huit nœuds en charge à mi-route. Il
HVWDXVVLVSpFLÀpTXHOHQDYLUHVHUDH[SORLWpjUDLVRQGHTXLQ]HYR\DJHVj
YLQJWKXLWQ±XGVHWGHFLQTYR\DJHVXWLOLVDQWXQHGHPLSXLVVDQFHjXQH
vitesse comprise entre vingt-deux et vingt-deux nœuds un quart.
0+RPEHUJGpÀQLWDXVVLHQTXDWUHSRLQWVODPpWKRGHjVXLYUH
/D&*7 s’occupera seule des emménagements.
©/HFKDQWLHUDXUDjIDLUHXQHpWXGHGHODIRUPHHWGHODSXLVVDQFH
du bateau, en se basant sur les caractéristiques imposées et le plan des
emménagements décidéª
/HVPRGLÀFDWLRQVDXSODQJpQpUDOGHVHPPpQDJHPHQWVVHURQWIDLWHV
VXUGHPDQGHGXFKDQWLHUDSUqVDFFRUGGHOD&*7.
©$SUqVTXRLLOHVWKDXWHPHQWGpVLUDEOHTXHQLOD&*7 ni le chantier
ne changent plus rien aux données principales qui auront été arrêtées30ª
0/pY\ prend note des indications et demande d’arrêter un choix parmi
OHVGLIIpUHQWVW\SHVG·DSSDUHLOVPRWHXUVHWpYDSRUDWRLUHV/DGRFXPHQWDWLRQ
fournie par le chantier met en évidence l’importance considérable du poids
de l’appareil moteur dans l’ensemble et de la consommation pour un navire
à grande vitesse de cette importance. Il déclare que le poids et la consommation agissent en grand sur les dimensions, le déplacement, les formes et
PrPHODSXLVVDQFH©&·HVWWRXWHO·pFRQRPLHGXSURMHWTXLHVWHQMHXª
/D GLVFXVVLRQ YD V·RXYULU VXU XQ SUpDODEOH LO HVW KRUV GH TXHVWLRQ
d’adopter des moteurs Diesel31, il ne reste qu’à adopter des turbines utilisant de la vapeur saturée ou surchauffée. Les turbines à action directe sont
éliminées en raison de leur poids et de leur encombrement.
)BIDEM .OTONS QUE CETTE DmMARCHE EST TYPIQUEMENT FRANlAISE ,ES &RANlAIS CONSTRUISENT UN HxTEL AVEC UNE
COQUE AUTOUR LES "RITANNIQUES CONSTRUISENT UN NAVIRE DANS LEQUEL ILS INSTALLENT L´HxTEL
)BIDEM #ETTE DERNInRE AF½RMATION VA oTRE COMME NOUS LE VERRONS PAR LA SUITE FORTEMENT CONTREDITE
,A PUISSANCE DES MOTEURS $IESEL EST INSUF½SANTE EN POUR LE NAVIRE ENVISAGm ,E PREMIER TRANSATLANTIQUE
g MOTEUR $IESEL EST L´!UGUSTUS PAQUEBOT ITALIEN LIVRm EN ,ES #HANTIERS DE 0ENHOpT ONT LIVRm EN LE
PAQUEBOT ,AFAYETTE DOTm DE QUATRE MOTEURS $IESEL -!. D´UNE PUISSANCE TOTALE DE CV
# DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE La transmission par engrenages réducteurs est envisagée comme sur le
Super LutetiaPDLVOHEUXLWHQJHQGUpQ·HVWSDVDGPLVVLEOHVHORQ0+RPEHUJ
TXLYHXWXQDSSDUHLOVLOHQFLHX['·DSUqVOHVDIÀUPDWLRQVGH03LQF]RQ, le
bruit des engrenages du Cap Arcona est audible seulement dans le local maFKLQH0/pY\ rappelle alors que pour le Super Lutetia, aucun constructeur
n’a voulu s’engager sur ce point et que le navire n’a été accepté que sous
réserve qu’il ne présenterait aucune gêne pour les passagers.
La discussion se poursuit sur le choix de l’appareil évaporatoire. M. RomanopFDUWHOHVFKDXGLqUHVjWXEHVG·HDXHQDSSX\DQWVRQDUJXPHQWDLUH
VXUOHQLYHDXGHTXDOLÀFDWLRQGHVRQSHUVRQQHOTXLHVWGH©TXDOLWpLQIpULHXUHHWEHDXFRXSPRLQVGLVFLSOLQpTXHFHOXLGHODPDULQHPLOLWDLUHª.
Il estime que le service intensif qui va être demandé ne correspond pas à
l’utilisation qu’en fait la marine militaire, et qu’il ne dispose ni du temps
ni de l’argent nécessaire pour les réparations et les retubages. Il traduit
XQDUWLFOHGH©7UDQVDFWLRQRI1DYDOVDUFKLWHFWVªR0$XVWLQVXSHULQtendant de la White Star Line, discute de l’emploi des chaudières à tubes
d’eau. L’emploi de la chauffe au charbon sur des chaudières à tubes doit
rWUHSURVFULWSRXUOHV©OLQHUVªHWODFKDXIIHDXPD]RXWHVWSRVVLEOHVHXOHPHQWHQD\DQWODSRVVLELOLWpG·DYRLUGHO·HDXGLVWLOOpH
6LOHVSDUWLFLSDQWVVHPHWWHQWG·DFFRUGVXUFHTXHYLHQWG·DIÀUPHU05Rmano, une controverse technique apparaît cependant.
Tout d’abord le chantier fait état qu’il s’agit de chauffer au mazout, et
cela à des taux de combustion bien inférieurs à ceux de la marine militaire,
ce qui est de nature à assurer une stabilité et une sécurité de fonctionnement. Le chantier, qui a une expérience du personnel militaire mis à sa
disposition lors des essais du PrimauguetFRQWHVWHO·DIÀUPDWLRQGH05RmanoDXVXMHWGHVRQSHUVRQQHOSHXTXDOLÀp
La polémique continue et M. Romano évoque les problèmes des chaudières du Berengaria, du Majestic et du Mauretania. Le chantier lui oppose
le Bremen et l’Europa. M. RomanoVHPpÀHGHVQRXYHDXWpVHWSHQVH©TX·HQ
SUDWLTXHOHVQDYLUHVTXLSRXUUDLHQWPDUFKHUHQVXUFKDXIIHQ·HQSURÀWHQW
que peu car ils se bornent à marcher à la vapeur sèche33ª
0+RPEHUJ clôt la controverse en demandant au chantier d’étudier
quatre solutions
D&KDXGLqUHVjYDSHXUVDWXUpHGHW\SH3UXGKRQ&DSXV ;
E&KDXGLqUHVF\OLQGULTXHVjYDSHXUVXUFKDXIIpH
0ROCnSVERBAL DE LA CONFmRENCE DU DmCEMBRE P BIS
)BIDEM P ,ES PLANS DE CES QUATRE PROJETS LUI SERONT ENVOYmS LE JANVIER AVEC DEUX TABLEAUX COMPARATIFS DES DEVIS
DE POIDS EN PROPULSION mLECTRIQUE ,´UN AVEC DES CHAUDInRES 0RUDHON#APUS g VAPEUR SATURmE NmCESSITANT UNE
COQUE DE M DE LONG L´AUTRE AVEC CHAUDInRES MULTITUBULAIRES ET TROIS CHAUDInRES CYLINDRIQUES LOGmES
DANS UNE COQUE DE M DE LONG
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL F &KDXGLqUHV GH W\SH 3UXGKRQ&DSXV avec surchauffeurs indépendants ;
d) Chaudières à tubes d’eau en accord avec les conditions techniques
énoncées par M. Romano.
/HSRLQWVXLYDQWpYRTXHODSURSXOVLRQpOHFWULTXHGRQW0/pY\ déclare
qu’elle est la seule solution à retenir, au point de vue du bruit, bien que
ce soit une solution vraisemblablement lourde. De plus, il ne possède pas
GHGRFXPHQWDWLRQOXLSHUPHWWDQWGHIDLUHXQSURMHWGLJQHGHFRQÀDQFH,O
faudrait une longue étude en collaboration avec des spécialistes électriciens. Il rappelle que, déjà, pour l’Île-de-France, faute de références sérieuses pour un aussi grand navire, la propulsion électrique avait été écartée.
Cette propulsion électrique a bien reçu des applications récentes sur des
paquebotsmais aucun n’a la puissance envisagée du Super Île-de-France.
,OSRXUVXLWDLQVL©&·HVWGRQFVHODQFHUGDQVXQHH[WUDSRODWLRQDXGDFLHXVH
et ce, d’autant plus que l’expérience d’une longue exploitation fera encore
défaut pendant quelques années et qu’elle est nécessaire pour émettre un
avis ferme. La question de la longévité des isolants se pose sans qu’aucune
UpSRQVHQ·DLWpWpIDLWHMXVTX·LFLjVDFRQQDLVVDQFH,O\DOjXQHLQFRQQXH
UHGRXWDEOHª
0+RPEHUJ rappelle qu’il s’était personnellement opposé à la propulsion électrique pour l’Île-de-France©QHYRXODQWG·XQHQRXYHDXWpQ·D\DQW
pas la sanction de l’expérience. Il lui apparaît… que l’on est dans la même
LQFHUWLWXGHǻ
/RUVGHODFO{WXUHGHODFRQIpUHQFH0+RPEHUJFRQÀUPHOHVGLPHQVLRQV
la vitesse et le nombre de passagers du navire ainsi que les solutions d’appareils moteur et évaporatoire à étudier par le chantier. M. Romano ajoute
WRXWHIRLVTX·LOVHUDLWERQG·DWWHQGUHMXVTX·HQVHSWHPEUHOHVUpVXOWDWV
du Bremen, de l’Europa et du Président Dal Piaz pour décider d’un appareil
moteur. Les représentants du chantier font observer que cela n’autorisera
aucun retard dans les études pour permettre une livraison en 1933.
DmCEMBRE L´EXAMEN DE LA PROPULSION mLECTRIQUE
Au cours de cette réunion, les représentants37 du constructeur de
matériel électrique, la Cie Thomson+RXVWRQ, ceux du chantier et de la
&*7 vont examiner comment une installation de propulsion électrique
)L FAIT SANS DOUTE ALLUSION AUX PAQUEBOTS AMmRICAINS DE CV #ALIFORNIA ET 6IRGINIA DATANT DE ET )L FAUT TOUTEFOIS NOTER QUE LES NAVIRES DE GUERRE AMmRICAINS 3ARATOGA ET Lexington LANCmS EN DISPOSENT DE
CV FOURNIS PAR QUATRE PAIRES DE MOTEURS ASYNCHRONES
)BIDEM P ,A #IE 4HOMSON(OUSTON A ENVOYm -- #HARPENTIER 'RIVEAU ET SON DIRECTEUR DE SERVICE COMMERCIAL - 3UET
LES CHANTIERS -- ,mVY ET -AROGER ET LA #'4 -- "RILLIm 2OMANO ET -ARTIN DU 0ONT
# DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE GHFKFKLIIUHLQGLTXpSDU0/pY\, pourrait être implantée dans
XQHFRTXHGRQWOHGpSODFHPHQWHVWGHO·RUGUHGHW0%ULOOLpD\DQW
GpFODUpTXHFHWWHSXLVVDQFHVHUDLWSUREDEOHPHQWLQVXIÀVDQWHOD7KRPVRQ+RXVWRQSURSRVHG·pWXGLHUWUqVODUJHPHQWO·DSSDUHLOPRWHXU
Le premier avant-projet de la Thomson+RXVWRQ donne les disposiWLRQVVXLYDQWHVHQSDUWDQWGHO·DUULqUH
²TXDWUHOLJQHVG·DUEUHVD\DQWFKDFXQHGHX[PRWHXUV
– quatre turboalternateurs38 disposés si possible dans la même tranche
transversale ;
²GHVWXUERG\QDPRVGHVWLQpHVjO·DOLPHQWDWLRQGXERUGHWOHVWDEOHDX[
de distribution des auxiliaires ;
²GHVFKDXGLqUHVDYHFVXUFKDXIIHHWWLPEUpHVjNJ39 sur l’avant.
M. Charpentier est partisan de l’adoption du courant alternatif à « bas
YROWDJHªSRXUWRXVOHVDSSDUHLOVGHERUGQHQpFHVVLWDQWSDVGHYDULDWLRQ
de vitesse. Seuls les treuils et guindeaux seraient alimentés en courant
continu à intensité constante.
'DQV VD QRWH LQWLWXOpH © 3URMHW G·pOHFWULÀFDWLRQ G·XQ SDTXHERW ª GX
MDQYLHUO·$OVWKRP lève un certain nombre d’interrogations à proSRVGHODÀDELOLWpGHVDSSDUHLOVpOHFWULTXHVHWGHVFRQWUDLQWHVSDUWLFXOLqUHV
à l’appareil propulsif électrique. Le chantier est d’accord avec l’Alsthom
sur l’augmentation de poids de 700 t par rapport à une propulsion par
engrenages. La rigidité de l’arrière du navire doit être moindre, car le raccourcissement des arbres et le jeu longitudinal autorisé par les moteurs
pOHFWULTXHV SHUPHWWHQW GH OHYHU O·XQH GHV JURVVHV GLIÀFXOWpV UHQFRQWUpHV
avec les engrenages, à savoir une précision importante pour les paliers des
butées d’hélices.
M. Detoeuf a transmis à M. Brillié toutes les informations relatives à
la tenue des isolants du matériel américains et anglais.
#ES TURBOALTERNATEURS ALIMENTENT LES MOTEURS SYNCHRONES DE PROPULSION
,E TIMBRE EST LA PRESSION AUTORISmE DANS UNE CHAUDInRE )L S´AGIT BIEN ENTENDU DE L´ANCIENNE UNITm EN KGCMß
QUE NOUS NOTERIONS DE NOS JOURS EN "AR .OUS AVONS VOLONTAIREMENT LAISSm DANS LE TEXTE LES ANCIENNES UNITmS
DE PRESSION QUI SONT ENCORE AUJOURD´HUI COMPRmHENSIBLES
,ES MOTEURS g COURANT CONTINU SE PRoTENT FACILEMENT g LA VARIATION DE VITESSE CAR CELLECI EST DmPENDANTE DE
LA TENSION D´ALIMENTATION DE L´INDUIT ET DU COURANT D´EXCITATION PARCOURANT SON SES INDUCTEURS 0OUR LES
MOTEURS g COURANT ALTERNATIF LA VARIATION DE VITESSE EST LImE g LA VARIATION DE LA FRmQUENCE DE LEUR ALIMENTATION
CE QUI EST BEAUCOUP PLUS COMPLEXE g RmALISER
0ROJET D´mLECTRI½CATION D´UN PAQUEBOT ¯ /BSERVATIONS SUR LES NOTES PRISES PAR - $ETOEUF g LA SUITE DE LA VISITE DE
- &OULD. P %N L´!LSTHOM A RmALISm L´EXTENSION DE LA CENTRALE DE 'ENNEVILLIERS AVEC UNE NOUVELLE CHAUFFERIE ET GROUPES TURBOALTERNATEURS DE K7 3ON EXPmRIENCE INDUSTRIELLE LUI PERMET D´ABORDER CE PROJET 4 AVEC
CON½ANCE #´EST UN PROJET IMPORTANT SUR LE PLAN INDUSTRIEL MAIS AUSSI UNE BELLE RmFmRENCE PUBLICITAIRE
$IRECTEUR GmNmRAL DE L´!LSTHOM
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL JANVIER LA #'4 SE DmCLARE FAVORABLE g LA PROPULSION mLECTRIQUE
0+RPEHUJDQQRQFHTXHOHSRLQWGHYXHGHOD&*7 a évolué en faveur
de la propulsion électrique à la lumière des renseignements qui lui ont été
adressés par M. Brillié. Il reconnaît que la propulsion électrique de l’Île-deFrance avait été proche d’être adoptée, mais qu’il n’avait pas les références qu’il possède aujourd’hui. De plus, les rapports sur la manœuvrabilité
des navires à propulsion électrique sont si probants qu’il se déclare prêt
jO·HVVD\HU/D:KLWH6WDU/LQH aurait fait le choix de la propulsion électrique pour équiper son prochain navire. De toute façon, conclue-t-il dans
son introduction, que ce soit à propulsion turboélectrique ou à turbines
à engrenages, aucune turbine marine de cette puissance n’a jamais été
construite.
0/pY\ se déclare prêt à construire un navire à propulsion électrique
ou à turbines à engrenages. Dans les deux cas, il n’existe pas dans la marine marchande de navire d’une puissance aussi importante. La marine
militaire possède aussi bien en France qu’en Angleterre des transmissions
à engrenages d’une puissance plus élevée, alors que la marine américaine
fait naviguer des bâtiments à propulsion électrique d’une puissance comparable. De fait, les expériences sont les mêmes et les « risques peuvent être
courus » des deux côtés.
0+RPEHUJYLHQWjGpFODUHUTXHVLO·RQUHWHQDLWODWKqVHGH0/pY\, le
choix de la propulsion électrique était fait compte tenu de ses avantages.
M. Fould,OXLSUpFLVHTX·LO\DXUDXQHPDMRUDWLRQGHSUL[FRQVLGpUDEOH
de l’ordre de vingt à vingt-cinq millions, et que l’avantage réel en terme
d’économie d’exploitation courante n’est pas complètement démontré,
et il souhaite avoir un accord sur les chiffres avancés par les rapports.
0/pY\ explique que l’économie réalisable dans une propulsion électrique tient surtout au fait que les turbines tournent dans le même sens avec
une meilleure qualité de vapeur liée à une grande surchauffe.
Cela revient à dire que le choix d’une solution dépend de l’appareil
évaporatoire retenu. Pour conclure son intervention, M. Brillié déclare
qu’il est « persuadé que sur l’Atlantique, pour un navire de l’importance de France ou Paris, par mauvais temps les variations (de puissance)
GRLYHQWDWWHLQGUH/DFRQVRPPDWLRQGHYDSHXUSHXWrWUHUpGXLWH
GHª
#ETTE INFORMATION EST CON½RMmE PAR ,ORD +YLSANT EN AVRIL ¦ ,E 6ICE 2OY OF )NDIA PAQUEBOT g PROPULSION
mLECTRIQUE POUR LA ±0/² § IN "ULLETIN 4ECHNIQUE 6mRITAS .€ AVRIL P 0ROCnSVERBAL CONFmRENCE DU JANVIER P ,ES PORTEAVIONS ,EXINGTON #6 ET LE 3ARATOGA #6 DISPOSENT D´UNE PUISSANCE DE CH .OTONS QUE LE
PREMIER PORTEAVIONS AMmRICAIN LE ,ANGLEY #6 EST LE PREMIER NAVIRE g PROPULSION mLECTRIQUE DE HAUTE MER )L
EST LANCm EN COMME CHARBONNIER LE *UPITER
0ROCnSVERBAL DE LA CONFmRENCE DU JANVIER P # DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE M. Romano intervient en disant qu’il a cherché en vain les économies
qu’un navire à propulsion électrique procure. De plus selon lui, les résultats obtenus aux essais ne diffèrent pas beaucoup de ceux obtenus pendant
d’exploitation. Ce qui est contesté par M. Brillié, qui lui rétorque qu’on ne
SHXWSDVOHVPHVXUHU/DFRQYHUVDWLRQV·HQOLVHXQSHXHW0/pY\ dit qu’il
faut faire les expériences sur le même bateau avec la même qualité de vaSHXUHWODPrPHSXLVVDQFH/HUHQGHPHQWJOREDOpOHFWULTXHHVWGH,
aussi est-il nécessaire que « le rendement de la turbine permette de gagner
GDYDQWDJH ª 0 GH &DWDODQR FLWH O·H[HPSOH GHV EDWHDX[ GH W GHV
transports maritimes qui consomment seize tonnes à dix nœuds. Pourquoi
l’économie réalisée sur ces navires ne se retrouverait-elle pas sur ceux que
O·RQFRQVWUXLW"0+RPEHUJ reprend la parole en déclarant que l’on peut
LPDJLQHUTX·LOQ·\DSDVG·pFRQRPLHHWTXHSHUVRQQHQHVRXWLHQWTXHOD
SURSXOVLRQpOHFWULTXHVRLWSOXVFKqUHTX·XQHDXWUHDXVVLQ·\DXUDLWLOSDV
avantage à la choisir, notamment pour des raisons de manœuvrabilité du
QDYLUHO·HQWUpHGXSRUWGX+DYUHHVWGpMjVLGpOLFDWHSRXUOHVQDYLUHVH[LVWDQWV3RXU0/pY\O·DSSDUHLOGHSURSXOVLRQpOHFWULTXHHVWSOXVORXUGHW
plus encombrant que celui à turbines à engrenages, aussi demande-t-il à
FHTXHOHFKRL[GpÀQLWLIVRLWSURFKDLQHPHQWDUUrWp0+RPEHUJVRXKDLWH
attendre le résultat des essais du Vice Roy of India avant d’entamer les
calculs et la détermination de la forme.
M. Romano fait remarquer que les projets d’appareils évaporatoires remis par le chantier lui paraissent trop faibles, voire impossibles à réaliser
DYHF OHV GLPHQVLRQV HQYLVDJpHV 2U OH QDYLUH GRLW PDUFKHU j YLQJWKXLW
nœuds avec des chaudières en réserve. Compte tenu de l’expérience de
OD&*7, il déconseille l’emploi de chaudières tubulaires, contrairement à
M. Martin du Pont.
0+RPEHUJKpVLWHFDUVHVLQJpQLHXUVHWVHVPpFDQLFLHQVQHFRQQDLVVHQWSDVFHV\VWqPH0/pY\Q·HVWSDVFHUWDLQTXHO·HPSORLGHFKDXGLqUHV
lourdes, même avec surchauffe, puisse permettre au navire d’atteindre
vingt-huit nœuds, ce qui remet en cause toute l’économie d’exploitation
de ce navire. M. de Catalano se demande si l’allongement du bateau ne
VHUDLWSDVXQHVROXWLRQ,OHVWUpSRQGXj0/pY\TXHO·XWLOLVDWLRQG·XQQDvire à vingt-sept nœuds est impossible, car il est prévu une rotation tous
les quatorze jours.
,E RENDEMENT DE LA SOLUTION g ENGRENAGES EST DE SELON - $ET®UF
)L S´AGIT D´)PANEMA ET 'UARUJA DE LA 3'4-6
#E PAQUEBOT BRITANNIQUE DE M DE LONG ET DE M DE LARGEUR EST PROPULSm PAR DEUX MOTEURS DE CH
,´APPAREIL mVAPORATOIRE EST COMPOSm DE SIX CHAUDInRES 9ARROW g TUBES D´EAU TIMBRmES g KG €# ALIMEN
TANT DEUX TURBOALTERNATEURS DE K7
- ,mVY EST PARTISAN DES CHAUDInRES g PETITS TUBES VERTICAUX COMME IL EST NOTm DANS LE RAPPORT 0ROJET D´mLEC
TRI½CATION D´UN PAQUEBOT ¯ /BSERVATIONS SUR LES NOTES PRISES PAR - $ET®UF g LA SUITE DE LA VISITE DE - &OULD.
P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL 0 +RPEHUJ À[H OHV GLPHQVLRQV GX QDYLUH P HQ SUpFLVDQW TXH
c’est une longueur minimale, 11 m de tirant d’eau et 33,7 m de large.
/H MDQYLHU 0 /pY\ UDSSHOOH GDQV XQ FRXUULHU FRQÀGHQWLHO
DGUHVVpDXGLUHFWHXUGHV&KDQWLHUVGX3HQKRsW que M. Romano admet le
changement d’hélices, pour passer de la marche d’été à pleine puissance à
la marche d’hiver à demi puissance.
/HGLUHFWHXUJpQpUDOGHV$WHOLHUVHW&KDQWLHUVGX3HQKRsW à Paris adresse alors à son président la note suivante, qui résume bien l’état du projet
jODÀQIpYULHU
« L’opinion que nous exprimons ci-après résulte d’un examen objectif des études entreprises jusqu’ici pour déterminer les caractéristiques
du Super Île-de-France. Elle ne tient aucun compte de ce qui peut être
considéré comme l’intérêt du chantier. Il paraît du reste nécessaire de faire
remarquer ici que depuis la décision qui a été prise de construire une nouYHOOH FDOH GH FRQVWUXFWLRQ OH FKDQWLHU D OHV PR\HQV GH IDLUH GHV QDYLUHV
SOXVJUDQGVTXHPqWUHVTXHOHVVHXOHVVXMpWLRQVH[LVWDQWHVj6DLQW1Dzaire sont relatives aux tirants d’eau et qu’il n’est en tout cas pas question
de dépasser onze mètres de tirant d’eau à pleine charge ; que le chantier
serait bien plus tranquille si l’on décidait l’adoption de chaudières Prudhon-Capus à vapeur saturée si l’on emploie des chaudières à tubes d’eau
KDXWHSUHVVLRQHWVXUFKDXIIHTXLVRQWG·XQGHVW\SHVTX·LOQ·DSDVH[pFXWp
jusqu’ici pour la marine de commerce. La seule réserve que j’ai à faire
au sujet des dimensions du navire est relative aux délais de construction.
3RXUXQQDYLUHGHPGHORQJGRQWOHFRQWUDWVHUDLWVLJQpHQRFWREUH
HWLOQ·\DSDVXQHPLQXWHjSHUGUHSRXUUpDOLVHUFHWWHGDWHQRXV
SRXUULRQVSUHQGUHO·HQJDJHPHQWGHOHOLYUHUDX+DYUHHVVDLVWHUPLQpVOH
1er DYULO6LOHQDYLUHDPGHORQJQRXVVHURQVREOLJpVGHUHSRUWHU
cette date au 1er PDLV·LODjPGHORQJFHWWHGDWHVHUDSRUWpHDX
1er juin 1933ª
,% #(/)8 $% ,´!00!2%), -/4%52
$X GpEXW GX PRLV GH PDUV OHV ELODQV WHFKQLTXHV V·pWDEOLVVHQW
DLQVL
La solution avec des turbines à engrenages et des chaudières Babcock
:LOFR[ a un appareil évaporatoire plus lourd de 870 t que celui des
FKDXGLqUHV3HQKRsW mais son appareil moteur est plus léger de 780 t, ce
qui donne, à 90 t près, le même poids que celui de la propulsion électrique
DYHFGHVFKDXGLqUHV3HQKRsW.
.OTE DU DIRECTEUR GmNmRAL DES !TELIERS ET #HANTIERS DU 0ENHOpT g 0ARIS AU 0RmSIDENT FmVRIER # DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE /DVROXWLRQDYHFGHVWXUELQHVjHQJUHQDJHVHWGHVFKDXGLqUHV3HQKRsW
qui est de loin la plus légère, n’est pas retenue, car les conditions de stabilité et de navigabilité du navire deviennent alors critiques.
Deux des quatre solutions avec des turboalternateurs imposent une
ORQJXHXUGHPSRXUXQGpSODFHPHQWGHjWORUVTXHOHFLUFXLW
YDSHXU HVW j YDSHXU VDWXUpH WUHQWH FKDXGLqUHV 3UXG·KRQ &DSXV NJ
/HVGHX[DXWUHVVROXWLRQVTXLGHPDQGHQWXQHORQJXHXUGHPSRXUXQ
GpSODFHPHQWGHWHQYLURQIRQWDSSHOjXQHQVHPEOHGHFKDXGLqUHV
WLPEUpHVjNJDYHFVXUFKDXIIHjƒ&WUHQWHQHXIFKDXGLqUHV%DEFRFN
RXWUHQWHTXDWUHGHW\SH3HQKRsW
/HV LQJpQLHXUV UHWLHQQHQW OD ORQJXHXU GH P TXL SHUPHW VRLW GH
disposer plus facilement l’appareil propulsif, soit d’augmenter le volume
pour assurer une meilleure répartition du fret, et assurer ainsi une bonne
stabilité au navire.
06XHWHW0&KDUSHQWLHUGHO·$OVWKRPWUDQVPHWWHQWj0/pY\ les réVXOWDWVFRQÀGHQWLHOVGHVFRQVRPPDWLRQVGpWDLOOpHVGHVSUHPLHUHWVHFRQG
YR\DJHVGXSDTXHERWDPpULFDLQVirginia et les courbes de consommation
du Vice Roy of India . Ce dernier s’adresse alors au directeur du chantier
GH3HQKRsW en lui faisant remarquer que les consommations prévues par
l’AlsthomOXLVHPEOHQW©H[WUrPHPHQWUpGXLWHVªHWLOOXLGHPDQGHV·LOHVW
MXGLFLHX[GHOHVFRPPXQLTXHUjOD&*7.
/HPDLOD&(0DGUHVVHGHX[QRWHVDXFKDQWLHUGH3HQKRsW. La
première détaille les caractéristiques de la propulsion électrique que propose la CEM. Ce devis fait état de quatre turboalternateurs pour un poids
XQLWDLUHGHWHWKXLWPRWHXUVGHSURSXOVLRQG·XQSRLGVXQLWDLUHGHW
VRLWWSRXUODWUDQVPLVVLRQpOHFWULTXH
/DVHFRQGHQRWHH[SOLTXHOHVDYDQWDJHVGHFHW\SHGHPRWHXU©&RPPH
PDFKLQH V\QFKURQH OH PRWHXU SHXW GpYHORSSHU SHQGDQW OH IUHLQDJH OD
IUpTXHQFHUpGXLWHGHSpULRGHVSDUVHFRQGHOHSOHLQPRPHQWGHWRUVLRQ
HQDEVRUEDQWXQFRXUDQWG·LQWHQVLWpGRXEOHRXGXPRPHQWGHWRUVLRQ
maximum avec une fois et demie la valeur de l’intensitéª
/HMXLQHQYXHGHSUpSDUHUODFRQIpUHQFHGXMXLQTXLGRLW
décider de la solution retenue pour l’appareil évaporatoire, le directeur du
FKDQWLHU j 6DLQW1D]DLUH HQYRLH XQ WDEOHDX FRPSDUDWLI GHV SURSRVLWLRQV
GHVGHX[VRFLpWpVj0/pY\.
L’Alsthom propose, contrairement à la CEM, une marche à allure économique où deux alternateurs alimentent les quatre lignes d’arbres. Les
caractéristiques techniques sont très proches. Elles marquent l’état de l’art
G·XQHLQVWDOODWLRQpOHFWULTXHGHJUDQGHSXLVVDQFHHQ
.OTE AU SUJET DE PAQUEBOT g PROPULSION, #%- MAI .OTE AU SUJET DES MOTEURS mLECTRIQUES DE PROPULSION ASYNCHRONES SYNCHRONISmS #%- MAI P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL ,A CONFmRENCE DU JUIN CH
POUR UNE COQUE DE PLUS DE M DE LONG
/D&*7HVWUHSUpVHQWpHSDU00+RPEHUJHWOHFKDQWLHUGH3HQKRsW
par M. Fould.
/HVGpEDWVV·HQJDJHQWVXUODIRUPHHWODORQJXHXUGHODFRTXH0/pY\
GRQQHXQHORQJXHXUGHPHQWUHSHUSHQGLFXODLUHVHWPKRUVWRXW
/HQDYLUHGpSDVVHODWDLOOHV\PEROLTXHGHVSLHGVFHTXLVDWLVIDLWOHV
UHSUpVHQWDQWV GH OD &*7. M. Tillier résume les principales caractéristiTXHVXQHFRTXHVDQVEXOEHXQDUULqUHGHW\SHFURLVHXUXQHFRQVRPPDWLRQG·HDXSRXUPDFKLQHVHWHPPpQDJHPHQWVVXIÀVDQWHXQHUpVHUYHGH
PD]RXWGHXQHFDOHSRXYDQWFRQWHQLUVRL[DQWHYRLWXUHVHWP3
GHPDUFKDQGLVHV7RXWFHFLDERXWLWjXQGpSODFHPHQWGHWFHTXL
FRQYLHQWjOD&*7TXLYRXODLWXQGpSODFHPHQWVXSpULHXUjW
0+RPEHUJ aborde le point suivant qui concerne l’appareil moteur et
pYDSRUDWRLUH0/pY\UDSSHOOHTX·LOIDXWFKSRXUDWWHLQGUHYLQJW
huit nœuds. Le chantier prévoit un appareil moteur capable de délivrer
jFK/HVFRQVRPPDWLRQVVRQWHVWLPpHVjWjYLQJWKXLW
Q±XGVHWFK/DVXUIDFHGHFKDXIIHHVWGHPòDORUVTXHWKpRULTXHPHQWPòVRQWVXIÀVDQWV
M. Tillier UpVXPH OHV SDUDPqWUHV GH OD SXLVVDQFH © FK WKpRULTXHV FK HQ PDUFKH FRXUDQWH SRXYDQW DOOHU MXVTX·j XWLOLVHU
FKHWGHPDUJHSRXUOHVFKDXGLqUHVª
0/pY\ annonce qu’il a reçu une étude complète de l’Alsthom concerQDQWODSURSXOVLRQpOHFWULTXH,ODMRXWHTX·LOQ·HVWSDVÀ[pVXUODTXHVWLRQ
des turbines et qu’il ne retiendra « une solution que complètement d’accord avec l’AlsthomDXSRLQWGHYXHGHVUHVSRQVDELOLWpVª Ces propos
LQTXLqWHQWXQSHXOHVUHSUpVHQWDQWVGHOD&*7 qui souhaitent une garantie
complète du chantier. M. Fould précise que le chantier ne fait pas de turbines Curtis,HW0/pY\ conclut en annonçant que le chantier prendra la
solution la plus avantageuse pour le navire. La conférence s’achève par la
GpÀQLWLRQG·XQFDOHQGULHU
'HX[MRXUVSOXVWDUGOHGLUHFWHXUGXFKDQWLHUGH3HQKRsW adresse un
courrier à l’AlsthomTXLOXLGHPDQGH
– de ne plus prévoir des alternateurs pouvant fonctionner avec une
VXUFKDUJHHQFRQWLQXSXLVTXHTXHOD&*7 envisage un changement d’hélices pour la marche d’hiver ;
)BIDEM P )BIDEM P #OURRIER DU CHANTIER DE 0ENHOpT g L´!LSTHOM JUIN # DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE – de lui indiquer la réduction de poids, d’encombrement et de valeur
que cela entraîne ;
²GHSUpYRLUO·DXJPHQWDWLRQGHODYLWHVVHGHVDOWHUQDWHXUVDÀQG·HQGLminuer l’encombrement ;
– de prévoir une augmentation du nombre de pôles des moteurs, saFKDQWTXHOHGLDPqWUHPD[LPDOQHGRLWSDVGpSDVVHUP
²G·pWDEOLUDYDQWOHMXLOOHWXQHVSpFLÀFDWLRQGpWDLOOpHGHWRXWHODWUDQVmission électrique de manière à constituer un élément de base pour la
remise de prix.
Les études se poursuivent chez Asthom, l’Électro-Mécanique, le chanWLHUGH3HQKRsWHWOD&*7.
­ODÀQGXPRLVG·RFWREUHXQHUpXQLRQSRXUGpWHUPLQHUOHW\SH
de turbines à retenir est organisée avec les représentants de ces quatre sociétés. Il s’agit en fait de trouver un consensus « de telle manière à ce que
la solution adoptée ne puisse être considérée comme imposée ni aux uns
ni aux autresª
M. Romano,GHOD&*7, déclare qu’à moins d’une absolue nécessité de
mettre à bord des turbines Curtis, il préfère les turbines Parsons. En effet,
OD&*7 utilise des turbines Parsons sur ses principaux paquebots transatlantiques FranceParisÎle-de-France«
M. Charpentier de l’Alsthom, expert en turbines, lui explique qu’il
V·DJLWSOXW{WGHWXUELQHV%URZQ%RYHUL.
M. Vasset de l’Électro-Mécanique ajoute qu’il s’agit d’une adaptation
GHVWXUELQHV%URZQ%RYHUL comme turbines marines. Il déclare que cela ne
lui pose aucun problème car il a, en la matière, une grande expérience.
0/DPEHUWGXFKDQWLHUGH3HQKRsWVXUO·LQYLWDWLRQGH0/pY\, son directeur, expose les arguments techniques en faveur de la turbine Parsons,
et conclue que les plans Alsthom ne sont pas très étudiés au point de vue
d’une installation marine.
M. Bommelair, qui pilote la délégation Alsthom, fait remarquer qu’il
V·DSSXLH VXU O·H[SpULHQFH GH OD *(& pour présenter ses plans. M. Lambert maintient ses propos et assure que l’application des plans présentés
par l’Alsthom aurait une application marine défectueuse. La discussion
s’enlise dans des considérations techniques. Aussi après avoir consulté en
DSDUWp 0 %RPPHODLU © 0 /pY\ déclare que les discussions techniques
ne peuvent guère conduire à un résultat et qu’il est nécessaire de voir la
question sous un autre jour. Le but à atteindre étant d’obtenir un succès
FRPSOHWLOHVWQpFHVVDLUHGHV·HQUDSSRUWHUjO·H[SpULHQFHGHOD*(&ª
0AQUEBOT 4 COMPTE RENDU DE LA RmUNION DU OCTOBRE 4URBINE DE CONCEPTION '%#
0AQUEBOT 4 COMPTE RENDU DE LA RmUNION DU OCTOBRE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL /D*(& a en effet une très grande expérience puisqu’elle a équipé quatre-vingt-dix navires en propulsion électrique. La délégation Alsthom fait
remarquer que dans une propulsion électrique, il n’est pas possible de dissocier le problème de la vapeur et le problème électrique. Elle s’interroge
DXVVLVXUODGLIÀFXOWpGHGpWHUPLQHUODUHVSRQVDELOLWpHQFDVGHYLEUDWLRQV
si les turbines sont livrées par la CEM et les alternateurs et moteurs par
l’Alsthom.
)LQDOHPHQW DXFXQH GpFLVLRQ Q·HVW SULVH HW LO HVW FRQYHQX G·HQYR\HU
un ingénieur en Amérique de façon à examiner les deux solutions, et voir
DYHF*(&VLO·HPSORLGHWXUELQHV3DUVRQVSUpFRQLVpSDUOD&*7 et le chantier, peut être retenu.
'HQRPEUHX[pFKDQJHVHQWUH$OVWKRPHWOHVFKDQWLHUVGH3HQKRsWYRQW
peu à peu préciser les caractéristiques de la propulsion électrique. Les inIRUPDWLRQVTXH0%ULOOLpDUpFROWpHVDXFRXUVGHVDPLVVLRQFKH]*(&YRQW
être décisives.
Le premier semestre 1930 est marqué par une absence de décision imSRUWDQWHGHODSDUWGHOD&*7HWXQHLQTXLpWXGHJUDQGLVVDQWHDX[FKDQWLHUVGH3HQKRsW
/HMXLOOHWOHGLUHFWHXUGXFKDQWLHUGH3HQKRsW annonce à l’AlsthomGH%HOIRUWTXHODSURSXOVLRQpOHFWULTXHHVWGpÀQLWLYHPHQWDGRSWpH
SRXUOHQDYLUH©7ª,OOXLGHPDQGHGH©PHWWUHDXSRLQWGDQVOHSOXVEUHI
GpODLOHVSODQVG·LQVWDOODWLRQJpQpUDOHDLQVLTXHOHVVSpFLÀFDWLRQVHWPDUchésª,OSURSRVHXQRUGUHGXMRXUSRXUXQHFRQIpUHQFHTXLVHWLHQGUDLW
GHSUpIpUHQFHj6DLQW1D]DLUH/HVSRLQWVVXLYDQWVVHUDLHQWDERUGpV
– examen du rapport de visite de M. Lambert, sous-directeur du chanWLHUjOD*(&6FKHQHFWDG\
– diminution de la longueur des groupes avec la même puissance ;
– consommation pour la marche avec deux alternateurs et quatre moWHXUVG·KpOLFHFKVDFKDQWTXHODSXLVVDQFHHQVHUYLFHHVWSRUWpHj
FKHWODSXLVVDQFHPD[LPDOHjFKHWTX·LOQ·HVWSOXVTXHVtion de changer les hélices ;
– bases de collaboration entre le chantier et l’Alsthom au sujet de l’exécution de certaines parties de l’appareil moteur.
,E ER AO}T LA PUISSANCE PASSE g CH
Le chantier et l’Alsthom examinent différents points concernant l’apSDUHLOSURSXOVLIHWQRWDPPHQWOHQRPEUHGHURXHVDX[WXUELQHV+3HW%3
,E NOMBRE DE PxLES DES ALTERNATEURS PASSE g QUATRE CE QUI ½XE LA VITESSE DES TURBINES
¦ 4 § PAQUEBOT POUR LA LIGNE DE .EW 9ORK ¯ !PPAREIL DE PROPULSION mLECTRIQUE JUILLET ,A CONSOMMATION INDIQUmE PAR L´!LSTHOM SEMBLE FAIBLE PAR RAPPORT g CELLE ENREGISTRmE SUR LE 6ICE 2OY OF )NDIA
# DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE La puissance maximale de l’appareil propulsif atteint maintenant
FKjWUPLQHQYLURQ&RPSWHWHQXGHO·DXJPHQWDWLRQGHYLtesse de la turbine, le nombre de pôles du moteur est porté à quarante, ce
qui donne un rapport de réduction de 10. Le diamètre des moteurs d’hélice ne change pas, suite à une légère diminution du pas polaire, mais la
longueur s’accroît de 10 cm.
/·DSSDUHLOSURSXOVLIFRPSOHWSqVHWFHTXLHVWLQIpULHXUGHWDX[
anciennes prévisions.
/H QRXYHDX ELODQ GH FRQVRPPDWLRQ j FK IDLW DSSDUDvWUH XQH
FRQVRPPDWLRQGHPD]RXWGHJFKK
/HFKDQWLHUGHPDQGHXQHVLPSOLÀFDWLRQGHVSRVVLELOLWpVGHFRXSODJHHQWUH
les alternateurs et les moteurs, et propose de « coupler chacun des groupes
générateurs avec l’un quelconque des moteurs d’hélice du même bordª
/DWHQVLRQHVWSRUWpHGHj9VXUOHVUHFRPPDQGDWLRQVGHOD
*(&.
Il est convenu que ce matériel sera entièrement construit par l’Alsthom,
et testé avant sa livraison par chemin de fer.
,E AO}T L´!LSTHOM REMPORTE LA COMMANDE
0+RPEHUJ attend les observations de M. Romano, mais il annonce
VDQV SOXV DWWHQGUH © 9RXV FRPPDQGHUH] j$OVWKRP qui est le seul qui
puisse le faire.ª
/HV FDUDFWpULVWLTXHV GH OD SURSXOVLRQ pOHFWULTXH VRQW GpÀQLWLYHPHQW
À[pHVDXFRXUVGHFHPRLVG·DR€WFHSHQGDQWO·DXJPHQWDWLRQGHSUL[
de l’Alsthom YD HQJHQGUHU GHV WHQVLRQV HQWUH OH FKDQWLHU j 6DLQW1D]DLUH HW O·XVLQH j %HOIRUW /H RFWREUH O·LQWHUYHQWLRQ SHUVRQQHOOH GH
M. Detœuf, directeur général d’Alsthom et de son homologue du chantier,
0/pY\ règle certains points du litige et le 3 novembre, une nouvelle proposition commerciale est signée.
/HGpFHPEUHDSUqVDYRLUYDLQHPHQWWHQWpG·REWHQLUXQHFRPmande ferme avant le 1er décembre, l’Alsthom annonce que ses « délais
sont majorés d’un nombre de semaine égal compris entre le 1er décembre
et la date de la commandeª /HGpFHPEUH0/pY\, s’étonne du comSRUWHPHQWGHODGLUHFWLRQGHOD&*7HQFHVWHUPHV©4XRLTXHQRXVQH
puissions comprendre les raisons que vous invoquez pour différer la com
4 PROPULSION mLECTRIQUE 1UESTIONS EXAMINmES AU COURS DE LA RmUNION AVEC L´!LSTHOM DU ER AO}T g 0ARIS
P #ONFmRENCE DU AO}T P #OURRIER DE L´!LSTHOM g L´ADMINISTRATEUR $' DES #HANTIERS ET !TELIERS DU 0ENHOpT NOVEMBRE ,ETTRE CON½DENTIELLE DE - $ET®UF DE L´!LSTHOM AU CHANTIER DE 0ENHOpT DmCEMBRE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL mande à passer à l’Alsthom, nous ne pouvons que nous incliner devant
votre décisionª,OO·LQIRUPHGXUHWDUGSUREDEOHGHODOLYUDLVRQMXVTX·LFL
À[pHDXDYULO
/HMDQYLHUO·DFFRUGWDQWDWWHQGXSDUO·$OVWKRPHVWFRQÀUPpSDUOH
FKDQWLHUGH3HQKRsW.
$X FRXUV GH OD VHPDLQH VXLYDQWH OH FKDQWLHU GX 3HQKRsW qui a reçu
« la commande d’un paquebot à construire pour la Compagnie générale
transatlantique, sous-traite à Als-Thom, une partie du matériel destiné
à l’appareil moteurª
Le chantier débute la construction de la coque quatre jours plus tard, en
posant la première tôle de la quille sur la nouvelle cale.
#/.#,53)/.
,A PROPULSION mLECTRIQUE DU .ORMANDIE
UNE AFFAIRE DE GRANDES SOCImTmS
Deux groupes industriels, la CEM d’une part et l’Alsthom d’autre part,
sont mis en concurrence pour le marché de propulsion électrique du Normandie 6DXWWHU+DUOp 30( GH O·LQGXVWULH pOHFWULTXH SRXUWDQW SLRQQLqUH
de la propulsion électrique en France, ne répond pas à l’appel d’offres, car
elle n’a pas la capacité industrielle pour produire des installations d’une
DXVVLJUDQGHSXLVVDQFH,OQ·\DDXFXQGRXWHjODOHFWXUHGHVUDSSRUWVTXH
O·DFFRUGJpQpUDODYHFOD*(&GRQWDKpULWpO·$OVWKRPDODUJHPHQWEpQpÀFLp
à cette dernière société au détriment de la CEM. En facilitant les transferts
GHWHFKQRORJLHJUkFHjXQHFLUFXODWLRQG·LQIRUPDWLRQVUDSSRUWVYR\DJHV
d’ingénieurs)HQWUHOD*(&RX%ULWLVK7KRPVRQGHX[VRFLpWpVD\DQWFRQoX
et réalisé des propulsions électriques navales et Alsthom, l’accord indusWULHO*(&$OVWKRPDMRXpSOHLQHPHQWVRQU{OH
/DFULVHGHV·LQVWDOOHHQ)UDQFHHWODVLWXDWLRQGHVHQWUHSULVHVGHYLHQWFULWLTXH/D&*7TXLMXVTXHOjHQJUDQJHDLWGHVEpQpÀFHVHVWODUJHPHQWWRXFKpH/HVFKDQWLHUVGH3HQKRsWSRXVVHQWOHXUSDUWHQDLUHHQGLIÀFXOWpjFRQFOXUHO·DIIDLUH/D&*7REWLHQWGHVVXEVLGHVGXJRXYHUQHPHQW
et devient une société d’économie mixte. Ainsi la construction du « T6 »
peut continuer.
Pour l’Alsthom, qui obtient la signature du marché du Normandie en
MDQYLHULOV·DJLWG·XQHERXIIpHG·R[\JqQH/HVGLULJHDQWVGHO·$OVWKRP
- ,mVY DmCEMBRE #ONTRAT ENTRE 0ENHOpT ET !LSTHOM POUR LA FOURNITURE DE MATmRIEL DESTINm g L´APPAREIL DE PROPULSION mLECTRIQUE
DU PAQUEBOT ¦ 4 § !RTICLE ¯ /BJET DU CONTRAT 0ARIS JANVIER # DE 2%#)43 0ROPULSION mLECTRIQUE !LSTHOM DU PAQUEBOT .ORMANDIE ont su prévoir des clauses de sauvegarde des prix sur le coût des matières
premières et des salaires. Surtout, cette commande est loin d’être aussi
anodine que l’est généralement la partie électrique d’un marché de navire.
Par la puissance des équipements commandés, il s’agit bien de fournir une
JURVVHXVLQHpOHFWULTXHFOpHQPDLQ1RXVVRPPHVELHQGDQVXQHDXWUHGLmension de capacité industrielle que celle habituellement rencontrée dans
OHFDKLHUGHVFKDUJHVSRUWDQWVXUO·pOHFWULÀFDWLRQG·XQQDYLUH
%NTRE INNOVATION ET HmRITAGE
La propulsion du Normandie est à la fois classique et innovante70.
,VVXHG·XQHWHFKQRORJLHUpFHQWHjODÀQGHVDQQpHVODSURSXOVLRQ
électrique vient directement concurrencer le monopole de la turbine directe ou à engrenages acquis trente ans auparavant. Certes, d’autres très
grands navires, notamment des porte-avions américains, l’utilisent, mais
son emploi dans un Liner est une innovation car il s’agit de traverser à
vive allure l’Atlantique chaque semaine, navigation requérant à la fois des
performances en vitesse et en endurance.
Paradoxalement, une partie de l’appareil propulsif a peu évolué. Il
V·DJLWGHVFKDXGLqUHVSRXUOHVTXHOOHVOD&*7DWRXMRXUVOLPLWpODSUHVVLRQ
HWV·HQHVWWHQXDXPRGqOHGHW\SH3HQKRsW qui fonctionne sur le Champlain. Ce souci de sécurité de fonctionnement n’a pas permis d’atteindre
les performances des chaudières industrielles, en particulier celles des usines électriques et il est certain qu’un choix plus audacieux, et sans pour
autant risqué dans le choix de l’appareil évaporatoire, lui aurait donné des
performances encore supérieures.
5NE SYNTHnSE DES TECHNIQUES OCCIDENTALES
6LOD)UDQFHSHXWrWUHOpJLWLPHPHQWÀqUHGXWUDYDLOG·XQHPXOWLWXGHGH
ses entreprises, un certain nombre d’équipements ont été fabriqués sous
OLFHQFHDPpULFDLQH*(&RXLPSRUWpV71. De même, une grande partie des
pWXGHVGHFDUqQHVDpWpFRQÀpHDX[$OOHPDQGV qui avaient déjà appliqué
des innovations majeures sur les paquebots Bremen et Europa73. Cet apport
VFLHQWLÀTXHLPSRUWDQWDpWpYRORQWDLUHPHQWJRPPpSDUO·KLVWRLUHTXLDW-
0ASCAL 2OBERT (ISTOIRE DES TECHNIQUES mLECTRIQUES EMPLOYmES SUR LES NAVIRES CIVILS AU 8)8E ET AU DmBUT DU 88E SInCLE
THnSE DE DOCTORAT EN (ISTOIRE DES TECHNIQUES UNIVERSITm DE .ANTES P ,ES GROSSES PInCES DE FONDERIE MnCHE DE GOUVERNAIL SUPPORT D´ARBRE D´HmLICE VIENNENT DES USINES TCHnQUES
3KODA L´ACIER AU SILICIUM POUR LES MOTEURS mLECTRIQUES ET ALTERNATEURS ARRIVE D´!LLEMAGNE¨
%T NOTAMMENT AU $R +EMPF DIRECTEUR DU BASSIN DES CARnNES DE (AMBOURG
#ES PREMIERS PAQUEBOTS g BULBE D´mTRAVE SONT DmTENTEURS DU 2UBAN BLEU EN ET 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2/"%24 0ASCAL WULEXHO·HQWLqUHSDWHUQLWpGHODFRTXHjO·LQJpQLHXUUXVVH<RXUNHYLWFK. Le
©JpQLHIUDQoDLVªGHVFKDQWLHUVGH3HQKRsWHWG·$OVWKRPHVWG·DYRLUUpXVVL
à produire et à assembler les techniques au sommet de l’état de l’art pour
en faire le plus performant paquebot transatlantique de son époque.
6LADIMIR 9OURKEVITCH A TRAVAILLm POUR LES CHANTIERS DE LA 3OCImTm ANONYME DES USINES FRANCORUSSES g 3AINT
0mTERSBOURG AVANT D´mMIGRER EN EN 4URQUIE PUIS EN &RANCE )L SERA RECOMMANDm AUX #HANTIERS DE 0EN
HOpT PAR SON COMPATRIOTE LE VICEAMIRAL FRANlAIS 0OGULAIEV ANCIEN CHEF D´mTATMAJOR DE LA ¾OTTE RUSSE DE
MER .OIRE )L REJOINT LES bTATS5NIS EN # DE 2%#)43 ,A CONGmLATION DU THON ,A CONGmLATION DU THON UNE ½LInRE TECHNIQUE EMBARQUmE
bTIENNE $ELAIRE
).42/$5#4)/.
De tout temps, la conservation des denrées périssables a été un souci.
/HVSUHPLHUVPR\HQVGHFRQVHUYDWLRQpWDLHQWOHVDODJHHWOHIXPDJHPDLV
au XIXe siècle, de nouveaux procédés ont vu le jour, fruit de l’ère pastorienne qui a mis en évidence le rôle majeur des micro-organismes dans
l’apparition des maladies d’une part, mais aussi dans la conservation des
aliments. À travers les découvertes empiriques de traitement des denrées
DOLPHQWDLUHVVDODJHGHVVLFFDWLRQMXVTX·DX[GpFRXYHUWHVVFLHQWLÀTXHVGX
XIXe siècle, s’est mise en place une logique de la conservation des denrées
qui a trouvé son expression la plus aboutie dans la chaîne du froid.
"REF HISTORIQUE DE LA CONSERVE DU THON EN &RANCE
&HWWHLQGXVWULHIRUWDQFLHQQHHQ)UDQFHSXLVTXHF·HVWj*URL[TXHGqV
1871, on fait les premières conserves à l’huile) commence à rencontrer de
UpHOVSUREOqPHVGDQVOHVDQQpHVLQWHQVLÀpVSHQGDQWOHVDQQpHVSpriode au cours de laquelle on constate une baisse constante des apports liée
au caractère saisonnier de cette pêche et à l’évolution des bateaux thoniers.
Le désarmement progressif des voiliers et l’affectation des navires à
PRWHXUjODSrFKHDXFKDOXWSOXVLQWpUHVVDQWHÀQDQFLqUHPHQWHQWUDvQH
une diminution de moitié de la production des principaux ports thoniers
HQWUHHWHWFHPRXYHPHQWVHPEOHGHYRLUV·DFFHQWXHUDYHFODGLVparition inéluctable des cinquante derniers thoniers à voile.
$ÀQG·DUUrWHUFHGpFOLQO·LQVWLWXWVFLHQWLÀTXHHWWHFKQLTXHGHVSrFKHV
PDULWLPHVHQWUHSUHQGGqVODUHFKHUFKHGHQRXYHDX[OLHX[GHSrFKH
et une carte portant les dates et positions des captures faites en juin par
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE le Président Théodore-Tissier1, est distribuée avec un grand succès aux pêFKHXUVHQHWSDUO·LQWHUPpGLDLUHGHODUHYXHLa Pêche Maritime.
,´mVOLUTION APRnS LA 0REMInRE 'UERRE MONDIALE
SUR LES CxTES FRANlAISES
-XVTXHGDQVOHVDQQpHVODSrFKHDXWKRQJHUPRQHVWIDLWHSUHVTXH
exclusivement par des voiliers, les pêcheurs français allant chercher les
EDQFVGHWKRQVjXQHGLVWDQFHG·HQYLURQjPLOOHV2QSHXWV·DWWHQdre, dans de telles conditions, à ce que tous les voiliers soient munis d’un
PR\HQGHFRQVHUYDWLRQGXSRLVVRQRULOQ·HQHVWULHQ3. Le thon, après avoir
pWpVRLJQHXVHPHQWYLGpHWODYpHVWSHQGXSDUODTXHXHjGHVEDUUHVÀ[pHV
sur le pont où on se contente de l’abriter du soleil et de la pluie par une
bâche (au mieux imperméable quand elle est neuve !).
2QSHXWDLQVLHVWLPHUSRXUGHVUDLVRQVGHFRQVHUYDWLRQLPSURSUHjSUqV
GHOHVSHUWHVGHSRLVVRQVSrFKpVHWUHMHWpVHQPHU&HWWHSHUWHHVWGRXEOHSHUWHSRXUOHVPDULQVG·DERUGPDLVSHUWHpJDOHPHQWSRXUOHVRXYULqUHVGHVXVLQHVTXLVRQWREOLJpHVGHFK{PHUQ·D\DQWSDVGHPDWLqUHVSUHPLqres à leur disposition. C’est ainsi que pendant le premier mois de pêche de
O·DQQpHSUqVGHGHVWKRQVSrFKpVRQWG€rWUHUHMHWpVjODPHU.
Pour améliorer le rendement de ces sorties, la Société technique pour
l’industrieSURFqGHDXGpEXWGHO·DQQpHjO·LQVWDOODWLRQG·XQHPDFKLQHIULJRULÀTXHHWjO·DPpQDJHPHQWG·XQHFDOHLVROpHjERUGGXWKRQLHU
Minahouet. La STPI s’est attachée à démontrer que la conservation du thon
par le froid sec est possible et qu’en outre les machines nécessaires à cette
installation sont, premièrement, d’un encombrement très réduit, deuxièPHPHQW SHXYHQW rWUH FRQÀpHV DX[ SrFKHXUV DSUqV XQ DSSUHQWLVVDJH GH
quelques jours seulement. Les conditions de fonctionnement en mer sont
particulièrement dures. Les températures de l’air extérieur et de l’eau de
mer sont souvent très élevées. La pêche est irrégulière et l’emplacement
'RhCE g UN CRmDIT DE NEUF MILLIONS ATTRIBUm AU MINISTnRE DE LA -ARINE PAR LA LOI SUR LE DmVELOPPEMENT DE
L´OUTILLAGE NATIONAL LA CONSTRUCTION DE CE NAVIRE SPmCIAL PEUT oTRE ENTREPRISE g PARTIR DE ,ES INSTALLATIONS
FRIGORI½QUES SONT PARTICULInREMENT IMPORTANTES g BORD DE CE NAVIRE ET COMPRENNENT ENTRE AUTRES UN BAC g
AUBES TOURNANTES POUR LA CONGmLATION IMMmDIATE DU POISSON g LA SORTIE MoME DES ½LETS ,E POISSON CONGELm
EST ENSUITE STOCKm DANS DES CHAMBRES FROIDES OU SONT mTUDImES LES MEILLEURES MmTHODES DE CONSERVATION TANT
EN CE QUI CONCERNE LES TEMPmRATURES QUE LES PROCmDmS DE REFROIDISSEMENT
,A REVUE ,A 0oCHE -ARITIME EST NmE DES PRmOCCUPATIONS DU GOUVERNEMENT PENDANT L´ANNmE /N CRAIGNAIT
ALORS UNE FAMINE EN &RANCE ET NATURELLEMENT ON PENSA g LA MER COMME SOURCE INmPUISABLE DE NOURRITURE
#´EST EN QUE 'EORGES 'ARREAU FUT SOLLICITm PAR - +ERZONCUF ALORS DIRECTEUR DES PoCHES MARITIMES AU
HAUTCOMMISSARIAT g LA MARINE MARCHANDE ET AUX PoCHES PRmSIDm PAR - &ERNAND "UISSON A½N DE FONDER UN
JOURNAL DESTINm AUX ACTEURS DE LA ½LInRE DES PoCHES MARITIMES DANS LE BUT DE DmVELOPPER LA CONSOMMATION
DU POISSON DE MER EN &RANCE
!LBERT "RONKHORST -ANUEL DU PATRON g LA PoCHE 0ARIS 3OCImTm bDITIONS COLONIALES P !NONYME "ULLETIN MENSUEL DES !FFAIRES -ARITIMES P 340) RUE DE 0ROVENCE g 0ARIS
# DE 2%#)43 ,A CONGmLATION DU THON pour les machines très restreint. Pour éviter l’augmentation du personnel
à bord, l’installation doit être conduite par un des pêcheurs qui n’a aucune
FRQQDLVVDQFHPpFDQLTXH'HSOXVGqVTXH©OHWKRQGRQQHªOHPDWHORW
abandonne la machine pour la pêche. Il faut donc que la machine puisse
tourner avec une surveillance très réduite.
/DPDFKLQHIULJRULÀTXHLQVWDOOpHVXUOHMinahouet est d’une puissance
GHIULJRULHVKHXUHjƒ&)RXUQLHSDUOD6RFLpWpQRXYHOOHGXIURLG
industrielOHFRPSUHVVHXUGHW\SHURWDWLIjFKORUXUHG·pWK\OHHVWPRQWp
sur un bâti de bois au-dessus d’un moteur à deux temps fonctionnant au
pétrole, avec démarrage et arrêt à l’essence.
Ce moteur développe une puissance de trois chevaux et demi. La partie mécanique de l’installation est placée dans la cabine arrière et complètement séparée de la chambre froide par une cloison isolée, le long de
laquelle est posé le frigorifère à détente directe. L’air aspiré au milieu du
frigorifère est refoulé, après refroidissement, par deux gaines d’air qui
sont placées dans des cloisons latérales.
/HVWKRQVVRQWVXVSHQGXVGDQVODFDOHDXQRPEUHGHjDXPD[LPXPSRXUXQHFDSDFLWpGHFKDPEUHGHP3.
Les essais effectués ont montré la valeur technique des machines installées ainsi que l’excellence du procédé de conservation du thon7 par l’emploi du froid sec à une température supérieure à 0°C. Le bateau rentre en
HIIHW OH DR€W DYHF XQH SrFKH FRQVHUYpH HQ SDUIDLW pWDW GDQV XQH
chambre froide pendant plus d’une semaine. Certains thons ont même
quinze jours de conservation. D’autre part, la consommation du moteur
HQWUDvQDQWO·LQVWDOODWLRQIULJRULÀTXHDpWpWURXYpHUHODWLYHPHQWIDLEOH(OOH
V·HVWpOHYpHjHQYLURQOLWUHVGHSpWUROHHWHQYLURQOLWUHVG·HVVHQFH
pour une pêche de trois semaines8.
5NE INSTALLATION ARTISANALE ,E THONIER +REBS
L’introduction du froid mécanique à bord d’un thonier à voile
pose d’abord, comme on l’a vu, le problème de l’embarquement d’un
mécanicien spécialisé. L’autre raison pour laquelle une installation
frigorifique à bord d’un voilier est délicate à faire accepter, est son
prix ; la valeur de l’installation complète étant tout à fait disproportionnée par rapport à celle du bateau. Pour répondre à toutes ces
!NDRm &AURE ¦ ,A CONSERVATION DU POISSON g BORD DES CHALUTIERS § DANS ,A 2EVUE GmNmRALE DU FROID MAI P !NONYME SANS TITRE DANS ,A 2EVUE GmNmRALE DU FROID OCTOBRE P !NONYME SANS TITRE DANS ,A 2EVUE GmNmRALE DU FROID LOC CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE TXHVWLRQV OH SURFpGp EUHYHWp .UHEV HW $OOLRW V·pFDUWH GHV VROXWLRQV
mises en œuvre sur des bateaux plus importants 9.
En 1931 cette installation fut réalisée à bord du thonier Rospico.
La cale centrale du navire est divisée longitudinalement en trois
compartiments ; les deux latéraux, plus spacieux, sont aménagés en
chambres froides, le compartiment central en bac à glace. Les cloisons
qui séparent le bac à glace des chambres sont munies en haut et en bas
d’ouvertures longitudinales réglables. L’air au contact de la glace se refroidit, descendant l’espace libre entre la cloison et la glace, pénètre dans
les chambres par les ouvertures longitudinales inférieures. Il refoule vers
le haut un air plus chaud et moins dense qui vient ainsi au contact de la
glace grâce aux ouvertures longitudinales supérieures, se refroidit à son
WRXUHWOHF\FOHUHFRPPHQFHLQGpÀQLPHQWWDQWTXHO·DLUGHODFDOHHVWVHQsiblement plus chaud que la glace.
Cette circulation qui s’active à chaque ouverture des panneaux pour
l’introduction des poissons, puis se ralentit progressivement, maintient
l’air des chambres à une température constante. L’air au contact de la glace
condense sur celle-ci une grande partie de la vapeur d’eau qu’il contient.
À chaque introduction de poissons dans la cale, sa température s’élève,
VDFDSDFLWpK\JURPpWULTXHDXJPHQWHHWLOVqFKHGHFHIDLWODVXUIDFHGHV
SRLVVRQV2QREWLHQWDORUVXQHDWPRVSKqUHVqFKHH[FHOOHQWHSRXUODERQQH
FRQVHUYDWLRQGXSRLVVRQVDQVWRXWHIRLVTX·LO\DLWGHVVLFFDWLRQGHVFKDLUV
la vitesse du courant d’air étant très faible.
Ce procédé de conservation ne nécessite aucune augmentation de
l’équipage ni aucun opérateur spécialisé10. Son prix de revient est peu élevé11, son fonctionnement très simple, automatique et sans aucune panne
SRVVLEOH (QÀQ LO DVVXUH XQH ERQQH FRQVHUYDWLRQ GX SRLVVRQ j O·DEUL GH
brusques changements dus aux conditions atmosphériques.
Une résistance à l’innovation apparut de la part des pêcheurs. S’ils apportaient plus de poissons, le prix ne baisserait-il pas ?
(QQRYHPEUHj&RQFDUQHDXVXUXQHÁRWWHGHFHQWTXDUDQWHFLQT
dundees thoniers sans moteur, dix-huit sont pourvus de chambres froides.
(QWUHHWVRQWHQFRUHFRQVWUXLWVGHVGXQGHHVWKRQLHUVVDQVFKDPEUHIURLGH7RXWHIRLVRQQRWHXQHOpJqUHPRGLÀFDWLRQDSSRUWpHDXJDEDULW
du thonier, permettant un emplacement rationnel pour le moteur de
PDQLqUHjSRXYRLUHPSOR\HUGHVDSSDUHLOVUpIULJpUDQWV .
"REVET .€ $ISPOSITIF POUR LE MAINTIEN D´UNE TEMPmRATURE CONSTANTE DE CHAMBRES FROIDES ,OUIS +REBS
ET (ENRI !LLIOT -AURICE 0IETTRE #ONSERVATION PAR LE FROID DES DENRmES D´ORIGINE CARNmE 0ARIS ,IBRAIRIE *" "AILLn
RE ET ½LS P ET -ICHEL "OURY ¦ ,E FROID APPLIQUm g LA CONSERVATION DU POISSON § DANS ,A 2EVUE GmNmRALE DU FROID AVRIL P 0IERRE #OLIN ¦ ,´mVOLUTION DE L´ARMEMENT THONIER§ DANS ,A PoCHE MARITIME ET MAI P #HARLES 2OBERT-ULLER 0oCHES ET PoCHEURS DE LA "RETAGNE ATLANTIQUE 0ARIS ,IBRAIRIE !RMAND #OLIN P # DE 2%#)43 ,A CONGmLATION DU THON &KDUOHV 5REHUW 0XOOHU pFULW GDQV VD WKqVH © 8Q DXWUH SURFpGp DYDLW
été également étudié pour rapporter rapidement les thons au port. Les
dundees thoniers auraient continué de pêcher à voile, et une embarcation
à moteur aurait fait uniquement la navette entre les lieux de pêche et les
ports, ramenant à terre des poissons pêchés et, en sens inverse, de raviWDLOOHU DX EHVRLQ OHV EDWHDX[ SrFKHXUV &H V\VWqPH DXUDLW HX O·DYDQWDJH
de permettre aux thoniers, après la rencontre d’un banc de poissons, de
continuer leur pêche au lieu d’avoir à rechercher le banc qu’ils ont dû
abandonner pour revenir à terre. De plus, le thonier qui, pendant les seize
VHPDLQHVTXHGXUHODFDPSDJQHHWOHVVHSWjKXLWYR\DJHVTX·HOOHOXLSHUPHWGHIDLUHQHSrFKHHIIHFWLYHPHQWTXHSHQGDQWjMRXUVSRXUUDLWGH
ODVRUWHSrFKHUFRQWLQXHOOHPHQWDYHFSOXVGHSURÀW13ª
*UkFH j OD JpQpUDOLVDWLRQ GX SURFpGp .UHEV HW$OOLRW GDQV OHV DQQpHV
1930, Concarneau put jouer un rôle primordial dans le marché breton, voiUHIUDQoDLVHWPrPHHXURSpHQGXWKRQ,O\DYDLWXQJUDQGQRPEUHG·XVLnes de conserves, une trentaine autour de la ville, permettant l’absorption
de grandes quantités de poisson.
Cette innovation, bien qu’artisanale, et sans doute parce qu’artisanale,
rencontra un grand succès dans le milieu thonier de la Bretagne sud, permettant après la guerre l’intégration de la technique de congélation à bord
du thon, importée des États-Unis, et ainsi donc la possibilité d’aller pêcher
au large de la Mauritanie.
,E THON EN !FRIQUE APRnS La pêche française sur les côtes d’Afrique avant 1914
La première tentative de conservation par congélation eut lieu à
Marseille en 1878 où se fonda une société, « La marée des deux monGHVªUHSUHQDQWOHVGURLWVGHOD©&RPSDJQLHGH3rFKHULHVIUDQoDLVHV
de l’île d’Arguin ªTXLDYDLWXQGRXEOHREMHFWLIDOOHUFKHUFKHUFKDTXHSULQWHPSVGDQVODEDLHG·+XGVRQXQFKDUJHPHQWGHVDXPRQVHW
le rapporter en France « dans un appareil frigorifique ªSXLVFKDOXter sur les bancs d’Arguin.
#HARLES 2OBERT-ULLER 0oCHES ET PoCHEURS DE LA "RETAGNE ATLANTIQUE LOC CIT P *EAN 0IERRE #HAUVEAU ¦ (ISTOIRE DE LA PoCHE INDUSTRIELLE AU 3mNmGAL ET POLITIQUES D´INDUSTRIALISATION § DANS
#AHIER 3CIENCES (UMAINES /RSTOM P !NONYME SANS TITRE DANS ,A 2EVUE GmNmRALE DU FROID AVRIL P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE &HWWHVRFLpWpHQYR\DOHYDSHXUStella Maris, muni d’appareils frigorifiques V\VWqPH&DUUp 17, pêcher entre les Canaries et le Sénégal.
(QODVRFLpWpG·DOLPHQWDWLRQ©OH7ULGHQWªpJDOHPHQWGH0DUseille, installa la première usine de congélation à Dakar.
En 1908, les chalutiers à vapeur le Rorqual et la Baleine, construits par les
chantiers de MM. J.T. Eltringham and Co, de South Shields (Angleterre)
SRXUOD&RPSDJQLHGHV3rFKHULHVGX*ROIHGH*DVFRJQH$UFDFKRQHQtrent en service. Un modèle réduit du RorqualÀJXUHjO·H[SRVLWLRQIUDQFR
britannique de Londres de 190818.
(QOD&RPSDJQLHGHV3rFKHULHVGX*ROIHGH*DVFRJQH19 possède
trois chalutiers munis de cale réfrigérée et faisant la pêche sur les côtes du
Maroc. Le Rorqual et la BaleineHPSORLHQWO·DPPRQLDFFRPPHÁXLGHUpIULgérant, tandis que le BélugaXWLOLVHOHGLR[\GHGHFDUERQH
Le navire la Baleine s’échoua sur les côtes d’Afrique en 1911, tandis que
le RorqualIXWUHYHQGXHQDX[SrFKHULHV'HOSLHUUHDUPDWHXUj%RXORJQHTXLV·HPSUHVVHQWDORUVGHGpPRQWHUO·LQVWDOODWLRQIULJRULÀTXHSRXU
UpFXSpUHUGXYROXPHGDQVOHVFDOHVO·pSDLVVHXUGHO·LVRODWLRQHWOHVWX\DXteries de froid occupant une place assez importante.
,OHVWTXHVWLRQGqVGHFUpHUXQSRUWGHSrFKHLQGXVWULHOOHj3RUW
Étienne auquel sont intéressés les armateurs boulonnais et arcachonnais,
et où seraient installées des unités de poisson séché et organisée la pêche
langoustière.
0DLVDORUVTXHO·DGPLQLVWUDWLRQHWOHVVFLHQWLÀTXHVSHQVDLHQWjODJUDQde pêche industrielle motorisée pour développer l’exploitation des côtes africaines, ce sont des petits patrons-pêcheurs bretons, à bord de leurs
dundées à voile, qui vont prendre les devants. Tout autant que les primes et encouragements à la pêche sur les côtes occidentales d’Afrique,
distribués à partir de 1909 et surtout 1911, la crise économique et sociale
qui frappe les pêcheurs bretons est à l’origine de cette nouvelle phase.
&HWWHFULVHDWWHLQWVRQSDUR[\VPH YHUVHWGpFRXOHGHGHX[IDFWHXUV
2OGER 0LANK ¦ $ATES COMMmMORATIVES DE L´INVENTION DES MACHINES FRIGORI½QUES UNE CONTRIBUTION g L´HISTOIRE
DU FROID § !NNEXES AU BULLETIN DE L´INSTITUT INTERNATIONAL DU FROID AO}T P &ERDINAND #ARRm ¦ ;¨= COMMENlA TRnS TxT SES ESSAIS DnS )L EMPLOYA D´ABORD COMME SUBSTAN
CE FRIGORIGnNE L´mTHER SULFURIQUE )L REPRENAIT EN CELA UNE EXPmRIENCE DUE AU PHYSICIEN mCOSSAIS *OHN ,ESLIE QUI
AVAIT MIS EN mVIDENCE L´ABSORPTION DE CHALEUR PROVOQUmE PAR L´mVAPORATION DE LA VAPEUR D´EAU SOUS LA CLOCHE
D´UNE POMPE PNEUMATIQUE § -AURICE $AUMAS (ISTOIRE GmNmRALE DES TECHNIQUES TOME ,ES TECHNIQUES DE LA
CIVILISATION INDUSTRIELLE ¯ mNERGIE ET MATmRIAUX 0ARIS 05& P bMILE ,EMAIRE ¦ ,A CONSERVATION DU POISSON FRAIS PAR LE FROID § DANS ,A 2EVUE GmNmRALE DU FROID FmVRIER P #ETTE SOCImTm LA PLUS PUISSANTE COMPAGNIE DE PoCHE EN &RANCE AVANT LA 'RANDE 'UERRE POSSnDE UNE ¾OTTE DE
VINGT CHALUTIERS g VAPEUR DONT CINQ DE TRnS GRAND TONNAGE g TONNEAUX
,A 3OCImTm INDUSTRIELLE DE LA 'RANDE 0oCHE EST CRmmE EN %N ELLE EMPLOIE DmJg PERSONNES g TERRE
ET TRAITE TOUTES LES CAPTURES DmBARQUmES g 0ORTbTIENNE SAUF LES LANGOUSTES EXPORTmES DIRECTEMENT VERS LA
&RANCE LES REQUINS ET UNE PARTIE DES COURBINES QUE LES #ANARIENS ENVOIENT VERS L´!RCHIPEL DES #ANARIES
&RANlOISE 0ENCALET+ERIVEL (ISTOIRE DE LA PoCHE LANGOUSTInRE 2ENNES 052 P # DE 2%#)43 ,A CONGmLATION DU THON HVVHQWLHOV G·XQH SDUW OD FRQFXUUHQFHLPSLWR\DEOHH[HUFpHSDUOHVDUmements de chalutiers à vapeur, à capitaux importants, détenus par de
grandes compagnies vis-à-vis des pêcheurs propriétaires de leurs bateaux ; d’autre part le dépeuplement, du fait de l’emploi par ces nouveaux
armements des redoutables chaluts, des zones de pêche européennes et
notamment celle de la sardine en Bretagne. Les grands armements capitalistes renforcent leur emprise dans les principaux ports français et ne
prêtent guère l’oreille à la propagande gouvernementale sur la pêche africaine. Au contraire, les artisans de la mer, pêcheurs voiliers traditionnels,
dont l’avenir en France s’annonce très sombre, tentent leur chance dans
la pêche coloniale
7DQGLVTXHOD6RFLpWpLQGXVWULHOOHGH*UDQGH3rFKHWHQWHHQGHUHdonner vie à la pêcherie industrielle de Port-Étienne, la société Pescada,
dont le siège social se trouve à Paris, est créée la même année à Dakar,
et se propose de sécher le poisson, de fabriquer de l’huile, de la farine,
GHODFROOHHWGHVHQJUDLV5HSULVHHQSDUVRQDJHQWGH'DNDUHOOHHQ
reste à un stade d’expérimentation. Le manque d’équipement de Dakar en
IULJRULÀTXHHWHQGLVSRVLWLIG·DYLWDLOOHPHQWUHQGYDLQVOHVDSSHOVGHVVSpFLDOLVWHVGHO·26730 qui s’intéressent à la pêche coloniale. La position
GHVLQGXVWULHOVHX[PrPHVHVWSOXVH[SOLFLWHSRXUHX[ODSrFKHYpULWDblement industrielle ne peut être immédiatement envisagée pour approvisionner les usines en l’absence d’infrastructures portuaires adéquates
et de prospections des ressources et des fonds qui ne peuvent être prises
en charge par l’initiative privée.
,´IN¾UENCE DES bTATS5NIS APRnS LA GUERRE -XVTX·HQ OH WKRQ SrFKp VXU OHV F{WHV GH &DOLIRUQLH HVW GX WKRQ
germon, dont la chair blanche est très appréciée dans tous les États-Unis.
Ce thon est pêché par quelques centaines de petits bateaux à essence, sur
XQEDQFG·HQYLURQPLOOHVGHORQJHWGHODUJHV·pWHQGDQWOHORQJGH
la côte de Californie jusqu’à Santa Barbara. Aucun mode de refroidissePHQWQ·HVWHPSOR\pOHSRLVVRQpWDQWVLPSOHPHQWVXVSHQGXVXUOHSRQWHW
OHVEDWHDX[UHVWHQWUDUHPHQWSOXVGHKHXUHVHQPHU/HVFRQGLWLRQVGH
pêche sont alors à peu près semblables à celles de beaucoup de ports français, de Saint-Jean-de-Luz à Concarneau. Cette industrie n’avait fait que
progresser pendant dix ans, lorsque subitement et sans raison apparente,
le germon disparut, menaçant de ruiner non seulement les pêcheurs,
.OUADHIBOU
/F½CE SCIENTI½QUE ET TECHNIQUE DES PoCHES MARITIMES QUI DEVIENDRA L´)&2%-%2
!NONYME SANS TITRE DANS ,A PoCHE MARITIME MARS P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE mais aussi les usines de conserves qui se trouvaient ainsi privées de maWLqUHVSUHPLqUHV2QGpFRXYUHDORUVXQHDXWUHHVSqFHOH©<HOORZ ILQ ª
à la chair légèrement rosée et bien acceptée par le public. L’habitat
de ce poisson, en revanche, ne commence qu’à 300 milles plus au sud, le
ORQJGHVF{WHVURFKHXVHVGHOD%DVVH&DOLIRUQLH(QOHVFKDQWLHUVGH
San Diego construisent un bateau de 110 pieds, l’Atlantic, destiné à pêcher
VXU FHV EDQFV pORLJQpV &H QDYLUH Q·D SDV GH PDFKLQH IULJRULÀTXH PDLV
emporte de la glace dans les cales, capable de contenir 130 tonnes de thon.
'HVGLIÀFXOWpVDSSDUDLVVHQWSULQFLSDOHPHQWGXHVjODIXVLRQGHODJODFH
GDQVFHVHDX[WUqVFKDXGHV/DFRQFOXVLRQHVWFODLUHO·DXJPHQWDWLRQGH
FDSDFLWpHWGHUD\RQG·DFWLRQGHVQDYLUHVGHSrFKHHVWOLPLWpHSDUO·LPSRVsibilité de ramener le poisson en bon état.
À cette époque également, se construit à San Diego un bateau destiné à
la pêche au thon, le Lois-SGHSLHGV&HEDWHDXH[WUrPHPHQWQRYDWHXU
puisqu’il est équipé du premier moteur Diesel mis à bord d’un bateau de
SrFKHHQ&DOLIRUQLHDpJDOHPHQWXQHPDFKLQHIULJRULÀTXHGHIULJRries par heure, actionnée par un moteur de voiture. Le froid est distribué
SDUPqWUHVGHWXEHVÀ[pVDXSODIRQGGHVFDOHV
2Q FRQVWUXLW HQ HW GH QRPEUHX[ FOLSSHUV FDSDEOHV G·DOOHU
pêcher à 3000 milles de leur port d’attache. Certains faisaient même des
YR\DJHVGHPLOOHVGXUDQWXQPRLV
(Q PR\HQQH OD SXLVVDQFH IULJRULÀTXH QpFHVVDLUH j XQ WKRQLHU GH
SLHGVHVWGHjIULJRULHVSDUKHXUH/HCity of San Diego, clipper
FRQVWUXLWHQDXQHORQJXHXUGHSLHGVHWXQHFDSDFLWpGHWRQQHV,OFRPSRUWHXQHPDFKLQHIULJRULÀTXHjDPPRQLDFGHIULJRULHV
SDUKHXUHHQWUDvQpHSDUXQPRWHXUpOHFWULTXHGHFY/HVFDOHVVRQWUHIURLGLHVSDUSOXVGHPqWUHVGHWX\DX[jGpWHQWHGLUHFWHG·DPPRQLDF
/HVEDFVjDSSkWVVRQWUDIUDvFKLVSDUPqWUHVGHWX\DX[JDOYDQLVpV
/HWHUPH©7XQD&OLSSHUªGpVLJQHFHQRXYHDXW\SHGHEDWHDX[DPpULFDLQV SrFKDQW OH WKRQ j O·DSSkW YLYDQW GDQV OH 3DFLÀTXH &H QDYLUH HVW
hautement spécialisé pour la pêche dans les régions tropicales et généUDOHPHQWjJUDQGHGLVWDQFHGHVRQSRUWG·DWWDFKH(QOHV3RUWXJDLV
SRVVqGHQWXQHERQQHSDUWLHGHODÁRWWHGHVTXHOTXHGHX[FHQWVFOLSSHUV
basés à San Diego, et constituent plus de la moitié des équipages. Cette
ÁRWWHOLYUHGHODSURGXFWLRQFDOLIRUQLHQQHGHWKRQTXLpWDLWG·HQYLURQ
WRQQHVHQ
La pratique de l’appât vivant qui s’est introduite en France puis en
(VSDJQHGHSXLVOD6HFRQGH*XHUUHDHQ(XURSHVHVRULJLQHVGDQVOHVvOHV
portugaises de l’Atlantique. À Madère et aux Açores, en effet, la pêche des
thons se pratique à la canne depuis fort longtemps, à bord d’embarcations
pontées ou demi-pontées de dix à quinze mètres de long, utilisant sar
# DE 2%#)43 ,A CONGmLATION DU THON dines, chinchards ou maquereaux comme appâts. Les premiers essais de
pêche à l’appât vivant aux États-Unis sont faits à San Diego, en Californie,
par des Portugais à bord de petites embarcations munies d’un simple vivier sur le pont. Le développement de cette pêche, dû à l’essor des usines
de conserves, conduit alors à accroître la taille des bateaux et des viviers,
puis à construire des logements pour l’équipage à l’avant du bateau, audessus du moteur.
,E 6ICTORINE "ERTIN SISTER SHIP DU 9OLANDE "ERTIN PREMIER ¦ 4UNA #LIPPER § g $AKAR
#ETTE SILHOUETTE NOUVELLE SUR LES CxTES D´!FRIQUE VA INSPIRER UNE GmNmRATION
DE BATEAUX ET DEPUIS LES ANNmES C´EST L´EXEMPLE AMmRICAIN QUI PRmVAUT
DANS LA CONCEPTION DES NAVIRES FRANlAIS ARMmS AU THON TROPICAL SOURCE *EAN .OCKIN
Cet accroissement du volume des viviers sur le pont – le poisson étant
conservé en glace en cale – se traduit par le chavirement de plusieurs bateaux, et ce n’est qu’avec le développement de la congélation du poisson
en saumure que la formule des clippers américains s’imposa. Ces bateaux,
GHjPqWUHVGHORQJXHXUPXQLVG·XQHLQVWDOODWLRQIULJRULÀTXHRQW
JpQpUDOHPHQW GL[ j TXDWRU]H KRPPHV j ERUG /H UD\RQ G·DFWLRQ GH FHV
navires peut atteindre 10 000 milles, permettant aux bateaux d’aller pêcher au-delà de l’équateur, et de rechercher le thon pendant presque toute
l’année, condition essentielle de leur rentabilité.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE &HTXLVXUSUHQGORUVTXHO·RQYRLWXQ©7XQD&OLSSHUªSRXUODSUHPLqUH
fois, c’est le contraste important entre son étrave généralement élancée et
sa poupe si lourdement chargée que l’eau est pratiquement au niveau de
toute la partie arrière du pont principal. Il en résulte qu’à pleine charge,
sur plus de la moitié de sa longueur, un clipper n’a pratiquement pas de
franc-bord et que, par faible roulis, l’eau entrant par les dalots circule sous
le caillebotis recouvrant le pont. Le mât médian, terminé par un nid-depie, et portant le mât de charge pour la manœuvre des embarcations vient
FRPSOpWHUFHWWHVLOKRXHWWHW\SLTXHGXFOLSSHU
La puissance du moteur atteint 800 à 900 chevaux pour des unités de
j PqWUHV HW GDQV OHV DQQpHV OH FKRL[ WHFKQRORJLTXH LUD YHUV
des moteurs rapides en V au détriment des moteurs lents, car permettant
de réduire l’espace occupé par la machine et de gagner ainsi de la place
pour la cargaison. Cette recherche de l’augmentation de la capacité de
transport, primordiale pour des bateaux allant pêcher à grande distance,
DPrPHFRQGXLWjHQYLVDJHUODVROXWLRQGLHVHOSURSXOVLRQpOHFWULTXHTXL
DO·DYDQWDJHVXSSOpPHQWDLUHGHVXSSULPHUOHVGLIÀFXOWpVG·DOLJQHPHQWGH
O·DUEUHG·KpOLFHVXUXQW\SHGHQDYLUHRFHWDUEUHDWWHLQWGHVGLPHQVLRQV
particulièrement importantes.
,A TECHNIQUE AMmRICAINE
(Q)UDQFHDX3D\VEDVTXHWRXWFRPPHQFHSDUXQHVRLUpHGHOH
PDL­%LDUULW]*DVWRQ3RPPHUHDXDUPDWHXUGH6RFRD, prononce une
conférence sur le thème des nouvelles techniques de pêche au thon adoptées par les Américains en Californie, la pêche au thon à la canne à l’appât
vivant.
©/HVHQWUHSUHQHXUVYR\DJHQWDXVVLSRXUOHXUSURSUHFRPSWHF·HVWXQH
pYLGHQFHPDLVHQFRUHSHXpWXGLpHª
Les conserveurs sont fortement organisés, et ont créé, dès 1918, le
&RPSWRLUIUDQoDLVGHO·LQGXVWULHGHVFRQVHUYHVDOLPHQWDLUHVOH&2),&$,
GRQW OH EXW HVW GH SODQLÀHU O·DFKDW FROOHFWLI GX SRLVVRQ HQ LQVWDXUDQW XQ
V\VWqPH GH UpSDUWLWLRQ GHV DSSRUWV DX[ GLIIpUHQWHV XVLQHV /H &2),&$
#IBOURE 0YRmNmES!TLANTIQUES
-ICHEL #OTTE ¦ #IRCULATION DE L´INFORMATION TECHNIQUE ET INNOVATION QUELQUES EXEMPLES § DANS ,E CULTU
RE DELLA TECNICA P DU MoME AUTEUR ±&ROM 4RADE TO )NDUSTRY 4HE )NDEPENDANT )NFORMATIVE
.ETWORKS OF %UROPEAN &IRMS %ARLY TH #² )#/. P !NONYME ¦ #ONSERVES DES PRODUITS DE LA PoCHE MARITIME § DANS !NONYME 2APPORT mCONOMIQUE .ANTES
#ONFmDmRATION FRANlAISE DE LA #ONSERVE P # DE 2%#)43 ,A CONGmLATION DU THON HVWWUqVLQWpUHVVpSDUOHVYR\DJHVWHFKQLTXHVjO·pWUDQJHUHWÀQDQFH des
échanges avec armateurs et conserveurs, en particulier américains.
Les conserveurs veulent également savoir comment les Américains
réussissent à conserver leur appât vivant à bord, quelquefois pendant pluVLHXUVVHPDLQHVHWHQYRLHQWHQO·DUPDWHXUFRQVHUYHXU$OEHUW(OLVVDOW
de Saint-Jean-de-Luz étudier la technique développée aux États-Unis.
'qVOHVXQVDSUqVOHVDXWUHVOHVWKRQLHUVOX]LHQV30 adoptent la technique de la pêche à la canne à l’appât vivant, et en l’espace de quelques
DQQpHVVHXOHPHQWODÁRWWLOOHFRPPHQFHjVHPRGHUQLVHUSRXUSUHQGUHXQH
DOOXUHVSpFLÀTXH2QDVVLVWHDORUVjXQHUHIRQWHRXELHQjXQDJUDQGLVVHment de plusieurs coques, pour accueillir les viviers, désormais encastrés
dans les bateaux, remplaçant ainsi les viviers de pont beaucoup plus encombrants et dangereux.
/HVWRQQHV GpEDUTXpHV SDU OHV /X]LHQV31 HQ QH VRQW FHSHQGDQWSDVVXIÀVDQWHVSRXUIDLUHYLYUHODÁRWWLOOHGHVVDUGLQLHUVWKRQLHUVHW
OD GLUHFWLRQ V\QGLFDOH FRRSpUDWLYH pPDQDWLRQ GX &2),&$ UHWLHQW DORUV
l’idée de pratiquer, durant l’hiver, la pêche au thon sur les côtes africaines
HQGpEXWDQWSDUFHOOHVGX0DURF(QTXHOTXHVUpXQLRQVGHWUDYDLORQW
OLHXDXVHLQGXFRPLWpORFDOGHVSrFKHVGH%D\RQQHHQFROODERUDWLRQDYHF
OH&2),&$HQYLVDJHDQWO·HQYRLGHGHX[EDWHDX[SRXUO·DQQpH
&·HVWpJDOHPHQWO·LGpHGHVFRQVHUYHXUVTXLFRQÀHQWDORUVXQHQRXYHOOH
PLVVLRQj$OEHUW(OLVVDOWDYHFXQRUGUHSUpFLV©'DQVOHFDVROHVWKRQLHUV
français, bretons ou basques, voudraient pratiquer la pêche dans ces parages, cela leur serait-il possible ? Quels ports pourraient les recevoir ? Leur
poisson pourrait-il être utilisé sur place ou entreposé et refroidi pour être
dirigé ensuite sur les usines françaises"ª
Albert Elissalt visite ainsi Port-Étienne33 en Mauritanie puis Dakar. En
FHWWHÀQF·HVWDYHF3RUWeWLHQQHSRXUWrWHGHSRQWTXHOHVFRQVHUYHXUV
français envisagent de développer leurs activités métropolitaines dès la
!LAIN 4ORQUAT 2APPORT SUR L´ACTIVITm DE L´INDUSTRIE DES CONSERVES DE POISSONS EN .ANTES #HAMBRE SYNDICALE
NATIONALE DES INDUSTRIES DE LA CONSERVE $IVISION MARITIME P 0IERRE 0ORTAIS ¦ ,E THON TROPICAL DU CLIPPER AU GRAND SENNEUR OCmANIQUE § DANS ,E #HASSE -ARmE P !NNIE 3AHASTUME 4HONIERS ET PoCHEURS BASQUES g $AKAR %USKO )KASKUNTZA :AINAK $ONOSTIA3AN 3EBASTIfN
P *EAN0IERRE #HAUVEAU ¦ (ISTOIRE DE LA PoCHE INDUSTRIELLE AU 3mNmGAL ET POLITIQUES D´INDUSTRIALISATION § DANS
#AHIER SCIENCES HUMAINES /RSTOM P $ANIEL #HARNEAU $YNAMIQUE DE LA ½LInRE FRANlAISE DU THON DEPUIS 4HnSE 3CIENCES bCONOMIQUES UNIVER
SITm DE "ORDEAUX "ORDEAUX 0ENDANT VINGT ANS 0 "ARRIS GmRANT DE LA 3)'0 DEMANDERA AUX POUVOIRS PUBLICS D´AMmLIORER LES CONDITIONS DE
DmBARQUEMENT DES NAVIRES ET D´INCITER LES INVESTISSEURS g IMPLANTER DES CONSERVERIES DONT L´ABSENCE CONDUIT
g REJETER ¦ SOLES ¾mTANS ROUGETS BARS SARDINES ET RAIES DONT LA CONSOMMATION LOCALE EST TROP LIMITmE ET QUI
NE PEUVENT oTRE SALmS OU SmCHmS §
,ES PoCHEURS BASQUES ET BRETONS QUI FONT PARTIE DU CORPS EXPmDITIONNAIRE DE LA &RANCE LIBRE ET DONT LA MIS
SION EST DE RALLIER L´!FRIQUE/CCIDENTALE FRANlAISE SE RAPPELLERONT DES MATTES RASSEMBLEMENTS DE THONS PLUS
IMPORTANTES QUE CELLES JAMAIS VUES SOUS NOS LATITUDES ET EN INFORMENT APRnS GUERRE LE #/&)#!
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%,,%'2)./ !NNA prochaine saison d’été. Leur projet est de louer un bateau congélateur, le
El Mabrouk, pour la période de juillet à novembre, le thon congelé étant raPHQpHQ)UDQFHSDUWUDQVSRUWVRUGLQDLUHVPXQLVGHFKDPEUHVIULJRULÀTXHV
/RUVGHVRQYR\DJHGHUHFRQQDLVVDQFH$OEHUW(OLVVDOW découvre égalePHQWO·HQWUHS{WIULJRULÀTXHGH'DNDU/DSDUWLHUpVHUYpHDXSRLVVRQFRPSUHQGXQV\VWqPHGHFRQJpODWLRQSDUDLUIRUFpSRXYDQWFRQJHOHUTXLQ]H
tonnes par jour, et des chambres d’entreposage pour cinq cents tonnes.
Ce frigo est situé sur le quai du bassin prévu pour les bateaux de pêche et
comprend une fabrique de glace de soixante tonnes.
,E PIONNIER *EAN .OCKIN
-HDQ1RFNLQ37, capitaine de la marine marchande, a fait son cours d’ofÀFLHU j O·eFROH GH OD 0DULQH PDUFKDQGH GH 1DQWHV SHQGDQW OD 6HFRQGH
*XHUUHPRQGLDOH3RXUUpDOLVHUOHVWHPSVGHQDYLJDWLRQQpFHVVDLUHVjODYDOLGDWLRQGHVRQGLSO{PH1RFNLQV·DFKqWHXQWKRQLHUGHV6DEOHVG·2ORQQH
et le remotorise avec un moteur Baudouin de 80 cv récupéré sur un bateau
coulé à Lorient, puis il se fait construire un chalutier thonier à moteur38,
L’Émeraude, avec lequel il s’essaie à la pêche au thon à l’appât vivant. Mais
le vivier de 8 m3 qui ne peut garder que 80 kilos d’appât est trop petit. Les
WHPSVVRQWGLIÀFLOHVHWORUVTX·XQGHVHVDPLVGLVSDUDvWHQPHU39 il décide
d’aller chercher fortune ailleurs, sur des mers moins hostiles et, en février
LOSDUWSRXUO·$IULTXHj3RUWeWLHQQHHQ0DXULWDQLH
$YHFVRQWKRQLHUVDIHPPHVHVHQIDQWVHWFLQTFDPDUDGHV-HDQ1RFNLQ
TXLWWHOD)UDQFHFDSDXVXG©­O·pSRTXHLOQ·\DYDLWSDVXQVHXO)UDQoDLV
c’était bourré de Canariens qui, pendant un mois et demi chaque année,
pêchaient le thon albacore lorsqu’il remonte le plus dans le nordª
(QMXLQOXLUHYLHQWOHPpULWHGHVSUHPLHUVHVVDLVGHSrFKHjO·DSSkW
vivant, dans la région de Port-Étienne. Il obtient immédiatement de bons
résultats, allant jusqu’à ramener six tonnes de thons par jour. Malheureusement, l’impossibilité d’obtenir de la glace le contraint à abandonner les
HVVDLVjODÀQGXPRLVGHQRYHPEUH
%L 2EZK ET %L -ABROUK SONT DES NAVIRES DE MnTRES DE LONGUEUR MnTRES DE LARGEUR ET MnTRES DE
CREUX 0ROPULSmS PAR UN MOTEUR POLAR DE CHEVAUX ILS ONT ATTEINT UNE VITESSE DE N®UDS AUX ESSAIS
,ES PLANS ONT mTm TRACmS PAR - 'UEROULT QUI DRESSA LE PROGRAMME DE RECONSTRUCTION DE LA ¾OTTE DE PoCHE
FRANlAISE EN COLLABORATION AVEC LES ANCIENS CADRES DE LA SOCImTm 0oCHE ET &ROID ARMATEURS DES 6IVAGEL ET 0ES
CAGEL NOTAMMENT LE COMMANDANT #ASTEL ET - ,HOTIS
*EAN -ARCILLE ¦ ,A PoCHE THONInRE MONDIALE SITUATION ACTUELLE ET ESSAI DE PROSPECTIVE § DANS ,A 0oCHE -ARI
TIME MAI P 4mMOIGNAGE DE *EAN .OCKIN RECUEILLI PAR L´AUTEUR g 0ORNIC SEPTEMBRE !UX #HANTIERS #HARRON DE L´)LE D´9EU
4mMOIGNAGE DE *EAN .OCKIN RECUEILLI PAR L´AUTEUR g 0ORNIC SEPTEMBRE )BIDEM
# DE 2%#)43 ,A CONGmLATION DU THON 2VFDU%HUWLQIDLWVRQFRXUVG·RIÀFLHUGHPDULQHPDUFKDQGHj'LHSSH
et rencontre à cette occasion Castel. Bertin navigue comme lieutenant
DX[0HVVDJHULHVPDULWLPHVVXUOHVOLJQHVG·([WUrPH2ULHQW,OHVWLPHTXH
OHVOLYUDLVRQVGHVGHQUpHVVHUDLHQWSOXVHIÀFDFHVDYHFGHSHWLWVQDYLUHV,O
s’achète un petit cargo et fait ainsi du cabotage en sous-traitance des Messageries maritimes.
Quelques années plus tard, il se lance dans la pêche et arme trois Tuna
Clippers à San Diego. Pour les Américains, l’approvisionnement en apSkWHVWGLIÀFLOHFDULOVVRQWVRXYHQWFRQWUDLQWVGHSpQpWUHUGDQVGHVHDX[
pWUDQJqUHVSRXUOHSrFKHUHWGRLYHQWSD\HUGHFR€WHXVHVOLFHQFHVGHSrFKH
DX[SD\VULYHUDLQV2VFDU%HUWLQGpFLGHDORUVGHWHQWHUO·DYHQWXUHWKRQLqUH
le long des côtes africaines où les conditions lui semblent comparables à
celles des côtes californiennes.
2VFDU%HUWLQFKHUFKHXQSDWURQSRXUVRQWKRQLHU,OUHQFRQWUH0'Xmontier (directeur de la revue Le Yacht), un de ses camarades de promotion
et lui demande s’il ne connaît pas un patron intéressé par la pêche au thon
HQ$IULTXH3UpFLVpPHQWOHÀOV'XPRQWLHUDIDLWO·eFROHG·K\GURJUDSKLHj
1DQWHVDYHF1RFNLQ%HUWLQGHVFHQGDQWGHVRQDYLRQSULYpj3RUWeWLHQQH
VHIDLWLPPpGLDWHPHQWFRQGXLUHFKH]-HDQ1RFNLQ©-HDQ1RFNLQVXUOHV
quais de Dakar, au pied de son bateau L’Émeraude rencontre l’armateurFDSLWDLQHDXORQJFRXUVIUDQFRDPpULFDLQ2VFDU%HUWLQ&·HVWOHGpEXWYpritable de l’aventure du thon tropical françaisª
/SCAR "ERTIN g GAUCHE
ET *EAN .OCKIN g DROITE
SUR LE 6ICTORINE "ERTIN
g $AKAR EN SOURCE * .OCKIN
#ASTEL CADRE DE LA SOCImTm 0oCHE ET &ROID PROPRImTAIRE DES NAVIRES CONGmLATEURS 0ESCAGEL ET 6IVAGEL
/N LUI PROPOSE UN JOUR DE TRANSPORTER UNE CARGAISON DE VALEUR DU CRABE GmANT DU +ATCHAMKA DENRmE g
L´mPOQUE TRnS PRISmE g ,OS !NGELES )L RESTE UN PEU TROP LONGTEMPS g QUAI ET SON BATEAU EST PRIS PAR L´EMBhCLE
CONGELANT NATURELLEMENT LES CRABES "ERTIN ARRIVE SIX MOIS PLUS TARD g ,OS !NGELES AVEC UNE CARGAISON EN
PARFAIT mTAT QU´IL REVEND g PRIX D´OR !VEC CE BmNm½CE g ANS /SCAR "ERTIN CRmm UNE COMPAGNIE DE CARGOS
SPmCIALISmS SUR LES LIGNES DE L´%XTRoME/RIENT DIRIGEANT SES AFFAIRES DEPUIS 3ANTA -ONICA )L PROPOSE PENDANT
LA GUERRE SES BATEAUX g DE 'AULLE ET APRnS QUE CEUXCI AIENT mTm COULmS PAR LES SOUSMARINS ALLEMANDS IL
RElOIT COMME DmDOMMAGEMENT DE GUERRE DEUX ,IBERTY SHIPS
9VON ,ACHnVRE $ISPONIBLE SUR HTTPWWWESSAMOGFR CONSULTm LE JUIN 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE ­ODEDUUHG·XQGHVWKRQLHUVFRQJpODWHXUVGHPqWUHVDSSDUWHQDQWj
Bertin, le Yolande Bertin, avec un équipage canarien, à l’exception du chef
DPpULFDLQ-HDQ1RFNLQREWLHQWLPPpGLDWHPHQWGHERQVUpVXOWDWV. Le premier chargement de thons est livré à Agadir où les deux observateurs de
O·2IÀFHGHV3rFKHVGX0DURFHPEDUTXpVjERUGVRQWUHPSODFpVSDUGHX[
VFLHQWLÀTXHVIUDQoDLVGHO·2UVWRP5RJHU/H7DFRQQRX[HW-HDQ'DUGLJQDF
participent à la deuxième marée, invités par Bertin qui considère de son
devoir de diffuser les nouvelles technologies, tant sur le plan de la pêche,
que sur celui de la conservation du poisson.
Le thonier Yolande Bertin mesure 31,88 mètres hors tout, sa largeur est
GH PqWUHV HW VRQ FUHX[ HVW GH PqWUHV 2Q YRLW TXH OD FRTXH VH
FDUDFWpULVHSDUXQHJUDQGHODUJHXUODORQJXHXUjODÁRWWDLVRQpWDQWOHSOXV
souvent comprise entre trois et quatre fois la largeur.
La salle des machines, située à l’avant du bateau, sous le pont principal, est occupée par le moteur et les auxiliaires, les pompes et les tableaux
GHFRQWU{OH/HPRWHXUSULQFLSDODXQHSXLVVDQFHGHFKHYDX[j
WRXUVSDUPLQXWHFHTXLGRQQHDXEDWHDXXQHYLWHVVHGHQ±XGV
Il contient huit viviers, dont les deux paires extrêmes ne possèdent
TX·XQH LQVWDOODWLRQ GH UpIULJpUDWLRQ OHV DXWUHV D\DQW HQ SOXV XQ pTXLSHment de circulation d’eau de mer, pour la conservation de l’appât. Les
deux viviers de pont ont une capacité de dix-huit tonnes chacun, et les
viviers de cale vingt-deux à vingt-cinq tonnes. La congélation du thon
V·HIIHFWXHGDQVXQEDLQGHVDXPXUHUHIURLGLHjƒ&
/HV\VWqPHGHUpIULJpUDWLRQSDUFRPSUHVVLRQGHO·DPPRQLDFHWGpWHQWH
GLUHFWHUHSUpVHQWHHQYLURQGXSUL[GXQDYLUH/HVFRPSUHVVHXUVVRQW
DXQRPEUHGHWURLVGHPPGHGLDPqWUHHWGHPPGHFRXUVHHQWUDvQpVFKDFXQSDUXQPRWHXUGHFY
La congélation du thon pêché à bord d’un clipper s’opère de la façon
VXLYDQWHDYDQWODSrFKHOHSXLWVGHVWLQpjUHFHYRLUOHSRLVVRQHVWUHPSOL
d’eau de mer puis isolé. Le circuit de réfrigération est alors mis en route de
IDoRQjDPHQHUODWHPSpUDWXUHGHO·HDXYHUVƒ&F·HVWjGLUHDXVVLSUqV
que possible de son point de congélation. Le thon pêché, après lavage au
jet sur le pont, est précipité en vrac, non vidé, dans la cale.
Le thon pêché en eaux tropicales atteignant une température interne de
30°C, il faut parfois un à deux jours pour que la cargaison soit uniforméPHQWUHIURLGLHjƒ&SXLVOHWKRQSHXWUHVWHUjFHWWHWHPSpUDWXUHFLQTj
six jours sans danger. C’est seulement à ce moment que l’on ajoute du sel,
jUDLVRQG·HQYLURQNJSDUWRQQHGHSRLVVRQVSRXUREWHQLUXQHVDXPXUH
FDSDEOHG·rWUHUHIURLGLHMXVTX·jƒ&VDQVIRUPDWLRQGHFULVWDX[GHJODFH
Le refroidissement du poisson est alors poussé entre - 7°C et - 8°C, et cette
,´bMERAUDE SERT g LA PoCHE DE L´APPhT
# DE 2%#)43 ,A CONGmLATION DU THON température est maintenue au moins pendant quarante-huit heures pour
assurer une congélation à cœur.
La préréfrigération en eau glacée a l’avantage d’empêcher la pénétration du sel lors de la mise en saumure, le poisson se congelant instantanément en surface au contact de celle-ci. Le thon peut ainsi être conservé à
sec deux à trois mois sans rancissement notable. Sur les clippers, la pêche
du thon s’effectue sur des balcons en acier situés à l’extérieur de la plage
arrière au niveau du pont.
Quand un banc est intercepté avec succès, la pêche se fait avec une ou
plusieurs cannes selon le poids des thons qui composent le banc. La pêche
peut atteindre facilement dix à vingt tonnes en une heure. En novembre
, le thonier congélateur Yolande Bertin, après avoir battu pavillon
KRQGXULHQVHUDIUDQFLVpVLPSOLÀDQWGHFHIDLWOHVHQWUDYHVjVDSrFKHGDQV
des eaux territoriales relevant de juridictions diverses et prendra comme
SRUWG·DWWDFKH'DNDUXWLOLVDQWDLQVLOHVPR\HQVIULJRULÀTXHVGHO·HQWUHS{W
de Dakar.
Le Yolande Bertin congèle en mer et utilise la capacité de stockage de
l’entrepôt de Dakar, qui devient rapidement d’une capacité trop faible. Il
faut alors envisager de prévoir l’étalement des campagnes des thoniers et
de n’admettre simultanément à Dakar qu’un nombre réduit de thoniers en
DWWHQGDQWO·H[WHQVLRQGXIULJRULÀTXH
Les armateurs bretons utilisent alors un chaland congélateur, le Foncillon, tandis que les armateurs basques mettent en service le Sopite, comPHVWRFNDJHLQWHUPpGLDLUHÁRWWDQW
(QMXLOOHWOHVictorine Bertin et le Blue Finn, premier Tuna Clipper
congélateur construit par un chantier métropolitain sont mis en service
pour le compte de la société « Pechafricª
,E FRIGORI½QUE DU PORT DE $AKAR
/·LGpHGHGRWHUOHSRUWGH'DNDUG·XQHQWUHS{WIULJRULÀTXHG·XQHFHUWDLQH
LPSRUWDQFHGDWHGHODSUHPLqUHDQQpHGHODJXHUUH'HYDQWO·DIÁX[GHVSURGXLWVSpULVVDEOHVYHQDQWGHVeWDWV8QLVTXHOHVHQWUHS{WVH[LVtants ne pouvaient recevoir, l’intendance américaine fut amenée à construire
GHX[HQWUHS{WVIULJRULÀTXHVSURYLVRLUHVO·XQSRXUOHVEDVVHVWHPSpUDWXUHV
9VES #ARIOU !VENTURE DANS UN !RMEMENT THONIER g #ONCARNEAU #ONCARNEAU 9VES #ARIOU mDITIONS
P /SCAR "ERTIN METTRA g BORD DE SES NAVIRES LES PREMIERS APPAREILS DmTECTEURS DE BANCS DE POISSONS mVOLUTION
DIRECTE DES SONARS DE LA 3ECONDE 'UERRE MONDIALE
#ONSTRUIT g ,A 2OCHELLE AUX #HANTIERS DE LA 0ALLICE
0ECHAFRIC DONT LES ACTIONNAIRES SONT "ERTIN #ASTEL ET .OCKIN
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE et l’autre pour les températures positives. L’administration coloniale enviVDJHGRQFODFRQVWUXFWLRQG·XQHQWUHS{WIULJRULÀTXHj'DNDU
Sa création doit permettre l’organisation industrielle de la pêche, la
congélation, et ensuite le stockage des produits. Dakar est choisi comme
principal point d’arrivée mais également principal point de départ pour
tout le ravitaillement non seulement du Sénégal, mais aussi des autres
FRORQLHVGHO·$IULTXH2FFLGHQWDOHIUDQoDLVH
Le marché fut scindé en deux parties, les travaux de génie civil étant
FRQÀpVDX[HQWUHSULVHVORFDOHVWRXWO·pTXLSHPHQWPpFDQLTXHHWIULJRULÀque étant fourni par des constructeurs de la métropole ou de l’étranger.
/H IULJRULÀTXH GX SRUW GH 'DNDU HVW FRQVWLWXp G·XQ HQWUHS{W SRO\YDlent, comme la plupart des entrepôts portuaires destinés à recevoir des
marchandises de toutes sortes. Il devait donc posséder un grand nombre
GH FKDPEUHV j GLYHUVHV WHPSpUDWXUHV SUpVHQWHU GHV PR\HQV UDSLGHV GH
manutention, recevoir des marchandises, les expédier par camions et par
voies ferrées, et se trouver à peu de distance des quais où accostent navires de charge et chalutiers.
L’entrepôt présente un ensemble de trois bâtiments d’environ cent cinquante mètres de long. Comprenant une fabrique de glace de soixante
WRQQHVSDUMRXUFLQTFKDPEUHVSRXYDQWFRQWHQLUHQPR\HQQHGHX[FHQWV
tonnes de poisson frais (l’une de ces chambres est divisée en plusieurs
FDVHVJULOODJpHVjO·XVDJHGHVPDUH\HXUVORFDX[XQHVDOOHG·DWWHQWHUpIULJpUpHjƒ&ƒ&GHX[WXQQHOVGHFRQJpODWLRQGHFLQTFHOOXOHVFKDFXQ
j ƒ& SHUPHWWDQW OD FRQJpODWLRQ GH WRQQHV SDU MRXU HQ GHX[ FKDUJHPHQWVHWKXLWFKDPEUHVjƒ&G·XQHVXSHUÀFLHGHPSRXYDQW
contenir au maximum mille tonnes de poisson congelé.
/·HQWUHS{WIULJRULÀTXHSURSUHPHQWGLWHVWSODFpDXFHQWUHjO·RXHVWGX
bloc central se trouve le bâtiment comprenant la salle des machines de
vingt mètres de large par trente-sept mètres de long qui abrite les groupes
électrogènes et les compresseurs.
L’administration coloniale tenait absolument à ce que l’entrepôt frigoULÀTXHVRLWLQGpSHQGDQWHQSDUWLFXOLHUHQFDVGHFRQÁLWRXGHWURXEOHVVRciaux entraînant l’arrêt de la centrale du secteur. Il fallait donc qu’il puisse
fonctionner, et fournir du courant aux divers services du port.
/HVWHPSpUDWXUHVjUpDOLVHUV·pFKHORQQDQWHQWUHƒ&HWƒ&LO\D
deux circuits différents.
Un premier circuit alimenté à l’aide d’une saumure à - 13°C
,ES mTUDES DE L´ENTREPxT SONT FAITES PAR L´INGmNIEUR DE #HESSIN AIDm PAR - #ASSAN DE LA SOCImTm -!4!, DE
.ANTES #RmmE PAR MONSIEUR ,E "OURDAT EN LA SOCImTm -!4!, LE MATmRIEL ALIMENTAIRE EUT COMME PRE
MInRE ACTIVITm LES mQUIPEMENTS FRIGORI½QUES DE DmTAILLANTS EN PRODUITS FRAIS 3ON PREMIER BATEAU LE 'RAND
3CHLEM QUI DATE DE FUT CONSTRUIT g ,A 2OCHELLE #ETTE SOCImTm ASSURERA LA MAINTENANCE DU FROID INDUSTRIEL
POUR LA SOCImTm 0ECHAFRIC
# DE 2%#)43 ,A CONGmLATION DU THON 8QGHX[LqPHFLUFXLWDOLPHQWpjO·DLGHG·XQHVDXPXUHjƒ&
Un emplacement au premier étage au-dessus de la salle des machines
est prévu pour deux bacs à glace, qui permettent une production pouvant
aller jusqu’à cent vingt tonnes par jour, pouvant être livrée sous forme
GH JODFH FRQFDVVpH GDQV XQ EUR\HXU *,))25':22' DX[ PDUH\HXUV
HWPDUFKDQGVGHSRLVVRQSDUXQHFKXWHF\OLQGULTXHWHUPLQpHSDUXQEHF
RULHQWDEOH&HGHUQLHUSHUPHWGHUHPSOLUGHVZDJRQQHWVFLUFXODQWVXUOH
quai, desservant tous les services, en particulier le remplissage des cales
des chalutiers.
#/.#,53)/.
Dans l’histoire de la pêche thonière durant la première moitié du
xxeVLqFOHRQSHXWGLVWLQJXHUGHX[PRPHQWVOHSUHPLHUHVWDVVRFLpjXQH
DFWLYLWpFRQFHQWUpHSULQFLSDOHPHQWHQ$WODQWLTXH1RUGVXUGHVYRLOLHUVOH
plus souvent, le second correspond à une pêche dans les eaux tropicales,
cette dernière étant le fait majoritairement de grands thoniers-senneurs.
L’économie halieutique thonière présente des caractéristiques propres, déÀQLHVSDUODORFDOLVDWLRQHWODQDWXUHGHVUHVVRXUFHVH[SORLWDEOHVG·XQHSDUW
et par les capacités de transformation et d’absorption du marché, d’autre
part. La pêche thonière française, traditionnellement pratiquée avant la
JXHUUHGHDFRQQXXQHSURIRQGHPXWDWLRQTXLFRQVWLWXHXQHUHmarquable illustration de ce qu’il est convenu d’appeler le redéploiement
JpRJUDSKLTXHGHVÁRWWLOOHV(QHIIHWjSDUWLUG·XQHEDVHEUHWRQQHLQLWLDOHment tournée vers la capture du thon blanc, la plupart du temps à partir
de voiliers, s’est constituée une structure de production et de commercialisation qui repose intégralement sur l’exploitation du thon tropical,
GRQWO·pOpPHQWOHSOXVLPSRUWDQWHVWFRQVWLWXpSDUODÁRWWLOOHGHWKRQLHUV
congélateurs.
« L’intérêt économique et technique que suscite la congélation à bord
du poisson à cette époque ne doit pas faire croire cependant qu’il s’agit
d’un phénomène très considérable à l’échelle mondialeª
Les États-Unis se lancent les premiers dans la congélation à bord du
WKRQ-XVTX·HQOHVWKRQLHUVFDOLIRUQLHQVSrFKHQWO·DOEDFRUHSUqVGHV
F{WHV HW OD JODFH VXIÀW j HQ SUpVHUYHU OD IUDvFKHXU &HWWH HVSqFH GH WKRQ
déclinant, ils doivent pêcher plus loin et la congélation s’impose, la saumure est utilisée différemment, en immergeant le poisson dans des puits
$E CONSTRUCTION AMmRICAINE
*EAN -ARCILLE ¦ ,A PoCHE THONInRE MONDIALE SITUATION ACTUELLE ET ESSAI DE PROSPECTIVE § LOC CIT P 2OGER 4HmVENOT %SSAI POUR UNE HISTOIRE DU FROID INDUSTRIEL DANS LE MONDE 0ARIS ))& P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $%,!)2% bTIENNE remplis de cette dernière. Après la guerre, l’extraordinaire accroissement
de la congélation à bord domine l’histoire du froid. L’activité française de
congélation à bord sera très importante grâce à la technique de congélation par saumure importée des États-Unis. Appliquée à la pêche au thon,
elle assurera pour partie la prospérité de l’agroalimentaire français.
L’industrie de la pêche au thon tropical française n’existe pas dans les
DQQpHV 3OXVLHXUV PLVVLRQV VFLHQWLÀTXHV HW WHFKQLTXHV PHQpHV j OD
ÀQGHVDQQpHVVXLWHDX[PLVVLRQVSURVSHFWLYHVGHPHPEUHVGX0Xséum d’histoire naturelle, ont montré la richesse en poissons de surface
DXODUJHGHO·$IULTXHGHO·2XHVW3RXUDFWLYHUOHSRWHQWLHOG·H[SORLWDWLRQ
GHFHWWHUHVVRXUFHOHVGLIIpUHQWVDFWHXUVSULYpVHWSXEOLFVGHODÀOLqUHWKRnière vont mettre en œuvre des stratégies collectives de conservation et de
transformation du poisson pêché.
/·LQQRYDWLRQTXHFRQVWLWXHODPLVHHQSODFHG·XQWHOV\VWqPHLQGXVWULHO
QHSHXWVHFRPSUHQGUHHQUHFRXUDQWjODÀJXUHWUDGLWLRQQHOOHGHO·HQWUHSUHQHXU©(QHIIHWGDQVFHWWHÀJXUHWUDGLWLRQQHOOHLOV·DJLWG·XQLQGLYLGX
isolé qui découvre de nouvelles combinaisons productives qu’il valorise
en créant une organisation productiveª'DQVOHFDVGXGpYHORSSHPHQW
de la pêche au thon tropical, cet individu isolé n’aurait pas pu développer
son offre, sauf de façon marginale.
&HWWHYpULWDEOH©FKDvQHGXIURLGªHVWRUJDQLVpHGHSXLVOHQDYLUHFRQJplateur où le poisson est préparé et congelé dès qu’il est pêché, jusqu’aux
centres de distribution en passant, bien entendu, par les nombreux ateliers
à terre (conserveries, industries agroalimentaires, etc.) qui peuvent apporter une valeur ajoutée au produit de base. Ces techniques jouent un rôle
essentiel pour le développement des activités des pêches maritimes ; elles
permettent en effet de régulariser l’arrivée des produits sur le marché en
évitant les pointes de production. La commercialisation de ces nouvelles
productions doit donc faire appel à la chaîne du froid.
L’introduction du froid à bord a permis de privilégier la fonction pêche
par rapport à la fonction transport, imposée par l’éloignement des lieux
de pêche dû à l’appauvrissement de la ressource. Elle a ainsi révolutionné
la pêche maritime, permettant de décupler la production de produits de
la mer destinés à l’alimentation humaine et d’en étendre sa distribution
DX[UpJLRQVOHVSOXVUHFXOpHV/·pYROXWLRQGXV\VWqPHKDOLHXWLTXHDIULFDLQ
GHO·RXHVWQHVHGpYHORSSHTX·jSDUWLUGHO·pPHUJHQFHG·XQV\VWqPHWHFKnique homogène, dont la pierre angulaire est le froid, permettant de « réGXLUHOHVGLVWDQFHVª
0ATRICE 'UILLOTREAU &RmDmRIC ,E 2OY ¦ ,A GUERRE DU THON OU L´mLmVATION DES CO}TS DES CONCURRENTS PAR L´INTmGRA
TION VERTICALE § DANS !NNALES DES -INES 'mRER ET #OMPRENDRE N€ P # DE 2%#)43 Partie IV
&LQpPD
Figures
de l’ouvrier
/UVRIERS ITALIENS DANS LE CINmMA FRANlAIS ,´IMAGE DE L´OUVRIER ITALIEN
DANS LE CINmMA FRANlAIS
DES ANNmES AUX ANNmES 4ANGUI 0ERRON
S
’INTÉRESSER À L’IMAGE DES OUVRIERS DANS LE CINÉMA FRANÇAIS est déjà
en soi une gageure. L’écrivain et scénariste Vladimir Pozner, l’hisWRULHQ5D\PRQG%RUGHRXOHFLQpDVWHPLOLWDQW5HQp9DXWLHU l’ont
GpMjFRQVWDWpHWVRXYHQWGpQRQFpDXFLQpPD©OHSURORªHVWUHVWpGDQV
l’ombre. Que dire alors du travailleur étranger ? Celui-ci, bien souvent, n’a
été que l’ombre à casquette. Il semble bien pourtant qu’au cours des années 1930 et surtout après la guerre – coproduction et populisme aidant –
VHVRLWGHVVLQpHXQHÀJXUHDUFKpW\SDOHGXWUDYDLOOHXULWDOLHQ
Il est évident que le cinéma n’est pas non plus ce « miroir promené le
ORQJ G·XQ FKHPLQ ª 7URS GH IDFWHXUV ² WHFKQLTXHV SROLWLTXHV LGpRORJLques et culturels – ont fait écran dans le cinéma français, à une reproducWLRQG·DLOOHXUVLPSRVVLEOH©GXPRQGHUpHOª&HGHUQLHUG·XQHPDQLqUH
GpWRXUQpHpWRXIIpHVHPDQLIHVWHFHSHQGDQWWRXMRXUVGDQVWRXVOHVÀOPV\
compris – et peut-être plus encore – dans ceux qui sont le plus, à première
YXHpORLJQpVGHVUpDOLWpVVRFLDOHV8QÀOPQRXVUHQVHLJQHVXUOHVGpVLUV
les peurs, les fantasmes des publics. Presque toujours, il véhicule ou traduit l’idéologie de la société qui l’a produit, parfois il peut nous apporter
de précieuses indications anthropologiques. Celles-ci ont été rares dans
O·pFKDQWLOORQGHÀOPVTXHQRXVDYRQVpWXGLpVOHVOHFWXUHVLGpRORJLTXHVHW
VLO·RQSHXWGLUH©SV\FKDQDO\WLTXHVªVHVRQWHQUHYDQFKHUpYpOpHVIUXF
4ANGUI 0ERRON IN !NTONIE "ECHELLONI -ICHEL $REYFUS ET 0IERRE -ILZA DIR ,´)NTmGRATION ITALIENNE EN &RANCE
bDITIONS COMPLEXES P 2ESPECTIVEMENT DANS ,´(UMANITm MARS ,A &RANCE DES ANNmES VUE PAR SON CINmMA MUSmE DES
!UGUSTINS 4OULOUSE ET ,A REVUE DES COLLECTIVITmS OUVRInRES AVRIL 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI tueuses. Dans Mythologies, Roland Barthes écrivait que c’est à l’intérieur
GHVLPDJHVGHPDVVHTXHWULRPSKHQWOHVVWpUpRW\SHV©ÀJXUHVPDMHXUHVGH
O·LGpRORJLHª/DOLWWpUDWXUHSRSXODLUHHWOHFLQpPDFRPPHUFLDOVRQWULFKHV
GH FHV LPDJHV VWpUpRW\SpHV HW GH FHV LPDJHV IDQWDVPpHV TXH O·KLVWRULHQ
cherchera ailleurs le plus souvent en vain.
L’intérêt pour les travailleurs italiens, et non pour les Italiens en généUDOSHXWVHMXVWLÀHUSDUWURLVDUJXPHQWVQREOHVHW©LJQREOHVªKLVWRULTXHV
HWKLVWRULRJUDSKLTXHVO·LPPLJUDWLRQF·HVWXQHpYLGHQFHDXMRXUG·KXLQpgligée, est avant tout un phénomène massivement ouvrier – entre 1930 et
²jGHV,WDOLHQVVRQWRXYULHUV©OHWUDYDLOOHXULWDOLHQªDYHF
OHVVWpUpRW\SHVTXHQRXVDYRQVUHOHYpVHVWXQHUHSUpVHQWDWLRQTXLpPHUJH
dans l’imaginaire des Français, sans doute vers 1930 et qui évolue dans les
DQQpHVHWHQÀQO·pWXGHGHO·LPDJHGHV,WDOLHQVGDQVOHFLQpPD
– de tous les Italiens – a déjà été effectuée par Bertin-Maghit pour une péULRGHDOODQWGHj3.
'DQVOHVDQQpHVLO\DjSHXSUqVGHX[PLOOLRQVG·RXYULHUVpWUDQJHUVHQ)UDQFHVRLW©SOXVGXTXDUWGHODFODVVHª. L’immigration italienne
HVWGHORLQODSOXVLPSRUWDQWHXQPLOOLRQG·,WDOLHQVGDQVO·+H[DJRQH&HWWH
immigration, en plus d’être massive, est ancienne – les premières vagues
de l’immigration italienne moderne commencent vers 1880, voire vers
²HOOHHVWDXVVLYDULpHELHQTXHPDMRULWDLUHPHQWPDVFXOLQHFRPPH
WRXWHLPPLJUDWLRQRXYULqUH'HVW\SHVVRFLDX[GLIIpUHQWVV·\VRQWFRQVWLtués, comme les mineurs de fer et les sidérurgistes lorrains, les maçons
GH OD UpJLRQ SDULVLHQQH HW GX 6XG(VW OHV SD\VDQV GX 6XG2XHVW« /HV
FRQGLWLRQVGHO·LPPLJUDWLRQQ·RQWSDVpWpOHVPrPHVSRXUWRXWOHPRQGH
LO\DFHX[TXLVRQWYHQXVjSLHGHWFHX[TXLVRQWYHQXVHQWUDLQDYHFOHXU
famille ou seuls, en maîtrisant la langue ou en l’ignorant totalement, avec
ou sans contrat de travail, avec des adresses et des contacts ou non… En
)UDQFHRXWUHOHVW\SHVVRFLDX[pYRTXpVSOXVKDXWLOH[LVWHGHQRPEUHXVHV
disparités en fonction des habitants, des comportements politiques, des
pratiques religieuses… De toutes ces différences, le cinéma, en général, ne
s’encombre guère.
Il est vrai que les Italiens ont longtemps eu des situations similaires en
SOXVLHXUVSRLQWVVDQVGURLWVSROLWLTXHVHWV\QGLFDX[LOVVHVRQWKHXUWpVDX
même mépris, aux mêmes préjugés en tous cas. Ralph Schor a souligné
dans L’Opinion française et les étrangersODGLFKRWRPLHHQWUHODÀHUWpG·rWUH
*EAN0IERRE "ERTIN-AGHIT ¦ 4ONI -ARIO *OAN #ONCINI ET LES AUTRES LA REPRmSENTATION DES )TALIENS ET DES %SPA
GNOLS DANS LE CINmMA FRANlAIS DE g § DANS 0IERRE -ILZA ET $ENIS 0ESCHANSKI DIR )TALIENS ET %SPA
GNOLS EN &RANCE !CTES DU COLLOQUE INTERNATIONAL DES NOVEMBRE 0ARIS )(40 *EAN0AUL -OLINARI ,ES /UVRIERS COMMUNISTES SOCIOLOGIE DE L´ADHmSION OUVRInRE AU 0#& ,´!LBARON 4HONONLES
"AINS 2ALPH 3CHOR ,´/PINION FRANlAISE ET LES mTRANGERS 0ARIS 0UBLICATIONS DE LA 3ORBONNE # DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS FLWR\HQGXSD\VGHV'URLWVGHO·+RPPHDFFXHLOODQWHWGHVPDQLIHVWDWLRQV
xénophobes – parfois des crimes racistes – souvent liées aux conjonctures
économiques et politiques.
Toutefois, les travailleurs italiens, dans les années 1930, ne semblent
SDVrWUHOHVSUHPLqUHVFLEOHVGHVFDPSDJQHV[pQRSKREHVHWGHVÁDPEpHV
UDFLVWHVFRPPHjODÀQGX XIXe siècle et du début du XXe siècle. Dans les
nombreuses études et publications de l’époque, consacrées à « la présence
pWUDQJqUH ª OHV ,WDOLHQV RQW SOXW{W ERQQH SUHVVH 0DXFR GDQV Les étrangers en FrancepFULWSDUH[HPSOHTXH©OHV,WDOLHQVSDUVXLWHG·XQH
grande communauté ethnique et de civilisation, n’éprouvent pas le même
GpVDUURL«TXHOHV3RORQDLVª:ORFHYVNLGDQVL’Installation des Italiens
en FrancepFULWOXLTXH©GDQVVRQHQVHPEOHO·LPPLJUDWLRQRXYULqUH
LWDOLHQQH HQ )UDQFH D GRQQp GHV UpVXOWDWV GHV SOXV VDWLVIDLVDQWV ª 'DQV
Trois millions d’étrangers (1938), sous-titré « Les indésirables et les bienYHQXV ª HW VXUWRXW FRQVDFUp DX[ LQGpVLUDEOHV 0LOOHW SDUOH WUqV SHX GHV
,WDOLHQVFHTXLHVWSOXW{WERQVLJQH1pDQPRLQVOHVSUpMXJpVHWODPpÀDQFH
YLVjYLVGHVFLWR\HQVGH©ODV±XUODWLQHªSHUGXUHQW
Mauco écrit ainsi que « les Italiens se distinguent par certaines caractérisWLTXHVWRXWHVPpULGLRQDOHVWXUEXOHQFHPDOSURSUHWpPXOWLWXGHGHFDIpVHW
JUDQGQRPEUHGHERXWLTXHVGHSURGXLWVDOLPHQWDLUHVLWDOLHQVªsic), « l’Italien ne rougit pas d’être en guenilles, par contre, les dimanches et les jours
de fête, la plupart sont méconnaissables et leur élégance fait pâlir les emSOR\pVOHVPLHX[PLVª:ORFHYVNLDSUqVDYRLUFLWpHQH[HPSOHO·LQVWDOODWLRQ
des Italiens, s’interroge tout de même devant les quelques menaces d’irréGHQWLVPHTXLSqVHQWVXUOD6DYRLHOD&RUVHHWVXUWRXW1LFHHWDIÀUPHTX·LO
faudra placer la population italienne de ces régions « sous une étroite surYHLOODQFHGDQVGHVFDPSVGHFRQFHQWUDWLRQª(QÀQRQQHSHXWV·HPSrFKHU
de ressentir un certain malaise devant les comptes d’apothicaire, à l’unité
près, de Millet dénombrant un an avant la guerre, « les malades étrangers
GDQVQRVK{SLWDX[ª©OHVDOLpQpVpWUDQJHUVGDQVQRVDVLOHVª©O·pWDWGHV
GpWHQXVpWUDQJHUVGDQVOHVpWDEOLVVHPHQWVSpQLWHQWLDLUHVIUDQoDLVª)LJXUHQW
aussi dans ces comptes, où semblent se dessiner certaines idées d’Alexis
Carrel, forcément, les étrangers italiens. Ce climat de suspicion et d’exclusion se retrouve souvent dans le cinéma d’avant-guerre qui fait de l’étranger en général et du Juif en particulier, des personnages négatifs.
Dans les années 1930 en effet, quand le cinéma cède à la xénophobie, la
première cible n’est pas l’Italien mais le Juif, il n’est que de voir les rôles
GRQQpVj'DOLR,VUDsO0RVFKH%ODXVFKLOG²OHWUDvWUHO·$UELGDQVPépé le
Moko, par exemple – pour saisir une partie de l’antisémitisme de l’époque.
#F. LE LIVRE DE 0ATRICK 4ORT ET ,UCIEN "ONNAFm ,´(OMME CET INCONNU !LEXIS #ARREL *EAN-ARIE ,E 0EN ET LES CHAM
BRES g GAZ 0ARIS bDITIONS 3YLLEPSE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI À l’écran, l’Italien n’est parfois qu’une simple métaphore de l’étranger7.
6DFKD*XLWU\GDQV En remontant les Champs-Élysées (1938), dit ainsi à propos de Concini8
²©1RXVDYRQVWRXMRXUVHXXQHIkFKHXVHWHQGDQFHjUHWHQLUFKH]QRXV
GHVJHQVTXLQHVRQWDEVROXPHQWSDVQpFHVVDLUHVª
/·,WDOLHQHW©VHVYLFHVªSHXYHQWTXDQGPrPHrWUHFODLUHPHQWGpVLJQpV
Dans VolponeGH0DXULFH7RXUQHXUFHOXLFLDSSDUDvWVHORQ%HUWLQ
0DJKLWFRPPH©FXSLGHXVXULHUUDSDFHHVFURFYLROHXU«ª
/H WUDYDLOOHXU LWDOLHQ HVW SOXV LGHQWLÀDEOH HQFRUH ­ FHV FLQT TXHVWLRQV
'·RYLHQWLO"2ORJHWLO"4XHOHVWVRQVRUWjODÀQGXÀOP"4XHOVVRQW
ses rapports avec les femmes ? Quelles sont ses particularités ?), nous avons
eu souvent des réponses similaires et ces réponses, quand elles ont évolué,
RQWFRQQXOHVPrPHVYDULDWLRQVHQWUHOHVDQQpHVHWOHVDQQpHV
Les immigrés italiens, eux aussi, sont les prolétaires des prolétaires.
Ils n’ont pour eux que leur nombre, leur force de travail ; leur nom est
JpQpULTXHHWOHXURULJLQHHVWÁRXH/HV©SLDIVªOHV©PDFDVªOHV©ULWDOVª
peuvent porter au cinéma le banal prénom de Toni ou Tonio9. Dans beauFRXSGHÀOPVRQQHVDLWSDVG·RLOVYLHQQHQWPDLVRQVDLWTX·LOVSHXYHQW
repartir. De même, ils vivent à l’écart de la population autochtone.
Le ToniGH5HQRLUV·RXYUHVXUODFRQYHUVDWLRQGHGHX[PDQ±Xvres étrangers travaillant sur une voie ferrée. Devant l’arrivée d’un train de
Piémontais, l’un des deux manœuvres (l’Italien), se plaint de « ces étrangers qui viennent nous lever (sicOHSDLQGHODERXFKHª/·DXWUHPDQ±Xvre (l’Espagnol) lui fait remarquer qu’eux-mêmes viennent juste d’arriver,
respectivement depuis un an et deux ans, de Turin et de Barcelone. Le
7XULQRLVUpWRUTXHDORUV
©0DLVPRLMHVXLVRXYULHUPRL0RQSD\VF·HVWFHOXLTXLPHIDLWERXIfer.
²&·HVWSRXUoDTXHWXHVVLJURVªUpWRUTXHDORUVOH%DUFHORQDLV
L’ouvrier turinois en vient ici à nier son origine en s’abritant derrière
des propos racistes alors que tout en lui – son accent, son parler, son travail même – le désigne comme immigré italien. Ce clin d’œil de Renoir ne
désigne pas moins l’immigré comme un déraciné.
$ANS 'ERMINAL DE #APPELANI 3OUVARINE EST LA ½GURETYPE DE ¦ ,´mTRANGER EN DEHORS DE LA COMMUNAU
Tm § ,´mTRANGER RUSSE EST g CxTm DES OUVRIERS RAREMENT AVEC IL EST SOUVENT DE DOS QUAND ILS SONT DE FACE DE
FACE QUAND ILS SONT DE DOS LORS DE LA FUSILLADE TOUS TOMBENT AUTOUR DE LUI LUI SEUL RESTE DEBOUT ª L´IMAGE IL
Y A AUSSI UNE GmOGRAPHIE DE L´EXCLUSION
#ITm PAR *EAN0IERRE "ERTIN-AGHIT ¦ 4ONI -ARIO *OAN #ONCINI¨ § LOC CIT
¦ $ANS L´AURORE LATINE DU MOT LE PROLmTAIRE C´EST EN EFFET LE SANSNOM ET LE SANSPAROLE CELUI QUI N´A DROIT NI
AUX ANCoTRES NI g L´EXPRESSION PUBLIQUE 5N HOMME SANS INSCRIPTION SYMBOLIQUE ET MUET ¨ UN MORTEL SANS
PASSm ET SANS AVENIR PUISQUE SANS NOM § *EAN "ORREIL ¦ ,ES COMBATS DES MUETS DU MUTISME CIVIL § DANS *EAN
#LAUDE "EAUNE *EAN "ORREIL ET ALII ,ES SAUVAGES DANS LA CITm AUTOmMANCIPATION DU PEUPLE ET INSTRUCTION DES
PROLmTAIRES AU 8)8E SInCLE 0ARIS #HAMP 6ALLON # DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS Grisou (1938), de Maurice de Canonge, est beaucoup plus représentatif
des idées dominantes de l’époque10. Là, l’étranger italien esquive même les
TXHVWLRQVVXUVHVRULJLQHV/HÀOPQHSUpFLVHG·DLOOHXUVSDVVDQDWLRQDOLWp
mais, sans se référer à la pièce11 de Brasseur et Dalio, qui est la base du scéQDULRFHOOHFLHVWH[SOLFLWHVRQSUpQRP²7RQL²VRQSK\VLTXH²F·HVWXQ
beau brun –, ses pratiques – il charme et chante –, tout le désigne comme
XQ,WDOLHQGpERUGDQWGH©ODWLQLWpª7RQLJDUGHWRXWHIRLVOHÁRXVXUVDQDtionalité, ce qui accentue son côté ambigu – un étranger porte toujours un
PDVTXH,OGLWDLQVLjODMHXQHWULHXVH0DGHOHLQH2GHWWH-R\HX[
©-HYRXVFKDQWHUDLGHVFKDQVRQVGHPRQSD\V"
²0DLVGHTXHOSD\VYRXVrWHV"
²$KXQSD\VRLO\DWRXMRXUVGXVROHLO
– C’est le ciel ?
²2XLSHXWrWUH«ª
De même, on ne sait d’où vient vraiment celui qui, dans La Maison sous
la merGH+HQUL&DOHIVHIDLWQRPPHU&RQVWDQW0HUFLHUPDLVGpEDUTXHG·$QJOHWHUUHDXQSK\VLTXHHWXQFRPSRUWHPHQWG·,WDOLHQ²VHORQOHV
VWpUpRW\SHVGHO·pSRTXH²HWTXLjODÀQGXUpFLWV·HQYDWRXMRXUVSDUOD
mer, en Amérique du Sud.
Les travailleurs italiens sont souvent de passage, comme ils sont disFUHWV HW pYDVLIV VXU OHXU RULJLQH ,OV LQFDUQHQW OD ÀJXUH GH © O·pWUDQJHU ª
©VDQVSDWULHQLIURQWLqUHªWRXWHQD\DQWSDUDGR[DOHPHQWQRQXQHYpULtable personnalité, mais de fortes caractéristiques. Ils sont de nulle part,
mais pas d’ici. Dans Thérèse RaquinGH&DUQp/DXUHQW5DOSK9DOORQHGLWDLQVLj7KpUqVH6LPRQH6LJQRUHW
« Je n’ai rien, sauf une camionnette. Quand j’en ai assez d’une ville, je
YDLVGDQVXQHDXWUHª
#ONTRAIREMENT g CE QU´A mCRIT *EAN0IERRE "ERTIN-AGHIT NOUS PENSONS QUE LE CINmMA ¯ CERTES DE MANInRE
DmTOURNmE ¯ PEUT PARFOIS EXPRIMER ¦ LES NIVEAUX D´OPINION QUI EXISTENT g UNE mPOQUE DONNmE DANS UN PAYS §
PAS SEULEMENT ¦ UNE IMAGE MOYENNE § DE LEUR IMAGINAIRE #ERTES 2ENOIR MALGRm L´INCIPIT DE 4ONI ¦ L´ACTION SE
PASSE DANS LE MIDI DE LA &RANCE EN PAYS LATIN Lg O| LA NATURE DmTRUISANT L´ESPRIT DE "ABEL SAIT SI BIEN OPmRER
LA FUSION DES RACES § A CONSTRUIT UNE ½CTION PmNmTRmE PAR L´IDmOLOGIE DOMINANTE ET L´IMAGINAIRE SOCIAL L´INTm
GRATION DE L´mTRANGER EST ALmATOIRE ET ELLE PEUT ABOUTIR g UN mCHEC RADICAL ¯ ICI LA MORT DE 4ONI LES LATINS TROP
SENSUELS PEUVENT oTRE DmVORmS PAR LEUR PASSION #EPENDANT )TALIENS ET %SPAGNOLS SONT SYMPATHIQUES LE SEUL
INDIVIDU FRANCHEMENT ANTIPATHIQUE SORTE DE PETIT FASCISTE AU QUOTIDIEN EST LE CONTREMAsTRE FRANlAIS 2ENOIR
MALGRm LES CONTRADICTIONS DU ½LM AVEC L´INCIPIt g QUAND MoME RmUSSI g Y FAIRE PmNmTRER PARTIELLEMENT SES OPI
NIONS QUI SONT CELLES D´UNE PARTIE DE LA GAUCHE FRANlAISE ,´AUTEUR A EN EFFET mTm LIBERTAIRE PUIS SYMPATHISANT
COMMUNISTE $E MoME LES SYMPATHIES TROTSKISTES D´9VES !LLmGRET L´ONT SANS DOUTE CONDUIT MoME SI SON ½LM
EST PARFOIS POPULISTE ET DRAMATIQUE g NE PAS MONTRER UNE IMAGE DmPRmCIATIVE DES OUVRIERS ET DES IMMIGRmS
DANS ,A -EILLEURE PART $ALIO mVOQUE AINSI DANS SES -mMOIRES L´mLABORATION DE LA PInCE AVEC 0IERRE "RASSEUR ¦ .OUS AVIONS MoME
TROUVm LE TEMPS ENTRE DEUX SAOULERIES D´mCRIRE 'RISOU ¨ *E M´APPELAIS "ARRER ET J´mTAIS MINEUR ,A FEMME DE
SON MEILLEUR AMI (AGUENAUDER UN AUTRE MINEUR mTAIT MA MAsTRESSE (AGUENAUER SOUPlONNAIT ,ORENZO UN
BEAU 6mNITIEN QUI TRAVAILLAIT DANS LES BUREAUX § $ALIO .OS PLUS BELLES ANNmES bDITIONS ,ATTnS 0ARIS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI Après qu’il lui ait demandé de partir avec lui, tout de suite, elle s’inTXLqWH
©3DUWLH"6DQVVDYRLUR"6DQVULHQGLUH"&RPPHGHVYROHXUV"ª
/HPDULGH7KpUqVH-DFTXHV'XE\VRXOLJQHDXVVLOHPDQTXHG·DWWDFKHVGXWUDYDLOOHXUSLpPRQWDLV
©8QFDPLRQQHXU(WXQpWUDQJHUHQSOXV2QQHVDLWSDVG·RoDYLHQW
dDWXWRLHWRXWOHPRQGHǻ
Le logement porte aussi la marque de cette exclusion. Le travailleur itaOLHQHVWFHOXLTXLHVW©jF{Wpª©HQGHKRUVªGHODFRPPXQDXWp'DQVToni,
les carriers, pour la plupart Italiens, vivent en pension dans un bâtiment
isolé, les bergers corses et italiens dorment dans les bois ; dans Grisou, Toni
ne vit pas avec les ouvriers du coron et ne travaille pas non plus dans la
mine avec les Français, mais seul, dans un bureau ; dans La Maison sous la
mer, l’étranger loge à l’écart de la ville, dans une grotte ; dans Thérèse Raquin, Laurent habite seul dans un hôtel meublé ; dans La Lumière d’en face
GH5DOSK+DELEL’Amour d’une femmeGH-HDQ*UpPLOORQHW
La Meilleure partG·<YHV$OOpJUHWOHV,WDOLHQVYLYHQWHQVHPEOHGDQV
des baraques de chantier.
Les travailleurs italiens ne semblent jamais pouvoir s’intégrer, s’enraciQHU2QQHYRLWMDPDLVOHXUVHQIDQWVQLOHXUIDPLOOHVDXIGDQVL’Air de Paris
GH&DUQp,OVVRQWGHSDVVDJHRXLOVWUpSDVVHQWODSOXSDUWGHVÀOPV
évoqués plus haut s’achèvent même par leur départ, leur expulsion ou
OHXUPRUW/H7RQLGH5HQRLUVHIDLWDEDWWUHSDUGHVSD\VDQVPpULGLRQDX[
le Toni de Maurice de Canonge se fait expulser par un travailleur français (Pierre Brasseur) ; dans La Maison sous la mer, Constant repart, seul,
sans rien dire, comme il est venu ; André Laurent, dans L’Amour d’une
femme, repart aussi, sans prévenir celle qui devait être son épouse ; dans
La Meilleure partOHYLHLOLWDOLHQVLOLFRVpYDUHWRXUQHUPRXULUGDQVVRQSD\V
tandis que Laurent, l’amant de Thérèse Raquin, inévitablement, va se faire
SRXUFKDVVHU SDU OD SROLFH 'DQV OHV ÀFWLRQV IUDQoDLVHV O·DYHQLU HVW GRQF
fort sombre pour les travailleurs italiens.
Malgré (ou à cause) de cette absence de perspectives véritables et de
racines, la femme est terriblement attirée par l’ouvrier italien dont l’appaUHQFHSK\VLTXHQ·HVWSDVOHPRLQGUHGHVHVFKDUPHV$XFLQpPDJpQpUDlement, l’ouvrier ou l’homme du peuple, quel qu’il soit, est déjà plus viril
que le bourgeois. Ce dernier est assez souvent un piètre partenaire ou un
pervers, sa femme est parfois stérile… Autant de variantes d’un même
thème que l’on retrouve aussi bien dans Le Quai des brumes (1938) de Carné, que dans LoulouGH0DXULFH3LDODW&HWWHFUR\DQFHYHQDQWVDQV
GRXWHGH©O·DQLPDOLWpªDWWULEXpHDXSUROpWDLUH²VDSULQFLSDOHIRQFWLRQHVW
# DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS de faire des enfants –, peut être utilisée de manières divergentes. Certains
artistes et idéologues, précédant une partie de l’opinion, ont inversé l’imaJHVHXOVOHVRXYULHUVHQIDFHGHV©ERXUJHRLVGpJpQpUpVªSHXYHQW©UpJpQpUHUªO·KXPDQLWpGRQWLOVVRQWO·DYHQLU/HWUDYDLOOHXULWDOLHQSHXWrWUH
SDUFH TX·LO HVW DXVVL OH SUROpWDLUH GHV SUROpWDLUHV © XQ VXSHUSUROpWDLUH ª
– ou un sous-prolétaire – est plus viril encore que l’ouvrier français. Cette
FUR\DQFHYLHQWDXVVLGHO·DQJRLVVHGHVRXYULHUVIUDQoDLVGHYDQWO·DUULYpH
GHV,WDOLHQVVXUOHPDUFKpGXWUDYDLOHWGDQVODVRFLpWp©DSUqVDYRLUYROp
OHSDLQLOVYHXOHQWYROHUOHVIHPPHVª)DQWDVPHGHV6DELQHV.
/HFLQpPDDORQJWHPSVIDLWULPHU[pQRSKRELHDYHFPLVRJ\QLH/DIHPme et l’étranger n’ont souvent été appréhendés que de manière schématiTXH$XPRLQVODIHPPHDWHOOHpWpFDQWRQQpHGDQVTXDWUHU{OHVO·LQJpnue, la garce, l’icône que l’on idolâtre et la mégère. L’étranger n’a pas eu
autant de choix. Quand ces deux êtres, dans les années 1930, étaient réunis
à l’écran, ils formaient un couple dangereux pour l’équilibre de la communauté. Dans le cinéma d’avant-guerre, hanté par la quête de l’Ailleurs, le
ÁRXGHVRULJLQHVHWO·LQFHUWLWXGHGHVOHQGHPDLQVTX·LQFDUQHQWOHV,WDOLHQV
VRQWSRXUOHVIHPPHVULYpHVHQJOXpHVGDQVOHUpHOXQSXLVVDQWPR\HQGH
UrYHXQDYDQWJR€WGXPHUYHLOOHX[6RXYHQWQDwYHVHOOHVYR\DJHQWGpMj
avec leurs récits, leur prestance et leur élégance, leur voix d’or et leur regard de braise de latin lover. L’ouverture de La Belle ÉquipeGH'XYLYLHUOHEDELOODJHGHMHXQHVHWLQJpQXHVÁHXULVWHVVRQWDLQVLUpYpODWHXUVGHV
FOLFKpVHWGHODPLVRJ\QLHGHO·pSRTXH
©&RPPHQWLOHVWWRQÀDQFp"
– Moi, je l’ai vu, c’est un brun avec une voix qui chante.
²&·HVWYUDLTX·LOV·DSSHOOH*RQ]DOqV"
– Il s’appelle Mario, il est de Barcelone.
²$KOHV,WDOLHQVLOVRQWGHV\HX[DYHFGHO·RUGHGDQV
– Mais Barcelone, c’est pas en Italie.
– Ah, où est-ce alors ? (…)
²(QWRXWFDVLOVVRQWEUXQVF·HVWGHVYUDLVKRPPHVª
)L EXISTE PEU DE TRACES mCRITES DE CE FANTASME POURTANT SI PRmGNANT DANS LA SOCImTm FRANlAISE ET SI VISIBLE DANS
SON CINmMA -AUCO Y FAIT TOUTEFOIS ALLUSION DANS ,ES bTRANGERS EN &RANCE !PRnS AVOIR SOULIGNm CHEZ LES )TALIENS
LE NOMBRE IMPORTANT EN REGARD AUX 0OLONAIS ¦ DES PLUS ISOLmS ET DES CmLIBATAIRES mLmMENTS PLUS INDISCIPLINmS
ET PLUS NOMADES § IL mCRIT QUE LE TEMPmRAMENT MmRIDIONAL LES POUSSE AUX M®URS FACILES D´AUTANT QUE BE
AUCOUP SOUS L´IN¾UENCE DES RAILLERIES FRANlAISES QU´ILS PRENNENT TROP AU SmRIEUX CROIENT BON TON D´AVOIR L´AIR
¦ mMANCIPm § 5N CERTAIN NOMBRE LES DIMANCHES ET JOURS DE FoTES SE LIVRENT g DE VmRITABLES ¦ SATURNALES §
$ANS LA GRANDE ENQUoTE DIRIGmE PAR 'IRARD ET 3TOETZEL EN UN INTERVIEWm SE RAPPELANT SON ARRIVmE EN &RAN
CE SE PLAINT QU´g UN BAL DONNm AU VILLAGE LES JEUNES ½LLES mTAIENT ¦ COMME Mm½ANTES g SON mGARD § -oME SI
L´ACCUEIL EST CONTRAIRE POUR 'IORGIO !MENDOLA AVANTGUERRE LORS DU BAL DU JUILLET g 0ARIS CELUICI N´IGNORE
PAS LA MAUVAISE RmPUTATION DES )TALIENS )L mCRIT AINSI QU´IL mTAIT ACCUEILLI AVEC SYMPATHIE BIEN QU´mTRANGER ET
SURTOUT )TALIEN ¦ C´ESTgDIRE UN TYPE PEU RECOMMANDABLE SPmCIALEMENT DANS LES RAPPORTS AVEC LES FEMMES §
' !MENDOLA CITm PAR # ,UCAS DANS #ENTRE D´mTUDES ET DE DOCUMENTATION SUR L´mMIGRATION ITALIENNE DIR ,´IM
MIGRATION ITALIENNE EN &RANCE DANS LES ANNmES !CTES DU COLLOQUE ORGANISm PAR LE #%$%) LES OCTOBRE
g 0ARIS 0ARIS #%$%) 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI /H7RQLGH&DQRQJHGXPRLQVSHQGDQWOHVWURLVTXDUWVGXÀOPSDUDvW
DX[ \HX[ GHV IHPPHV OH SURWRW\SH GH FH IDQWDVPH 7RXMRXUV WLUp j TXDWUH pSLQJOHV LO FKDQWH HQFRUH SOXV TXH *DELQ GDQV La Belle Équipe, mais
à la manière de Tino Rossi dans Naples au baiser de feu (1938) d’Auguste
*HUPLQD/HEHOOkWUHVpGXLWDOOqJUHPHQWOD/RXWH0DGHOHLQH5RELQVRQOD
jeune femme du vieux mineur (Aimos) – à qui il dit « faut pas m’en vouORLUMHVXLVSDVQpLFLM·DLSDVODWHUUHFRPPHYRXVDXWUHVª²DLQVLTX·XQH
MHXQHWULHXVHODV±XUG·XQEUDYHKRXLOOHXU3LHUUH%UDVVHXU­ODÀQGX
UpFLWO·,WDOLHQHVWH[SXOVpHWODIHPPHLQÀGqOHV·HQYD/DFDPDUDGHULHGDQV
le travail, entre gens du cru et du coron, va pouvoir suivre son cours. La
femme, avant leur séparation, s’est tout de même rendu compte de la facWLFLWpHWGHODGXSOLFLWpGHO·,WDOLHQ
©6LW·HVODUJHG·pSDXOHVF·HVWSDVODJ\PQDVWLTXHF·HVWWRQWDLOOHXUª
Si Toni a un travail, on ne le voit pas travailler. Une seule fois range-t-il
vaguement un papier dans un tiroir. Ce papier s’avère être un avertissement concernant la sécurité dans la mine. Cette négligence, indirectement,
va entraîner la mort d’hommes, suite à un éboulement dans les galeries.
Les auteurs ont ici opéré une curieuse inversion de la hiérarchie, exacWHPHQW FRQWUDLUH j OD UpDOLWp OHV pWUDQJHUV WUDYDLOOHQW DX MRXU VRQW EXreaucrates, tandis que les Français sont mineurs de fond…13 Cela permet
DX PLQHXU +DJXHQDXHU G·RSpUHU GDQV VRQ GLVFRXUV ÀQDO XQH FRQIXVLRQ
entre l’opposition entre classes et l’opposition entre races. Dans Grisou,
O·,WDOLHQHVWIDLQpDQWYHXOHGDQJHUHX[SRXUOHSD\V,OPHQDFHO·pTXLOLEUH
de la communauté en volant les femmes, il désorganise le travail par sa
négligence – qui s’apparente à du sabotage – il mérite donc d’être expulsé.
(QGpÀQLWLYHFHQ·HVWSDVQRQSOXVXQYUDLKRPPH/H7RQLGHHVWLFL
plus la métaphore de l’étranger avec les particularités des Italiens (menWHXUVHWVpGXFWHXUVTX·LOQ·LQFDUQH©OHWUDYDLOOHXULWDOLHQªGRQWO·LPDJHVH
fait plus précise et moins négative après-guerre.
¦ ,´EFFECTIF TOTAL DES CHARBONNAGES FRANlAIS mTANT DE EN LES mTRANGERS CONSTITUAIENT
DONC DE NOTRE POPULATION MINInRE #E POURCENTAGE CONSIDmRABLE S´mLEVAIT ENCORE LORSQU´ON NE CONSI
DmRAIT QUE LE TRAVAIL DE FOND ¨ IL ATTEIGNAIT ALORS ET DmPASSAIT PLUS DE LA MOITIm DES EFFECTIFS § 'EORGES
-AUCO ,ES mTRANGERS EN &RANCE LEUR RxLE DANS L´ACTIVITm mCONOMIQUE 0ARIS !RMAND #OLIN ¦ #HEZ NOUS EN BAS C´EST PLUS DIF½CILE DE COGNER LE CHARBON QUE DE TRIPATOUILLER DANS VOS PAPELARDS Lg
¯ 4U VAS ME DmNONCER ¯ .ON JE NE SUIS PAS UN DONNEUR MOI J´AI DU SANG D´HOMME MOI ¨ *E SERAI LE SEUL g SAVOIR QUE T´ES UN
FAINmANT 3EULEMENT TU VAS ME FAIRE UN PLAISIR MAINTENANT TU VAS DmBARRASSER LE PLANCHER 4´AS FAIT ASSEZ DE
MAL ICI 2IEN NE TE REGARDE TU TE FOUS DE TOUT TOI AH EN HAUT lA S´ARRANGE TOUJOURS QUE CE SOIT POUR LE C®UR
OU LA CARCASSE LES COUPS DURS C´EST POUR CEUX D´EN BAS
¯ !LORS QU´ESTCE QUE TU ATTENDS DE MOI ¯ 1UE TU TE DmBINES QUE TU FOUTES LE CAMP QUE TU DmBARRASSES LE PAYS §¨
/N COMPREND QU´IL N´Y AIT EU BESOIN POUR PASSER LE ½LM SOUS 6ICHY QU´g BIFFER AU GmNmRIQUE LES NOMS DES
TECHNICIENS JUIFS ET g TAIRE LE NOM DE $ALIO
# DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS Dans Dédée d’AnversG·<YHV$OOpJUHW'pGpH6LPRQH6LJQRUHW
s’échappe aussi des réalités sordides du port par la voix de velours du
WUDÀTXDQWLWDOLHQ)UDQFHVFR0DUFHO3DJOLHURHWVHVpYRFDWLRQVGHFODLUGH
lune napolitain. Bel homme, peu loquace, Francesco séduit par ses seules qualités – contrairement au fourbe Toni. Marcel Pagliero, ancien résistant, coscénariste de Paisa, joue aussi le rôle du résistant communiste dans
Rome, ville ouverte, et de l’ouvrier assassiné dans Les jeux sont faits
GH-'HODQQR\VFpQDULRGH-HDQ3DXO6DUWUH,OSDUDvWrWUHXQHpEDXFKHGH
Ralph Vallone.
Après la guerre, la force et la virilité, dans la représentation des Italiens,
l’emporte sur l’élégance. Dans La Maison sous la mer, l’étranger sauve la
femme (Viviane Romance) d’une chute de falaise, à la force de ses avantbras, comme il sauve son mari en se suspendant à un câble métallique
au-dessus de la mer.
Dans La Rage au corps OD MHXQH Q\PSKRPDQH )UDQoRLVH $Unoul), cantinière dans un barrage de haute montagne, s’enfuit à Paris avec
O·KRQQrWHFKHIGHFKDQWLHULWDOLHQ7RQLR%RUUHOOL5D\PRQG3HOOHJULQLGLW
5D\PRQG3HOOHJULQ'DQVLa Lumière d’en faceXQHMHXQHJLURQGH
et sensuelle ingénue (Brigitte Bardot), serveuse dans un routier tenu par
son mari (ancien camionneur devenu impuissant suite à un accident), vit
en face du bel Italien garagiste Pietri (Roger Pigault), plus musclé encore
que le restaurateur, et dont le débardeur comme le tatouage rappellent les
RXYULHUVSHLQWVSDU)HUQDQG/pJHU3LHWULÀOVGHPLQHXUDIXLOH1RUGSRXU
le soleil du Sud de la France. Forcément, chaleur et ennui aidant, la jeune
femme et le garagiste forment un couple (éphémère).
'DQVFHVGHX[ÀFWLRQV²FHTX·LO\DGHSOXV©RVpªGDQVODFLQpPDWRJUDSKLHGHVDQQpHVHWVHSUpVHQWDQWSRXUpYLWHUODFHQVXUH, comme
GHVpWXGHVTXDVLPpGLFDOHV©GHFDVª²OHVDXWHXUVRQWMXJpOHVWUDYDLOOHXUV
italiens comme étant seuls capables d’être les véritables partenaires d’une
Q\PSKRPDQHHWGHFHTXLDOODLWrWUH©ODERPEHVH[XHOOHGHVDQQpHVª
Sur un autre registre, à l’opposé de cette appréhension machiste de la
IHPPH *UpPLOORQ GDQV L’Amour d’une femme, a aussi mis en scène un
WUDYDLOOHXULWDOLHQ$QGUp/RUHQ]L0DVVLPR*LURWWLjO·LQVWDUGHVSURWDgonistes de La rage au corps, et de La Lumière d’en faceEpQpÀFLHG·XQVWDtut social relativement privilégié puisqu’il est ingénieur. Il est toutefois
proche de ses ouvriers, avec qui il loge et travaille. En plus estompé, il
UDSSHOOHO·LQJpQLHXU-HDQ*DELQGDQVLe TunnelGH.%HUQKDUGWLO
HVWVXUWRXWSURFKHGXFDSLWDLQHGXUHPRUTXHXUTXDVLKRPRQ\PH$QGUp
5NE CENSURE QUE LE JEUNE CRITIQUE &RANlOIS 4RUFFAUT RmCLAMA POUR ,A ,UMInRE D´EN FACE !RTS N€ MARS ¦ %LLE "RIGITTE "ARDOT SE BAIGNE NUE ET NE SAIT PAS QU´ON LA VOIT COMME ELLE GRIMPE DERRInRE LA MOTO ELLE
MONTRE SES GENOUX 3UR UNE CHAISE POUR ACCROCHER JE NE SAIS QUOI SES JAMBES SE LAISSENT VOIR /N A LE DROIT DE
PARLER ICI DE PORNOGRAPHIE ET DE S´INTERROGER SUR LA COMPLICITm INDULGENTE DE LA COMMISSION DE CENSURE¨ §
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI /DXUHQW DXVVL MRXp SDU -HDQ *DELQ GDQV Remorques GH -HDQ *UpPLOORQ/HFLQpDVWHLQYHUVHWRXWHIRLVVRQSURSRVHQWUHVHVGHX[ÀOPVVL
OHSUHPLHUYRLWO·KRPPHVDFULÀHUODIHPPHjVRQPpWLHUHWjODPHUGDQV
OH VHFRQG OD IHPPH PpGHFLQ j O·vOH G·2XHVVDQW SUpIqUH YRLU SDUWLU VRQ
DPDQWSOXW{WTXHGHOXLVDFULÀHUVRQPpWLHU0DULH0LFKHOLQH3UHVOHHVW
LFLOHSHUVRQQDJHFHQWUDOO·KpURwQHGHODQDUUDWLRQ$XWDQWVRQU{OHHVWpODboré et crédible, que celui de l’Italien est schématique. Celui-ci est beau,
grand (plus que les îliens) ; il a le regard droit, ce qui, dans les canons cinématographiques de l’époque, indique la franchise. Il est de plus costaud,
puisqu’il se bagarre contre trois îliens à la fois. André Lorenzi est toutefois
obtus ; il se contente souvent de dire que, dans le couple, comme le veut la
tradition, la femme doit vivre avec et pour son mari. Il somme d’ailleurs
O·KpURwQHG·DUUrWHUVRQWUDYDLOSDUFHTXHFHGHUQLHUSRXUOHVIHPPHV©Q·HVW
ERQTXHSRXUOHVFpOLEDWDLUHVªHWTXH©OHSOXVEHDXPpWLHUHVWFHOXLGH
PqUHGHIDPLOOHª6LO·,WDOLHQGDQVOHÀOPHVWHQWUHYXFRPPHXQHpYDVLRQ
possible – toute île est une prison, il est surtout perçu, comme la tradition,
HPSrFKDQWO·pPDQFLSDWLRQGHODIHPPH­ODVRUWLHGXÀOPTXDVLFRQÀdentielle), la critique ne releva pas le schématisme des personnages. Un
MRXUQDOLVWH/RXLV'HOXFpFULYLWG·DLOOHXUVFHVSURSRVUpYpODWHXUV
« L’ingénieur veut épouser Marie, mais il est Italien et n’accepte pas
qu’une femme soit autre chose qu’épouse et mère de famille17ª
Le travailleur italien après-guerre est donc un homme de parole, fort
et beau, courageux et peu loquace ; il est néanmoins fruste et possessif,
parfois colérique et implacable18. Les compositions de Ralph Vallone semEOHQWrWUHODPLVHHQVFqQHGHFHVVWpUpRW\SHVFRXUDQWVGDQVO·RSLQLRQGH
l’après-guerre. Cet acteur italien, aussi journaliste culturel de l’Unità, inFDUQD VRXYHQW JUkFH j VRQ SK\VLTXH OHV EHDX[ PkOHV HW OHV FRXUDJHX[
SUROpWDLUHV,OVHÀWUHPDUTXHUGDQVRiz amerGH*LXVHSSH'H6DQWLV
et joua le rôle d’un mineur dans Le Chemin de l’espéranceGH3LHWUR
*HUPL ÀOP GpFULYDQW OHV SpUpJULQDWLRQV HW OHV GpERLUHV G·XQ JURXSH GH
mineurs siciliens qui, après la fermeture de leur mine, traversent toute
O·,WDOLHHWOHV$OSHVSRXUDUULYHUFODQGHVWLQHPHQWHQ)UDQFH©SD\VGHFR
,A VIE DES )TALIENS EN &RANCE EST POURTANT UN THnME QUI SEMBLE AVOIR INTmRESSm 'RmMILLON 5N DE SES PREMIERS
MmTRAGES HmLAS AUJOURD´HUI INTROUVABLE S´INTITULE ,A 6IE DES TRAVAILLEURS ITALIENS EN &RANCE )L mCRIVIT DE
PLUS APRnSGUERRE UN SCmNARIO SUR UNE TROUPE AMBULANTE DE THmhTRE ITALIEN ARRIVANT g 0ARIS LE JOUR DE LA 3AINT
"ARTHmLEMY
#´EST NOUS QUI SOULIGNONS
2OGER 6AILLAND AVEC "EAU MASQUE 'ALLIMARD A CRmm UN PERSONNAGE D´OUVRIER ITALIEN CONDENSANT BEAU
COUP DE CES STmRmOTYPES ET FANTASMES ¦ #´EST UN )TALIEN UN 0ImMONTAIS QUI S´APPELLE DE SON VRAI NOM "ELMASCHIO CE QUI SIGNI½E BEAU MhLE ¨ $E
TAILLE PLUTxT GRANDE MAIGRE LA MUSCULATURE TRnS DmVELOPPmE LA POITRINE BROUSSAILLEUSE LE POIL NOIR ¨ "EAU
-ASQUE REND VOLONTIERS SERVICE LE GESTE RAPIDE ET S}R CAPABLE DE SOULEVER UN SAC DE CENT KILOS AVEC AUTANT
D´AISANCE QU´IL MANIE LES ½LS DmLICATS D´UNE POMPE mLECTRIQUE ¨ LES FEMMES ¨ RIENT VOLONTIERS AVEC LUI #E
N´EST PAS QU´IL SOIT BEAUCOUP PLUS BAVARD AVEC ELLES ¨ 3ON ®IL RESTE MALICIEUX ET MoME DUR )L TROUVE TOUT DE
SUITE LE REGARD DE L´AUTRE 5NE SORTE DE COMPLICITm S´mTABLIT ENTRE "EAU -ASQUE ET N´IMPORTE QUELLE FEMME §
# DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS FDJQHª5DOSK9DOORQHVHUHQGLWDXVVLFpOqEUHHQ)UDQFHHQLQWHUSUpWDQWOH
rôle d’un docker dans la pièce d’Arthur Miller, Vu du pont. C’est Charles
6SDDNHW0DUFHO&DUQpTXLHQDGDSWDQWOHOLYUHGH=RODThérèse Raquin,
ÀUHQWGH/DXUHQWXQ,WDOLHQMRXpSDU5DOSK9DOORQH6DGRXOpFULYLWDYHFMXVWHVVHTXH©/HKpURVTXHFDPSH5DOSK9DOORQHHVWOHIUqUHGHFHOXLTX·LQFDUQH*DELQGDQVG·DQFLHQVÀOPVGH&DUQp8QKRPPHOLEUHXQOLEHUWDLUH
PrPHVDQVDXFXQSUpMXJpFROpUHX[IRQFLqUHPHQWERQªLettres françaises,
QƒPDUV/HFULWLTXHUHPDUTXDDXVVLTXH©OHFROpUHX[/DXUHQWª
ici un camionneur piémontais, est également le frère du cheminot joué par
*DELQGDQVLa Bête humaine (1938), de Renoir. Ralph Vallone, quant à lui,
GpÀQLWDLQVLVRQU{OH
©/DXUHQWHVWLWDOLHQGDQVOHÀOP,OHVWG·XQHLQWHUSUpWDWLRQDVVH]FRPplexe, parce que toutes ses réactions sont élémentaires. Le personnage est
WUqVVLPSOLÀpHQHIIHWSDUUDSSRUWjFHTX·LOHVWGDQVOHURPDQ«­YUDL
dire, il ne “pense” pas ses sentiments, il les vit et les agit. C’est un être tout
LQVWLQFWLIªLettres françaisesQƒRFWREUH
Deux regards, diégétiques, permettent de mieux cerner encore la personnalité de Laurent, celui de Thérèse (Simone Signoret) et celui du maître
FKDQWHXU5RODQG/HVDIIUH²TXHODFHQVXUHDIDLWUHYHQLU©GX-DSRQªHW
non d’Indochine, comme le souhaitait Carné.
7KpUqVHGLWDLQVLj/DXUHQW
« Je vous admire, Laurent, vous êtes fort, vous êtes libre. Quand vous
voulez quelque chose, c’est tout de suite. (Vous êtes) un homme, un
YUDLª
/HUHJDUGGXPDvWUHFKDQWHXUVXU/DXUHQWOXLHVWWHLQWpG·LURQLH
« C’est un violent », « Il est têtu mais un peu bête », « Dis donc, il est pas
toujours bête ».
Les travailleurs italiens, malgré leur magnétisme, n’en restent pas
PRLQV GHV rWUHV SULPDLUHV /·DQLPDOLWp DWWULEXpH j FHV SUROpWDLUHV GpÀQLW
encore leur caractère dans le cinéma de l’après-guerre ; ces caractères sont
schématiquement regroupés autour d’un pôle positif et d’un pôle négatif,
ODYLULOLWpHWOH©SULPLWLYLVPHª
Après la guerre, le discours raciste n’est toutefois plus porté par les
héros comme dans GrisouPDLVSDUGHVSHUVRQQDJHVPpGLRFUHVRXSLWR\Dbles, à côté desquels les Italiens paraissent être les seuls hommes véritables. Le cinéma ne peut plus être ouvertement xénophobe (comme il
ne peut plus être grossièrement antisémite). L’Italien séduit toujours mais
par son seul charisme, il n’a plus à utiliser la ruse et les boniments pour
conquérir les femmes qui se jettent naturellement dans ses bras. D’un
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI homme à femmes, il devient l’homme qui attire les femmes. Il leur est
ÀGqOHFRPPHLOHVWH[FOXVLI
Dans La Maison sous la mer, deux remarques acerbes sont adressées à
l’étranger, mais ces paroles de rejet ne sont pas prononcées par des êtres
DYHF TXL OH SXEOLF SHXW V·LGHQWLÀHU 8Q PLQHXU H[FpGp SDU OH IDLW TXH
&RQVWDQW0HUFLHUDLWDFFHSWpXQWUDYDLOVRXVSD\pHWGDQJHUHX[OXLGLW
©dDP·pWRQQHSDVW·HVSDVXQYUDLPLQHXUª
Le mari trompé s’écrie aussi, au bord des larmes (et cela est révélateur
G·XQH[pQRSKRELHODWHQWHGXPRQGHRXYULHUSOXVH[SRVpjODFRQFXUUHQFH
« T’as pas de parole, t’es rien, t’es même pas d’ici ! Tu viens prendre
QRWUHWUDYDLOKHLQHWWXYRXGUDLVDXVVLSUHQGUHQRVIHPPHV"ª
Plus lamentable encore est Camille, le mari de Thérèse Raquin. Celui-ci,
après avoir voulu acheter Laurent, l’avoir menacé de lui faire retirer sa
FDUWHGHWUDYDLOHWGHOXLHQYR\HUODSROLFHHWOHVJHQGDUPHVV·pFULH
©7RXVOHVPrPHV2QYRXVDFFHSWHFKH]QRXVRQYRXVQRXUULWHWYRXV
HQSURÀWH]SRXUIDLUHYRVVDOHWpVª
Ce discours raciste, porté ici par un être ridicule, méchant et lâche (en
plus d’être malingre et laid) est de fait invalidé. Seuls restent les clichés
SOXV RX PRLQV [pQRSKREHV TXL RQW SHUPLV G·DSSUpKHQGHU OD ÀJXUH GX
Piémontais.
Thérèse RaquinQ·HVWSDVOHVHXOÀOPjGUHVVHUXQSRUWUDLWVLDFFDEODQWGX
PDULKDELWXHOOHPHQWV\PEROHGHSRXYRLUHWGHIRUFH²FRPPHOHSqUH/H
mari est par exemple ivrogne et brutal dans Les Frères Bouquinquant de DaTXLQHWUn homme marche dans la villeGH3DJOLHUROkFKHHWSHUÀGHGDQVLes Portes de la nuitGH&DUQpVDGLTXHHWYHXOHGDQVDédée
d’Anvers, réduit à un rôle de marionnette sénile dans Une si jolie petite plage
G·<YHV$OOpJUHWLPSXLVVDQWGDQVLa Lumière d’en face… De plus, les
jeunes héros du Point du jourGH'DTXLQHWGHLa Grande vie
GH*LOOHV6FKQHLGHUVRXIIUHQWGHO·DEVHQFHGXSqUH&HGHUQLHUHVWLQÀUPH
et un moment trompé par sa femme dans Les orphelins de Saint-Vaast
GH-HDQ*RXUJXHW2XWUHOHPDODLVHTXHFHUWDLQVKRPPHVUHVVHQWLUHQWGHvant la reconnaissance politique de la place de la femme (conquise après la
JXHUUHGHRQSHXWSHXWrWUHYRLUGDQVFHVLPDJHVO·pFKRG·XQH
opinion, élevée dans le culte des chefs et désarçonnée devant le spectacle
d’une République, vécue comme impuissante, alors que s’affrontent « les
GHX[JUDQGVª/HWUDYDLOOHXULWDOLHQDSSDUDvWFRPPHXQPRGqOHGHIRUFH
HWGHVWDELOLWp²ODSUpÀJXUDWLRQG·XQWLHUVPRQGHVDOYDWHXU"(QÀQXQERQ
©ERQVDXYDJHª"
La présence du travailleur italien dans le cinéma de l’après-guerre s’exSOLTXHDXVVLWRXWHIRLVGHPDQLqUHSOXVSURVDwTXH3RXUWHQWHUGHVDXYHUOH
# DE 2%#)43 /UVRIERS ITALIENS DANS LE CINmMA FRANlAIS FLQpPDIUDQoDLVDSUqVOHVDFFRUGV%OXP%\UQHVTX·LODYDLWUDWLÀpVO·eWDW
IUDQoDLVjSDUWLUGHIDYRULVDOHVFRSURGXFWLRQVDYHFOHFLQpPDLWDOLHQ
SDUHLOOHPHQWPHQDFp&HV\VWqPHFRPSUHQDLWGHVFODXVHVSUpFLVHVTXLQH
furent pas toujours respectées à la lettre, exigeant par exemple « que l’apport du producteur minoritaire doit comporter obligatoirement (…) au
moins un assistant metteur en scène, un auteur, un acteur d’un rôle prinFLSDOHWXQDFWHXUG·XQU{OHVHFRQGDLUHª192QDVVLVWHGRQFSDUGHOjOHV
$OSHV j TXHOTXHV pFKDQJHV G·KRPPHV GH FLQpPD -HDQ *DELQ HW 5DOSK
Vallone se croisèrent sur les routes parfois hasardeuses des coproductions.
/HSUHPLHUMRXDDYHF,VD0LUDQGDGDQVOHEHDXÀOPIUDQFRLWDOLHQGH5HQp
Clément, Au-delà des grillesL’air de Paris, Thérèse Raquin, L’Amour
d’une femme, La Meilleure part, Cela s’appelle l’auroreGH%XxXHOVRQW
aussi des coproductions. Celles-ci furent pour certains grands réalisateurs
G·DYDQWJXHUUH FRPPH *UpPLOORQ OH PR\HQ G·REWHQLU GH O·DUJHQW TX·RQ
OHXUUHIXVDLWHQ)UDQFH/HVÀOPVpWDQWSURMHWpVHQ,WDOLHHWHQ)UDQFHSURducteurs et réalisateurs s’interdisaient de montrer de manière trop négaWLYHOHVUHVVRUWLVVDQWVGHOHXUSD\V'HSOXVLOVHQSURÀWDLHQWSDUIRLVSRXU
JOLVVHUTXHOTXHVFDUWHVSRVWDOHVGHOHXUSURSUHSD\VSRXUDFFURvWUHOHSUHVtige de celui-ci à l’étranger.
Si Carné a fait de l’identité italienne de Ralph Vallone un élément dramatique dans Thérèse RaquinRQVHQWELHQTXH©ODIDPLOOHLWDOLHQQHW\SHª
dans L’Air de Paris, n’est pas principalement là qu’à cause des exigences de
la coproduction. Sadoul écrit d’ailleurs dans Les Lettres françaisesQƒ
VHSWHPEUHTXH©F·HVWPDOJUpHX[OHVDFWHXUVTXHODIDPLOOHG·pSLciers qu’ils incarnent est à peine plus vivante que des personnages peints
VXUODWRLOHG·XQGpFRUª/HUHJDUGSRUWpVXUFHWWHIDPLOOHLWDOLHQQHG·RULJLQHVLFLOLHQQHHVWWRXWHIRLVUpYpODWHXUVFKpPDWLTXHHWV\PSDWKLTXHLOLQsiste sur l’enracinement sans heurt de cette brave famille. Celle-ci, en effet, tient commerce, travaille sans compter, partage chaleureusement son
repas avec ses voisins et amis français (le couple français et le père italien
UHVWHQWDVVLVVDIHPPHHWVDÀOOHVLOHQFLHXVHVVHOqYHQWSRXUVHUYLU4XDQG
le jeune commis français (Rolland Lesaffre) combat à la boxe un Italien, Sicilien de surcroît, le père soutient son compatriote dans sa langue, mais la
mère, en italien aussi, encourage le Français – la salle, elle, est séparée seORQOHVGHX[QDWLRQDOLWpV/DMHXQHÀOOHELHQV€UHVWDPRXUHXVHGXER[HXU
PDLVLOO·LJQRUHGXUDQWWRXWOHÀOP/DIDPLOOHLWDOLHQQHV·LQWqJUHLFLSDUOH
sport, le travail et le commerce.
Si cette famille est ici « à peine plus vivante que des personnages sur
OD WRLOH G·XQ GpFRU ª OHV WUDYDLOOHXUV PDJKUpELQV VRQW SOXV GLVFUHWV HQcore. Ils n’ont le droit ni aux noms, ni même à des visages. Dans le bar de
#ITm PAR *EAN,OUP 0ASSEK $ICTIONNAIRE DU #INmMA 0ARIS ,AROUSSE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0%22/. 4ANGUI O·K{WHORORJHOHMHXQHER[HXUOHV©1RUG$IULFDLQVªIRUPHQWXQHPDVVH
imprécise jouant aux cartes et écoutant de la musique arabe. Pourtant,
comme Carné a voulu montrer l’enracinement exemplaire d’une famille
d’Italiens, sans doute a-t-il souhaité dénoncer les conditions de vie imposées aux travailleurs maghrébins. Le jeune boxeur et la patronne de l’hôtel
pFKDQJHQWDLQVLFHVSURSRV
© 0RQVLHXU 0pQDUG OHV ÁLFV VRQW YHQXV LOV HQ RQW HQFRUH HPSRUWp
trois !
– Et après ?
– Attaque nocturne, à ce qu’il paraît. Vous parlez d’une clientèle !
²(OOHYRXVUDSSRUWHOHPD[LPXPQRQ"&LQTW\SHVSDUFKDPEUHHWXQ
VHXOOLWoDYRXVVXIÀWSDV"ª
Il n’en reste pas moins que dans L’Air de Paris LO \ D XQH KLpUDUFKLH
des représentations, plaçant à son sommet l’entraîneur breton et le boxeur
parisien. Les Italiens sortent de l’ombre sans connaître la lumière des sunlights,OVRQWWURXYpSOXVEDVTX·HX[OHVWUDYDLOOHXUVDOJpULHQV
<YHV$OOpJUHWSDUIRLVVXUOHWRQGHODFRPpGLHMRXHGHFHFRQWUDVWHGDQV
La Meilleure part. Travailleurs italiens et travailleurs algériens vivent séparément, les premiers méprisant même les derniers. Le cuisinier italien entre
par exemple chez les Arabes en se bouchant le nez, critiquant avec un fort
DFFHQWOHVP±XUVGHV©ELFRWVª/·LQWpJUDWLRQGHV,WDOLHQVSDVVHLFLSDUOH
mépris vis-à-vis des nouveaux venus – ce qui rappelle le début de Toni.
La Meilleure part s’ouvre par l’arrivée à pied d’un jeune Arabe venant
quémander du travail alors qu’un ouvrier a fait une chute mortelle ; il
V·DFKqYHSDUODPRUWGHFHMHXQH$UDEHEUR\pGDQVXQFRQFDVVHXU/HGHVtin des Algériens en France, dans le cinéma, ne semble guère plus brillant
que celui des Italiens jusqu’à L’Air de Paris²PDLVODV\PSDWKLHHWODVROOLFLWXGHG·$OOpJUHWSDUDLVVHQWLFLVLQFqUHV/HSURSRVGXÀOPYXODFHQVXUH
qui régnait pendant la guerre d’Algérie, est relativement courageux.
/HSURÀOGHO·RXYULHULWDOLHQGXGpEXWGHVDQQpHV©IRUWIUDQFHW
IUXVWHªDSUqVDYRLUpWpIRXUEHGDQVOHVDQQpHVVHPEOHV·HVWRPSHU
tandis que celui du travailleur algérien, malgré quelques tentatives, ne
peut s’imposer. L’enracinement tranquille est indiqué sans pour autant
devenir un thème prégnant, comme le fantasme de virilité. Peut-être cela
annonce-t-il l’effacement de l’ouvrier italien des écrans français, ce moment correspondant aussi au début de la Ve République et à l’apparition
GHOD1RXYHOOH9DJXHTXLIXWSDUUDSSRUWjODJpQpUDWLRQSUpFpGHQWHSOXV
indifférente encore aux sorts et aux destins des ouvriers.
# DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN ,E 3EL DE LA TERRE DE "IBERMAN
,AURENT 'ARREAU
,% #).b-! !-b2)#!). %4 ,! ¦ #(!33% !58 3/2#)È2%3 §
« Je suis assis avec vous, à Cannes, en France, et je ne peux parler de
cette époque sans indiquer la dette que j’ai envers les Français, envers
ceux qui travaillaient dans le cinéma ou dans les journaux, car j’ai reçu une
invitation pour aller recevoir à Paris, au cours d’un dîner chez Maxim’s,
O·pWRLOHGHFULVWDOGHO·DFDGpPLHGXFLQpPDSRXUOHPHLOOHXUÀOPpWUDQJHU
montré en France cette année-là, et mon gouvernement ne m’a pas laissé
SDUWLUHWO·LQGXVWULHUHIXVDLWGHPRQWUHUPRQÀOPHQ$PpULTXH8QMRXU
j’ai reçu chez moi un paquet de critiques provenant des journaux et des
magazines français, et je n’oublierai jamais ce moment, jusqu’au dernier
MRXUGHPDYLHMHOHVOLVDLVOHVXQHVDSUqVOHVDXWUHVHWOjRQGLVDLWTXH
=RODDXUDLWDGRUpHWDLOOHXUVTXHYRLUFHÀOPF·pWDLWGpFRXYULUXQHDXWUH
$PpULTXHHWGDQVXQHDXWUHTXHFHÀOPDOODLWGHYHQLUXQJUDQGFODVVLTXH
DPpULFDLQª
Herbert J. Biberman1
/·KLVWRLUHGXPDFFDUWK\VPHj+ROO\ZRRGHVWUHODWLYHPHQWFRQQXH&H
qui l’est sans doute nettement moins, ce sont les causes profondes et les
UpSHUFXVVLRQVTXHFHWWHFKDVVHDX[VRUFLqUHV©URXJHVªHW©MDXQHVªHXUHQW
dans le monde et notamment comment elle était perçue en France et en
(XURSH /D VRUWLH GX ÀOP Le Sel de la terre en France donna l’occasion à
la presse et la critique françaises de commenter des événements si révélateurs de l’antagonisme moral, culturel et politique des deux blocs aux
débuts de la guerre froide.
"ERTRAND 4AVERNIER !MIS AMmRICAINS ENTRETIENS AVEC LES GRANDS AUTEURS D´(OLLYWOOD ,YON )NSTITUT ,UMInRE
!CTES SUD RE mDITION RmmDITION REVUE ET ENRICHIE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT 3RXUPLHX[DSSUpFLHUODSRUWpHHWODYDOHXUGXÀOPLOIDXWUHPRQWHUOH
WHPSVHWFKHUFKHUOHVUDFLQHVKLVWRULTXHVGHODSV\FKRVHDQWLFRPPXQLVWH
TXLVLHOOHVHPDQLIHVWHGDQVOHVDQQpHVDGHVVLJQHVDYDQWFRXUHXUV
GqV OHV DQQpHV /HV IDLWV GRQW OH ÀOP V·LQVSLUH VRQW j PHWWUH VXU OH
même plan que l’histoire de ce tournage épique s’il en est. Dans les deux
FDVFHVRQWGHVSDULDVGXV\VWqPHGRPLQDQWTXLVRQWOHVÀJXUHVFHQWUDOHV
et qui prennent leurs destins en main, qui refusent la fatalité de l’ostracisme et de l’exclusion et qui s’opposent énergiquement à l’aliénation à laTXHOOHOHSOXVIRUWHWODPDMRULWpYRXODLHQWOHVVRXPHWWUH&HÀOPSHXWGRQF
s’interpréter comme un acte de résistance à la chasse aux communistes qui
V·DEDWVXU+ROO\ZRRGSHQGDQWXQHWUHQWDLQHG·DQQpHV
,%3 !.#Å42%3 $% -!##!24(9
/HVSUHPLHUVVLJQHVGHFHWWHK\VWpULHVRQWGRQFUHSpUDEOHVGqVOHVDQnées 1930. Comme en témoigne la propagande américaine de l’époque, le
communisme n’était pas une notion très claire et évidente. La première
©+RXVH&RPPLWWHHRQ8Q$PHULFDQ$FWLYLWLHVªOD&RPPLVVLRQGHVDFWLYLWpV DQWLDPpULFDLQHV +8$& HVW FUppH HQ (OOH OXWWH FRQWUH OHV
associations subversives sur le territoire des États-Unis. Son président est
alors un représentant démocrate du Texas. Très conservateur, Martin Dies
DG·DLOOHXUVpFULWXQSDPSKOHWLQWLWXOpThe Trojan Horse in America © OH FKHYDO GH 7URLH DX[ eWDWV8QLV ª ,O V·DWWDTXH VXU SOXV GH WURLV
cents pages, au péril communiste et, sur seulement une petite quarantaine
de pages, au danger fasciste. Il apparaît rapidement que ce qui est d’abord
mis en cause dans l’idéologie communiste, c’est son origine soviétique et
l’atteinte qu’elle risque de porter à l’indépendance des États-Unis d’Amérique. Par là même, des membres du parti démocrate peuvent être parmi
les plus farouches adversaires du communisme. En même temps, une
PDUJHGHOLEHUWpSROLWLTXHHVWWRXWGHPrPHODLVVpHj+ROO\ZRRGXVLQHj
rêves, qui peut promouvoir et exporter le modèle américain (étatsunien,
devrait-on dire) de liberté et de démocratie. Dès lors que le message liEHUWDLUHHVWWHQXSDUGHERQV:$63:KLWH$QJOR6D[RQ3URWHVWDQWLOHVW
ELHQPLHX[YX&·HVWFHWWHWROpUDQFHTXLMXVWLÀHOHVOHFWXUHVSURJUHVVLVWHV
GH6WDQOH\&DYHOOGDQVVRQOLYUHPursuits of happiness: the Hollywood comedy
of remarriage DX VXMHW GH QRPEUH GH FODVVLTXHV GX FLQpPD KROO\ZRRGLHQ
des années 1930 en faveur de l’émancipation des femmes dans une société
américaine encore patriarcale et conservatrice.
-ARTIN $IES 4HE 4ROJAN (ORSE IN !MERICA .EW 9ORK $ODD -EAD #OMPANY # DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN Mais quelques personnalités politiques comme Martin Dies n’hésitent
pas à faire l’amalgame entre progressisme et communisme et concentrent
OHXUVDWWDTXHVVXUOHSDUWLGH0RVFRXHQV·DSSX\DQWVXUGHVFKLIIUHVGH
jOHQRPEUHG·DGKpUHQWVDXSDUWLFRPPXQLVWHDPpULFDLQDGRXEOpSDVVDQWGHj(QSOHLQNew Deal, c’est un parti qui attire
les professions artistiques et intellectuelles, en somme des professions qui
SHXYHQWLQÁXHQFHUO·RSLQLRQSXEOLTXH(QOHSDUWLFRPPXQLVWHDPpULFDLQ FUpp XQH VHFWLRQ j +ROO\ZRRG 3DUPL OHV WURLV FHQWV FRPPXQLVWHV
DORUVLGHQWLÀpVGDQVO·LQGXVWULHKROO\ZRRGLHQQHODPRLWLpVRQWVFpQDULVWHV &HV GHUQLHUV V·HIIRUFHQW GH GRQQHU XQ FRQWHQX VRFLDO j OHXUV ÀOPV
/HVJUDQGVVWXGLRVKROO\ZRRGLHQVYRLHQWDORUVGDQVOHXUV\QGLFDOLVDWLRQ
OHUpYpODWHXUG·XQHLQÁXHQFHVLQRQG·XQFRPSORWFRPPXQLVWH
,% $b6%,/00%-%.4 $´5.% 3%.3)"),)4b 0/,)4)15% ª (/,,97//$
3DUPLHX[+HUEHUW%LEHUPDQHVWO·XQGHVSUHPLHUVjSUHQdre conscience de la menace du fascisme pour la paix mondiale. Il s’assoFLHjG·DXWUHVSHUVRQQDOLWpVSRXUFUpHUODOLJXHDQWLQD]LHG·+ROO\ZRRGHQ
2Q \ WURXYH FHUWHV GHV FRPPXQLVWHV PDLV SDV VHXOHPHQW 'RQDOG
2JGHQ 6WHZDUW 3 qui recevra l’oscar de la meilleure adaptation pour The Philadelphia Story GH *HRUJHV &XNRU XQH GHV
FRPpGLHVGXUHPDULDJHDQDO\VpHSDU6WDQOH\&DYHOOPLOLWHDYHFOXLHWDYHF
&KDUOHV%UDFNHWWDYHF'XGOH\1LFKROV'DVKLHOO
+DPPHWWRX'RURWK\3DUNHU'DQVO·HQWUHWLHQTXH
%HUWUDQG 7DYHUQLHU UpDOLVH DYHF OXL HQ +HUEHUW - %LEHUPDQ UHYLHQW
VXUVRQFKHPLQHPHQWSHUVRQQHOYHUVO·DFWLRQSROLWLTXHFROOHFWLYH©-·DYDLV
besoin de ce genre d’association, d’action, moi qui n’étais intéressé que
SDUPRLPrPHTXHSDUPD©FUpDWLRQDUWLVWLTXHªPHVSURJUqVGHWHFKnicienª&HWWHVROLGDULWpDX[SUHPLqUHVYLFWLPHVGXQD]LVPHHWDX[UpIXgiés ne fait pas de lui un communiste au sens traditionnel, juste la prédisSRVHWHOOHDORUVjFHWWHLQÁXHQFHLGpRORJLTXH$\DQWSULVSRVLWLRQFRQWUH
les monopoles qui empêchent la libre concurrence, il s’est mis à dos à la
IRLVO·LQGXVWULHKROO\ZRRGLHQQHHWOHVDQWLURXJHV5pWURVSHFWLYHPHQWVRQ
$ONALD /GDEN 3TEWART PRmSIDA LA LIGUE ANTINAZIE AU MOMENT DE SA CRmATION )L EST L´UN DE CEUX QUI CHOISIRENT
DE S´EXILER g ,ONDRES AU PLUS FORT DE LA CHASSE AUX SORCInRES g (OLLYWOOD
#HARLES "RACKETT RElUT L´OSCAR DE LA MEILLEURE ADAPTATION POUR 4HE ,OST 7EEKEND ,E 0OISON DE "ILLY 7ILDER
EN ET LES OSCARS DU MEILLEUR SCmNARIO POUR 3UNSET "OULEVARD mGALEMENT DE "ILLY 7ILDER ET
POUR Titanic DE *EAN .EGULESCO $ASHIELL (AMMETT ROMANCIER ET AUTEUR DU &AUCON MALTAIS A PASSm QUELQUES MOIS EN PRISON POUR AVOIR REFUSm
DE TmMOIGNER LORS D´UN PROCnS ACCUSANT DES COMMUNISTES 3A COMPAGNE ,ILLIAN (ELLMAN RAPPOR
TE QU´ILS DURENT VENDRE LEUR PROPRImTm DE 0LEASANTVILLE g CAUSE DU HARCnLEMENT DONT L´ADMINISTRATION ½SCALE
LES ACCABLAIT 3COUNDREL 4IME ,ONDON -ACMILLAN P SQ
"ERTRAND 4AVERNIER !MIS AMmRICAINS¨ OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT WpPRLJQDJHSDUDvWFRQIRQGDQWGHQDwYHWpHWG·LQQRFHQFH©9HQDQWG·XQ
PLOLHXWUqVERXUJHRLVMHVXLVDUULYpj+ROO\ZRRGHQFUR\DQWjO·DUWSRXU
l’art. Je n’avais aucune pensée politique, bien que j’aie monté deux pièces
soviétiques. Je les ai mises en scène comme un homme qui avait beaucoup
de respect pour le peuple soviétique, mais qui ne connaissait rien à la politique de ce peuple. Je ne m’intéressais pas à la politique7ª$X[\HX[GHV
anticommunistes, le simple intérêt aux questions sociales est déjà suspect.
­IRUFHGHF{WR\HUGHV©SURJUHVVLVWHVªLOHVWVHQVLEOHjFHVVXMHWV©FRQQRWpVªHWPrPHWDERXV6RQDFWLYLVPHDQWLIDVFLVWHHWJDXFKLVDQWVHUDWUqVPDO
perçu non seulement par les milieux conservateurs mais également par
les hommes d’affaires et les studios qui refusent d’abandonner le marché
allemand. Entre ceux qui sont hostiles à l’idéologie communiste et ceux
TXLYHXOHQWpWHLQGUHGDQVO·±XIWRXWHVYHOOpLWpVSROLWLTXHVRXV\QGLFDOHV
XQHSRLJQpHGHFUpDWHXUVKROO\ZRRGLHQVRVHQWDSSHOHUDXER\FRWWFRPSOHW
de l’Allemagne nazie8 ou à la suspension de la vente d’armes au Japon
au moment de l’invasion de la Mandchourie. À l’occasion d’actions reWHQWLVVDQWHV OH SHWLW PRQGH G·+ROO\ZRRG GpFRXYUH SURJUHVVLYHPHQW FH
qui se passe dans le monde entier. Il n’en restera pas là. En mettant leur
créativité au service de causes sociales et politiques, les scénaristes miliWDQWVYHXOHQWSUpSDUHUOHVHVSULWVGHOHXUVFRQFLWR\HQVjODJXHUUH/·DQQpHHVWFKDUQLqUH+ROO\ZRRGVHIHQGDORUVGHÀOPVSDWULRWLTXHVHW
bellicistes avec la bénédiction de l’administration Roosevelt. L’heure n’est
plus à la persécution invétérée des rouges mais plutôt à la collaboration
VWUDWpJLTXHDYHFXQWUqVSUREDEOHIXWXUDOOLp'HVÀOPVFRPPH4XDWUHÀOV
G·$UFKLH0D\RSergent York G·+RZDUG+DZNVRX
Mystery Sea Reader G·(GZDUG'P\WU\NSODLGHQWHQIDYHXUGH
O·LQWHUYHQWLRQDPpULFDLQHGDQVOHFRQÁLWPRQGLDO0DLVLOOXLIDXGUDDWWHQGUHGpFHPEUHHWO·DWWDTXHGH3HDUO+DUERUSRXUTXHOHVeWDWV8QLV
HQWUHQWHQJXHUUHDX[F{WpVGHV6RYLpWLTXHV'qVORUVOHVÀOPVGHJXHUUH
antijaponais se multiplient. Les anti-rouges voient leurs pires cauchemars
VHUpDOLVHU'HVVWXGLRVKROO\ZRRGLHQVYRQWMXVTX·jSURGXLUHGHVÀOPVGH
SURSDJDQGHSURUXVVH$LQVL%HUWUDQG7DYHUQLHUFRQVLGqUHWLOOHÀOPMission à Moscou GH0LFKDHO&XUWL]SURGXLWSDUOHVIUqUHV:DUQHU
HQFRPPHOHÀOPOHSOXVSURFRPPXQLVWHGHO·KLVWRLUHGXFLQpPD9 ! Le
)BID P ,E QUOTIDIEN BRITANNIQUE $AILY %XPRESS AVAIT mTm LE PREMIER g LANCER CET APPEL AU BOYCOTT DES PRODUITS AL
LEMANDS DnS LE LENDEMAIN DE L´ACCESSION D´!DOLPH (ITLER g LA #HANCELLERIE 3A UNE DU MARS TITRAIT ¦ *UDEA $ECLARES WAR ON 'ERMANY § ET APPELAIT AU ¦ BOYCOTT OF 'ERMAN GOODS § EN S´ADRESSANT AUX MILLIONS
DE JUIFS DISPERSmS DE PAR LE MONDE ,E JOURNAL INFORMAIT SON LECTORAT QU´g .EW 9ORK ANCIENS SOLDATS
JUIFS S´mTAIENT RENDUS g L´HxTEL DE VILLE POUR PROTESTER ET RmCLAMER AU MAIRE SON SOUTIEN DANS LE BOYCOTT DES
PRODUITS ALLEMANDS 4OUS LES RABBINS DE LA VILLE DEVAIENT CONSACRER LEUR SERMON DU LENDEMAIN g L´mPREUVE DES
JUIFS EN !LLEMAGNE
0ROPOS RECUEILLIS PAR 0ATRICK 2OTMAN DANS L´mMISSION ¦ ,ES "R}LURES DE L´(ISTOIRE #HASSE AUX SORCInRES g (OL
LYWOOD § DIFFUSmE LE MAI SUR &RANCE # DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN ÀOPChant de Russie GH*UHJRU\5DWRIIHQSHLQWO·LPDJH
LG\OOLTXHG·XQYLOODJHUXVVH/HVPHWWHXUVHQVFqQHVFpQDULVWHVDFWHXUVGH
FHVÀOPVDSSDUHQWpVFRPPXQLVWHVRXQRQVHURQWSOXVWDUGFRQYRTXpVSDU
ODFRPPLVVLRQGHVDFWLYLWpVDQWLDPpULFDLQHVTXLVHUDFKDUJpHGH©SXUJHUª
O·LQGXVWULHKROO\ZRRGLHQQHGHV©FRPSORWHXUVª
,% -52 $´(/,,97//$
$X OHQGHPDLQ GH OD YLFWRLUH DOOLpH OHV VWXGLRV KROO\ZRRGLHQV HW OD
SOXSDUWGHVFUpDWHXUVDXSDUDYDQWHQFRQÁLWVHPEOHQWDYRLUGpSDVVpOHXUV
antagonismes et espèrent continuer à travailler dans la paix sociale que
OHXUDYDLWXQWHPSVDSSRUWpHODPRELOLVDWLRQFRQWUHOHV©YUDLVªHQQHPLV
GHOD1DWLRQ&HWWHWUrYHIXWGHFRXUWHGXUpH/HVRSSRVDQWVDXSURJUHVVLVPHHWDXFRPPXQLVPHSURÀWHQWGHODEUXWDOHGpJUDGDWLRQGHVUHODWLRQV
(VW2XHVWSRXUUpJOHUOHXUVFRPSWHVDYHFFHX[TXLj+ROO\ZRRGDYDLHQW
fait allégeance à l’administration Roosevelt. Ils s’organisent entre anciens
DGYHUVDLUHVGHOD'LUHFWRU·V*XLOGGHOD6FUHHQ:ULWHUV·*XLOGGHOD/LJXH DQWLQD]LH GX &RPLWp GpPRFUDWLTXH G·+ROO\ZRRG GH WRXV FHX[ TXL
de près ou de loin contribuèrent à l’élection et aux réélections de Franklin
'HODQR5RRVHYHOWGHjSRXUFKDVVHUWRXVD]LPXWVOHVSURJUHVsistes, considérés comme des communistes en puissance ou en fait. BiberPDQO·H[SOLTXHj%HUWUDQG7DYHUQLHU©1HYRXVODLVVH]SDVDEXVHUSDUOD
QRWLRQGHFRPPXQLVWH2QQHVDYDLWSDVTXLpWDLWFRPPXQLVWH0DLVQRXV
étions des hommes libres, ce qui était dangereux pour ces gens qui avaient
fondé l’Alliance cinématographique pour la préservation de la démocratie
DPpULFDLQH4XDQGYRXVYR\H]XQWLWUHFRPPHFHODYRXVVDYH]LPPpGLDtement à quel genre d’organisation vous avez affaire. Cela n’a que peu de
rapports avec la démocratie10ª
&·HVWHQTXHOHVSUHPLqUHVDXGLWLRQVGHVSHUVRQQDOLWpVGXFLQpPD
vont être médiatisées. Cette année-là, quatre-vingt-dix journalistes sont
accrédités pour assister et rendre compte des interrogatoires de dix-neuf
personnes qui durent témoigner sur leur appartenance présente ou passée
DXSDUWLFRPPXQLVWH(QHIIHW+ROO\ZRRGDSSDUDvWFRPPHXQHFLEOHGH
FKRL[SRXUWUDTXHUOHVDUWLVWHV©URXJHVªHWOHXULQÁLJHUGHVSHLQHVUpGKLELWRLUHVHWFRHUFLWLYHV/DFRXYHUWXUHPpGLDWLTXHGHFHVDXGLWLRQVÀQLUD
par avoir les effets dissuasifs recherchés.
/D FRPPLVVLRQ V·HPSORLH DYHF ]qOH GqV j SRXUVXLYUH OHV UpDOLVDWHXUVDFWHXUVHWVFpQDULVWHVVXVSHFWpVGHV\PSDWKLHHQYHUVOHFRPPX-
"ERTRAND 4AVERNIER !MIS AMmRICAINS¨ OPCIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT nisme et l’Union soviétique. Indirectement, elle contribua donc à façonner
OHFLQpPDKROO\ZRRGLHQGHO·pSRTXH11.
6XUVLPSOHFRQYRFDWLRQOHVSUpVXPpV©FRXSDEOHVªVRQWDSSHOpVjWpmoigner devant le comité des activités antiaméricaines et donner le nom
G·DXWUHV SHUVRQQHV D\DQW RX D\DQW HX j OHXU FRQQDLVVDQFH GHV V\PSDthies communistes.
Les individus nouvellement dénoncés sont alors invités à leur tour à témoigner et ainsi de suite. Ceux qui refusent de donner des noms se retrouvent inscrits sur une liste noire et ne peuvent dorénavant plus travailler
pour les studios. C’est le sort qui attend les premières victimes connues
FRPPHOHV©'L[G·+ROO\ZRRGª²OHVFpQDULVWH$OYDK%HVVLH
le scénariste et réalisateur du Sel de la terre+HUEHUW%LEHUPDQOHVFpQDULVWH/HVWHU&ROHOHUpDOLVDWHXU(GZDUG'P\WU\NOHVFpQDULVWH
5LQJ/DUGQHU-UO·DXWHXU-RKQ+RZDUG/DZVRQ
O·DXWHXU$OEHUW0DOW]OHVFpQDULVWH6DPXHO2UQLW]
OHVFpQDULVWHSURGXFWHXU$GULDQ6FRWWOHVFpQDULVWHHWURPDQFLHU'DOWRQ7UXPER – condamnés pour outrage parce qu’ils
UHIXVHQWGHUpSRQGUHjODTXHVWLRQ©ÈWHVYRXVRXDYH]YRXVpWpPHPEUH
GXSDUWLFRPPXQLVWH"ª
$XFRXUVGHVPRLVHWGHVDQQpHVTXLVXLYHQWOHVDFWLYLWpVGHO·+8$&
FUpHQWSHXjSHXXQHVFLVVLRQj+ROO\ZRRGHQWUHG·XQF{WpOHV©DPLFDX[ª
TXL FROODERUHQW GRQW FHUWDLQV DYHF HQWKRXVLDVPH ² 5REHUW 7D\ORU *DU\&RRSHU5RQDOG5HDJDQ-RKQ:D\QH
:DOW'LVQH\HWF²HWGHO·DXWUHOHV©LQDPLFDX[ª
²+XPSKUH\%RJDUW-RKQ+XVWRQ:LOOLDP:\OHU
HWF²TXLQ·KpVLWHQWSDVjSURWHVWHUFRQWUHOHVPpWKRGHVHPSOR\pHV HQ LQYRTXDQW OH SUHPLHU HW OH FLQTXLqPH DPHQGHPHQW © QXO QH
SHXWrWUHFRQWUDLQWGHWpPRLJQHUFRQWUHOXLPrPHª'DQVOHPrPHWHPSV
suite à leur convocation ou à leur comparution, plusieurs cinéastes sont
FRQWUDLQWVjO·H[LO-XOHV'DVVLQ-RVHSK/RVH\-RKQ
%HUU\RX&KDUOLH&KDSOLQSRXUQ·HQFLWHUTXHTXHOques-uns. Tandis que d’autres porteront à jamais le fardeau de la culpabilité
SRXUDYRLUIDLWSDUWLHGHVGpODWHXUVFRPPH(OLD.D]DQ5REHUW
5RVVHQ6WHUOLQJ+D\GHQ(GZDUG'P\WU\N
/LFHQFLpGHOD5.2HQQRYHPEUHSRXUDYRLUUHIXVpGHUpSRQGUH
DX[ TXHVWLRQV GH O·+8$& (GZDUG 'P\WU\N HVW O·XQ GHV © 'L[ G·+ROO\ZRRGª,OHVWFRQGDPQpjVL[PRLVGHSULVRQHWLQFDUFpUpjODSULVRQIp
)BID P .EUF AUTRES TmMOINS FURENT CONVOQUmS LORS DE CES PREMInRES AUDITIONS 3UITE g L´INTERRUPTION DES INTERROGA
TOIRES DE CETTE PREMInRE SALVE ILS NE COMPARURENT ½NALEMENT PAS )L S´AGIT DE 7ALDO 3ALT 'ORDON
+AHN ,ARRY 0ARKS 2ICHARD #OLLINS ,EWIS -ILESTONE (OWARD +OCH "ERTOLD "RECHT )RVING 0ICHEL 2OBERT 2OSSEN $ONALD /GDEN 3TEWART
# DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN GpUDOHGH0LOO3RLQWHQ&·HVWGHVDFHOOXOHTX·LOUXPLQHHWSUpSDUHVRQ
UHWRXUj+ROO\ZRRG/HVHSWHPEUHLOFRQYRTXHVRQDYRFDWSRXUOXL
GpFODUHU©-HQHVXLVQLQ·pWDLVPHPEUHGXSDUWLFRPPXQLVWHDXPRPHQW
GHPRQDXGLWLRQ-HQHVXLVSDVQRQSOXVXQV\PSDWKLVDQWFRPPXQLVWH-H
UHFRQQDLVOHVeWDWV8QLVG·$PpULTXHFRPPHOHVHXOSD\VHQYHUVOHTXHOMH
GRLYHREpLVVDQFHHWOR\DXWpª/HOHQGHPDLQFHWH[WHODSLGDLUHIDLWODXQH
GHVMRXUQDX[&HODQHVXIÀUDSDV2QDWWHQGGXUpDOLVDWHXUXQHUHSHQWDQFH
en grande pompe. Il devra comparaître à nouveau devant la commission
GHVDFWLYLWpVDQWLDPpULFDLQHV&·HVWOHDYULOTX·LOWpPRLJQHUDFRQWUH
ses anciens camarades devant la commission.
7RXWHFHWWHDWPRVSKqUHSDUDQRwDTXHQ·DUUDQJHULHQjODFULVHGXFLQpPD
TXLVHSURÀOHGqVDYHFODSURFODPDWLRQGHODORLDQWLWUXVWREOLJHDQW
les grands studios à se séparer de leurs parcs de salles. En effet, à partir
GHVDQQpHVQRWDPPHQWjFDXVHGHODFRQFXUUHQFHJUDQGLVVDQWHGHOD
WpOpYLVLRQ+ROO\ZRRGV·HQIRQFHSHXjSHXGDQVXQHFULVHFKURQLTXH/D
IUpTXHQWDWLRQWRPEHHQjPLOOLRQVGHVSHFWDWHXUVKHEGRPDGDLUHV
FRQWUHPLOOLRQVHQ(QFRQVpTXHQFHGHTXRLjSDUWLUGHOH
QRPEUH GH ÀOPV SURGXLWV DX[ eWDWV8QLV QH GpSDVVHUD SOXV OHV DX
OLHXGHVRXSURGXLWVGXUDQWODJXHUUHDOODQWMXVTX·jWRPEHUVRXV
ODEDUUHGHVDXFRXUVGHVDQQpHV
02/'2%33)3-% 63 #/--5.)3-%
Pour sortir de la crise, les studios font appel à une nouvelle généraWLRQGHFLQpDVWHV TXL j OD VXLWH QRWDPPHQW GH -RKQ +XVWRQ G·$QWKRQ\
0DQQGH9LQFHQWH0LQHOOLUpYpOpVGqV
HWVXUWRXWG·2UVRQ:HOOHVDXWHXUGXFpOqEUHSDPSKOHWQRYDteur Citizen KaneLPSRVHQWVXUOHVpFUDQVGHQRXYHDX[WKqPHVHW
des sujets plus courageux, parfois même subversifs du point de vue de la
PRUDOH SXULWDLQH DPpULFDLQH 1LFKRODV 5D\ (OLD .D]DQ -RVHSK/0DQNLHZLF])UHG=LQQHPDQ6DPXHO)XOOHU%LOO\:LOGHU5REHUW$OGULFK5LFKDUG%URRNV
2WWR 3UHPLQJHU 6WDQOH\ .XEULFN HW
TXHOTXHVDXWUHVVXFFqGHQWDX[*HRUJH&XNRU)UDQFN&DSUD
3UHVWRQ6WXUJHVGHODGpFHQQLHSUpFpGHQWH3OXVLHXUV±XYUHV
donnent par exemple une importance nouvelle à la question du racisme
DQWL1RLUVDQWL,QGLHQVRXDQWLVpPLWHHQWUHDXWUHVHWUHVSHFWLYHPHQWLa
Porte s’ouvre-0DQNLHZLF]La Flèche brisée''DYHVRXLe
Mur invisible ( .D]DQ 2VFDU GX PHLOOHXU ÀOP 4XHOTXHV DXWUHV
s’attachent à la question de la délinquance juvénile (L’équipée sauvage de
L. Benedek, La fureur de vivre GH15D\HWGraines de violence de R. Brooks
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT HQjODWR[LFRPDQLHL’Homme au bras d’or G·23UHPLQJHUHQ
DX[ DPRXUV © FRQWUHQDWXUH ª Lolita GH 6 .XEULFN HQ j OD
folie (Shock Corridor GH6)XOOHUHQHWGHIDoRQGpWRXUQpHjO·KRPRsexualité (Certains l’aiment chaud GH%:LOGHUHQ/HFRXUDJHGHFHV
QRXYHDX[PHWWHXUVHQVFqQHHVWGLIIpUHQWGHFHOXLGRQWOHV©EODFNOLVWpVª
auront à faire preuve pour continuer à travailler dans le cinéma. ParfaitePHQWLQWpJUpjO·LQGXVWULHKROO\ZRRGLHQQHOHXUVDXGDFHVVRQWDWWHQGXHV
et encouragées par les studios et leurs publics. Ils doivent incarner le reQRXYHDXVXUOHTXHOOHVVWXGLRVFRPSWHQWSRXUVRUWLU+ROO\ZRRGGHODFULse. Inversement, l’une des conséquences premières de la « chasse aux sorFLqUHVªHVWGRQFELHQODPDUJLQDOLVDWLRQYRLUHO·pOLPLQDWLRQGHVpOpPHQWV
considérés comme idéologiquement subversifs. À cet égard, un discours
sensiblement réactionnaire domine la production consacrée. Pour montrer
OHXU SDUIDLW © DPpULFDQLVPH ª OHV VWXGLRV SUHQQHQW OH FRQWUHSLHG GH FH
TX·LOVH[SULPDLHQWGXUDQWOD6HFRQGH*XHUUHPRQGLDOHHWSDUWLFLSHQWFHWWH
fois-ci à une vaste entreprise de propagande anti-rouges en produisant
des œuvres comme Le Rideau de ferGH:LOOLDP$:HOOPDQ
La Grande menaceGH*RUGRQ'RXJODVI Married a
Communist GH5REHUW6WHYHQVRQGuilty of Treason GH)HOL[()HLVWI was a Communist for the FBI GH*RUdon Douglas, My Son John GH/HR0F&DUH\HWF3DUPL
OHVÀOPVpPLQHPPHQWSURSDJDQGLVWHVEHDXFRXSDIÀFKHQWFHSHQGDQWXQ
discours plus subtil, usant volontiers de métaphores. C’est le cas en parWLFXOLHUGHV±XYUHVGHVFLHQFHÀFWLRQPHWWDQWHQVFqQHGHVH[WUDWHUUHVWUHV
EHOOLTXHX[ YHQXV GH OD © SODQqWH URXJH ª RX GHV LQVHFWHV JLJDQWHVTXHV
SURGXLWVGHO·qUHDWRPLTXHLa Guerre des mondesGH%\URQ+DVNLQ
Les Envahisseurs de la planète rouge GH :LOOLDP &DPHURQ0HQ]LHVLes Monstres attaquent la villeGH*RUGRQ
Douglas, La Chose d’un autre mondeGH&KULVWLDQ1\E\
HWSURGXLWSDU+RZDUG+DZNVHWF7RXWHVFHVSURGXFWLRQVODSOXSDUWGH
série B, exploitent le thème alarmiste du complot communiste et jouent
volontiers sur les fantasmes et les peurs suscitées par l’URSS et la bombe
DWRPLTXH 0DLV FH GLVFRXUV DQWLURXJHV QH VH OLPLWH SDV DX[ VHXOV ÀOPV
GH VFLHQFHÀFWLRQ G·DXWUHV JHQUHV VHURQW DXVVL FRQFHUQpV SDU H[HPSOH
OHZHVWHUQLa Charge héroïqueGH-RKQ)RUGRXGHPDQLqUHSOXVH[SOLFLWHOHÀOPQRLULe Port de la drogue GH6DPXHO)XOOHU
# DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN %.6%23 %4 #/.42% 4/53 4(% 3!,4 /& 4(% %!24(
'XPRPHQWR-RH0F&DUWK\VpQDWHXUGX:LVFRQVLQHVWLPHjOHQRPEUHG·DJHQWVFRPPXQLVWHVjWUDYDLOOHUDXPLQLVWqUHGHV$Ifaires étrangères et en convainc nombre de libéraux américains, les œuvres
à se prononcer ouvertement contre la chasse aux sorcières se font de plus
en plus rares. Parmi les exceptions, Le Sel de la terre est sans doute l’un des
seuls exemples d’un authentique cinéma prolétarien américain. Pourtant,
VHORQ VRQ UpDOLVDWHXU OXLPrPH LO HVW O·XQ GHV ÀOPV OHV SOXV DPpULFDLQV
jamais tournés13,OHQHVWGHPrPHGXÀOPPDQLIHVWHGH-RKQ%HUU\The
Ten Hollywood qui est un document clé de cette époque. Les dix premiers
©EODFNOLVWpVªG·+ROO\ZRRGFRQGDPQpVHWHPSULVRQQpVSRXURXWUDJHDX
FRQJUqV\H[SULPHQWFHTX·LOVSHQVHQWGHOHXUSD\VHWGHO·DWWHLQWHjOHXUOLberté fondamentale que représente leur peine, à la veille de leur incarcéraWLRQ&·HVW$OEHUW0DOW]HW+HUEHUW%LEHUPDQTXLHQpFULYLUHQW
OHVFpQDULR(Q%LEHUPDQDUHYXFHÀOPSRXUODSUHPLqUHIRLV
« Je me suis aperçu que tous ceux qui parlent maintenant du Vietnam,
GXFRPSOH[HLQGXVWULHOHWPLOLWDLUHFURLUDLHQWTXHFHÀOPDpWpWRXUQpOD
veille. C’était tellement précis, tellement clair, non seulement par rapport
jODSpULRGHPDLVDX[GDQJHUVLQFOXVGDQVFHWWHSpULRGH,O\DHQFRUHGH
JUDQGVGDQJHUVSRXUQRWUHSD\VPDLQWHQDQWPDLVLOQ·DMDPDLVHXXQHWHOOH
santé, une telle puissance saine pour les combattre. Il se peut qu’un jour
les États-Unis deviennent une démocratie et une véritable puissance plus
humaine, plus respectueuse. Il faudra bien sûr se battre durement, mais ce
qui me frappe, ce qui m’a toujours frappé, ce n’est pas le danger ou l’importance du danger. Et je trouve que les éléments sains et valables sont en
quantité et en qualité plus prometteurs à l’heure actuelle en Amérique que
dans toute ma vie passée. J’ai l’habitude de dire que, dans ces années péniEOHVPRQSD\VDYDLWEHVRLQGHPRL,OQHOHVDYDLWSDVPDLVLODYDLWEHVRLQ
de moi… Quand j’allais au Mexique de temps en temps, pour diverses
raisons, j’avais hâte de revenir, de peur qu’il n’arrive quelque chose à mon
SD\VTXDQGMHQ·pWDLVSDVOj«&HODGLWMHSHQVHTXHPDJpQpUDWLRQQHV·HVW
SDVUHPLVHGXPDFFDUWK\VPH&HQ·HVWSDVSDUFHTXHTXHOTXHVSHUVRQQHV
ont survécu, se sont battues ou ont réussi à revenir… L’esprit de toute une
JpQpUDWLRQDYDLWpWpDWWHLQW(WFHTXLHVWOHSOXVLPSRUWDQWOHSD\VQHV·HQ
HVWMDPDLVUHPLV«,O\DHXXQHVRUWHGHSHXULQMHFWpHGDQVOHVYHLQHVGX
SD\VTXLH[LVWHHQFRUHPDLQWHQDQWª
6LODFKDVVHDX[VRUFLqUHVSULWÀQj+ROO\ZRRGHQMDQYLHUDYHFOD
signature d’un pacte d’échanges culturels entre l’URSS et les États-Unis et
"ERTRAND 4AVERNIER !MIS AMmRICAINS¨ OP CIT P )BID P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT DYHFODYLVLWHGHODFDQWLQHGHODth&HQWXU\)R[SDU1LNLWD.KURXFKWFKHY
HQOHVWUDXPDWLVPHVTX·HOOHSURYRTXDGDQVODSURIHVVLRQ
durèrent encore longtemps après cette déclaration de Biberman. En 1998,
+ROO\ZRRG PRGLÀDLW HQFRUH OHV JpQpULTXHV SRXU UpKDELOLWHU OHV DQFLHQV
©EODFNOLVWpVªGHVDQQpHV.
/HÀOPThe Salt of the Earth relate, d’après des faits réels, une grève de
PLQHXUV DX 1RXYHDX0H[LTXH &·pWDLW OH SUHPLHU SURMHW G·XQH QRXYHOOH
société de production, The Independant Productions Corporation (IPC),
FRQVWLWXpHQSDUXQSHWLWJURXSHGHSHUVRQQHVEODFNOLVWpHVTXLQHSRXYDLHQWSOXVWUDYDLOOHUGDQVOHV\VWqPHGHVWXGLRVKROO\ZRRGLHQV+HUEHUW
%LEHUPDQ3DXO-DUULFR0LFKDHO:LOVRQHW$GULDQ
Scott. C’est leur adversité qui leur a permis de surmonter les obstacles
GUHVVpVGHYDQWHX[SDUOHVVWXGLRVOHVV\QGLFDWVOHVRUJDQLVDWLRQVGHVXUveillance gouvernementale, une partie du gouvernement, les laboratoires.
/HÀOPV·LQVSLUHG·XQHJUqYHTXLV·HVWGpURXOpHj6LOYHU&LW\1RXYHDX
0H[LTXH0LFKDHO:LOVRQV·HVWDSSX\pVXUXQHGpSrFKHSXEOLpHSDUOHNew
York Times OHMXLQ&HUWDLQVJUpYLVWHVVHFRQÀqUHQWjOXLSRXUO·DLGHU
jUpGLJHU'·DXWUHVDSSDUDLVVHQWGDQVOHÀOP-XDQ&KDFRQOHSHUVRQQDJH
PDVFXOLQSULQFLSDOpWDLWO·XQGHVOHDGHUVV\QGLFDX[jO·RULJLQHGXPRXYHment. Dans cette région du sud des États-Unis, une très importante couche
de population mexicaine est restée sur place après l’annexion de ces États
SDUOHV<DQNHHV&HVIDPLOOHVFRQWLQXHQWjSDUOHUHVSDJQROHWVRQWOHSOXV
VRXYHQWFDWKROLTXHVSUDWLTXDQWV2QOHVDSSHOOHOHVpochos ou les chicanos et
ils constituent aujourd’hui la première communauté hispanique des ÉtatsUnis. D’après le journaliste et cinéaste Pardo Carlos, le début de ce qui est
considéré comme le mouvement chicano se situe à l’aube de ces années
cinquante et The Salt of the Earth HVWOHSUHPLHUÀOPD\DQWSRXUSHUVRQQDJH
SULQFLSDOXQ&KLFDQR4XDUDQWHDQVSOXVWDUG%HUYHUO\6DQFKH]3DGLOOR
réalisa El Corrido de Juan Chacon XQGRFXPHQWDLUHVXUFHWWHÀJXUH
historique17. Le respect de la double culture des acteurs « non professionQHOVªUDSSHOOHOHFLQpPDVRYLpWLTXHRXOHQpRUpDOLVPHLWDOLHQ,OVHWUDGXLW
par une manière de traiter tout à fait spéciale les problèmes sociaux dans
le cinéma américain. La place accordée à la langue espagnole dans les dialogues, la peinture sociale et culturelle de la mentalité des chicanos et mêmes les aspects rétrogrades de la morale machiste des mineurs contribuent
à cette mise en scène réaliste de la classe ouvrière et de son contrepoint, la
%DOUARD 7AINSTROP ¦ ,´!MmRIQUE REMET SES ±BLACKLISTmS² AU GmNmRIQUE ,A RmHABILITATION DES SCmNARISTES RmALI
SATEURS ET PRODUCTEURS VICTIMES DU MACCARTHYSME SE POURSUIT § ,IBmRATION DU AO}T P ,E SCmNARISTE -ICHAEL 7ILSON PARTICIPA AU SCRIPT DE ,A 6IE EST BELLE DE &RANK #APRA ,´!FFAIRE #ICmRON
DE -ANKIEWICZ PUIS APRnS AVOIR mTm BLACKLISTm ,E 0ONT DE LA RIVInRE +WAt ET ,AWRENCE D´!RABIE
0ARDO #ARLOS ¦ ,A MmMOIRE INSURGmE DES #HICANOS § ,E -ONDE DIPLOMATIQUE DmCEMBRE P # DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN FODVVHGRPLQDQWH/HWLWUHGXÀOPLQVSLUpG·XQHSDUROHGX&KULVW0DW9
UHQYRLHjODUHOLJLRVLWpHWDXFDWKROLFLVPHGHFHWWHSRSXODWLRQ'H
la révolte silencieuse et contenue, manifeste dans les premières scènes du
ÀOPjVRQpPDQFLSDWLRQSROLWLTXHTXDQGHOOHSUHQGODWrWHGXJURXSHGHV
IHPPHV GH =LQF 7RZQ (VSHUDQ]D 4XLQWHUR HVW OH SULQFLSDO V\PEROH GH
cet appel à la dignité auquel renvoie ce titre emprunté aux Évangiles. À la
ÀQHOOHUHVVHPEOHDX[©VROGDGHUDVªFHVIHPPHVTXLDFFRPSDJQDLHQWOHV
révolutionnaires mexicains des années 1910-1917.
3OXVJOREDOHPHQWODGpPDUFKHUpDOLVWHGXÀOPOHFRQGXLWjQHÁDWWHU
personne. Les ouvriers ne sont pas des saints et la classe dominante n’est
SDV FDULFDWXUpH (Q FH VHQV OH ÀOP VH GpPDUTXH GX FLQpPD GHV WKpRULciens russes (Eisenstein, Poudovkine). C’est principalement une conception analogue du montage et de la composition des plans qui autorise le
rapprochement.
Le tournage fut mouvementé, la police mettant la pression sur les
SDUWLFLSDQWVHQYR\DQWGHVKpOLFRSWqUHVSRXUHPSrFKHUOHVSULVHVGHYXH
HWVFUXWDQWOHVFRPSWHVGXÀOPSRXUWURXYHUXQHDIÀOLDWLRQDYHFOHSDUWL
communiste. Des vigilantes ont tenté d’écraser tout le plateau avec des camions. L’équipe a dû en venir aux armes pour les arrêter. Elle a fait appel à
la police pour patrouiller dans les parages. Elle a pu compter sur l’aide des
SUrWUHVGHODYLOOH0LHX[O·pYrTXHGH1HZ0H[LFRRXG·(O3DVRGHPDQGD
à la population de ne pas aider les vigilantes. L’événement le plus triste
UHVWH VDQV GRXWH O·H[SXOVLRQ GH 5RVDXUD 5HYXHOWDV DFWULFH
mexicaine qui joue le rôle d’Esperanza Quintero. Son visa fut révoqué, et
on l’interrogea sur l’appartenance des membres de l’équipe au parti communiste, avant que Paul Jarrico, le producteur, ne puisse intervenir. Elle
QHWRXUQDMDPDLVSOXVDX[eWDWV8QLV(OOHHQUHJLVWUDODQDUUDWLRQGXÀOP
au Mexique avec un preneur de son amateur. Elle s’installa en Allemagne
HQRHOOHWUDYDLOODDYHF%HUWROG%UHFKW
Les laboratoires reçurent des injonctions des autorités pour ne pas déYHORSSHUOHÀOPOHVODERUDWRLUHV3DWKpSDUH[HPSOHVRXVSHLQHGHER\FRWW$XVVL OH ÀOP IXW VWRFNp GDQV GHV ERvWHV QH SRUWDQW SDV OH WLWUH GH
O·±XYUHHWGpYHORSSpODQXLWSDUGHVV\PSDWKLVDQWVGDQVGLIIpUHQWVODboratoires disséminés sur tout le territoire. Biberman ne pouvait pas voir
les rushesFDUOHVODERUDWRLUHVUHIXVDLHQWGHGpYHORSSHUOHÀOP&·HVWFHTXL
explique la simplicité des plans et de leur enchaînement.
,O IDOODLW WRXWH OD SHUVpYpUDQFH G·XQ 3DXO -DUULFR RX G·XQ +HUEHUW %Lberman pour diriger des acteurs amateurs qui avaient un constant besoin
d’encouragements et de conseils. Il fallait leur éviter toutes gênes provoTXpHVSDUOHVFRQGLWLRQVWHFKQLTXHVGHFHWRXUQDJHWUqVGLIÀFLOH$XÀQDO
%LEHUPDQFRQÀHTXH©VDQVO·pQHUJLHGHVJHQVTXLpWDLHQWOjMHQ·DXUDLVSDV
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT HXO·pQHUJLHVXIÀVDQWHSRXUWRXUQHUFHÀOP18ª0rPHOHÀOPWHUPLQpOHV
participants peuvent craindre des représailles. L’un d’entre eux est puni
GH FLQT DQV GH SULVRQ /D YRLWXUH G·XQ GLULJHDQW V\QGLFDOLVWH TXL MRXDLW
GDQVOHÀOPIXWPLWUDLOOpH
/RUVGHVDVRUWLHHQOHÀOPQHIXWSURMHWpTX·XQHIRLVj1HZ<RUN
DYDQWG·rWUHEODFNOLVWpSRXURQ]HDQV%LEHUPDQSUpVHQWDOHÀOPDYHFVXFcès en Europe, notamment en France et en Tchécoslovaquie.
5.% #2)4)15% &2!.a!)3% $% 4/53 "/2$3¨ 5.!.)-%
En France, la presse, quasiment dans son ensemble, l’accueille favorablement. Dans Témoignage chrétien GX DYULO 5RJHU )UHVVR] V·HQWKRXVLDVPH © /·$PpULTXH QH QRXV DYDLW SDV HQYR\p GHSXLV
longtemps, d’œuvre aussi noble et aussi belle, aussi dure et aussi tranTXLOOH DXVVL UpYpODWULFH HW DXVVL DFFXVDWULFH G·HOOHPrPH ª 6XU OD PrPH
SDJH&ODXGH'XULHX["GpQRQFHODUpFXSpUDWLRQFRPPXQLVWH
HQVRXOLJQDQWODVREULpWpGXÀOP©Le Sel de la terre traduit peut-être au plus
haut point – et c’est sans doute sa valeur inestimable – une phase de cette
OXWWHRXYULqUHVDQVODURPDQFHUVDQVODVRSKLVWLTXHUª/HMXLQGDQV
OHPrPHMRXUQDO-HDQ&DUWDLQWURGXLWVRQLQWHUYLHZGH0LFKDHO:LOVRQHQ
FRQVLGpUDQWTX·LOV\PEROLVHOHFRXUDJHHWHQUHQGDQWKRPPDJHjO·DXGDFH
HWjODWpQDFLWpGHVKRPPHVTXLO·RQWUpXVVL/HQRYHPEUH5DGLR
&LQpPDOHSUpVHQWHFRPPHXQÀOPVXUODGLJQLWpKXPDLQH« Un seul thème
GRQQHDXÀOPVRQXQLWpFHOXLGHODGLJQLWpKXPDLQH,OVHSUpVHQWHVRXVXQWULSOH
aspect : dignité de celui qui travaille, méconnue par celui qui l’exploite ; dignité
de la femme, méconnue par l’homme dont la bienveillance se teinte de mépris ;
dignité d’une race tenue pour inférieure. ». Ce qui frappe le critique, c’est « un
FHUWDLQWRQGHQREOHVVHª'DQVParis-Presse, -HDQ3DXO)DXUHHVWGLWK\UDPELTXH©8QÀOPERXOHYHUVDQWYLHQWG·DSSDUDvWUHKpODVWLPLGHPHQWVXU
l’écran du Studio des Ursulines. D’inspiration progressiste et réalisé par un
´LQWHUGLWGHVpMRXUj+ROO\ZRRGµ+HUEHUW-%LEHUPDQF·HVWFHUWDLQHPHQW
l’œuvre la plus revendicatrice du cinéma américain. C’est aussi un de ses
chefs-d’œuvre et aucune considération politique ne doit empêcher de le
VDOXHUFRPPHWHO/DEHDXWpGX6HOGHODWHUUHF·HVWVDQREOHVLPSOLFLWpª/H
quotidien Le Monde GXPDUVOHTXDOLÀHGHSDVVLRQQDQWHWORXHVRQ
VW\OHLQFRPSDUDEOH©&HWWHOLEHUWpG·H[SUHVVLRQVHQVLEOHGHODSUHPLqUHj
ODGHUQLqUHLPDJHFRPPXQLTXHDXÀOPXQFDUDFWqUHLQVROLWHTXLQ·HVWSDV
VRQPRLQGUHLQWpUrW1RXVQ·DYLRQVSDVYXGHSXLVORQJWHPSVXQRXYUDJH
américain aussi ouvertement revendicateur. Il passe par moments sur Le
"ERTRAND 4AVERNIER !MIS AMmRICAINS¨ OP CIT P # DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN 6HO GH OD WHUUH OH VRXIÁH TXL SDVVDLW VXU OHV SUHPLqUHV ±XYUHV GH 3RXGRvkine ou d’Eisenstein, et qui s’est depuis longtemps transformé au-delà
du rideau de fer en une bise conformiste. Le Sel de la terre a la violence et
ODVpUpQLWpGHFHUWDLQVÀOPVLWDOLHQVLQGLHQVRXMDSRQDLVTXHQRXVDYRQV
DSSODXGLVUpFHPPHQWª'DQVVRQDUWLFOH©/·DIIDLUHGX6HOGHODWHUUHXQ
SURFqVTXLIHUDGDWHGDQVO·KLVWRLUHGXFLQpPDª6LPRQH'XEUHXLOKFRPPHQFH©3DUDGR[H6\VWpPDWLTXHPHQWER\FRWWpWDQWSHQGDQWVDUpDOLVDtion que lors de sa sortie par les producteurs, distributeurs et directeurs
GHVDOOHVDPpULFDLQV/H6HOGHODWHUUHGH0LFKDHO:LOVRQHW+HUEHUW%LEHUPDQHVWGHSXLVXQDQOHÀOPDPpULFDLQTXLDOHPLHX[VHUYLjO·pWUDQJHU
Angleterre, Allemagne, Mexique, Tchécoslovaquie, France ; le prestige du
cinéma américain19ª En effet, l’impression de retrouver de l’authentique
cinéma américain est une constante de la critique française. Dans les Lettres
françaises GX PDUV OH FULWLTXH FRPPXQLVWH *HRUJHV 6DGRXO FRPPHQWH©&HTXLGRPLQHGDQV/H6HOGHODWHUUHF·HVWODMRLHGHUHWURXYHU
HQÀQOHFLQpPDDPpULFDLQ«&HWWHJUDQGH±XYUHUHQRXHDYHFODJUDQGH
la merveilleuse tradition de l’art américain. (…) Le Sel de la terre est le
chef-d’œuvre du “néoréalisme américain” et son commencement, moins
pour ses décors naturels et ses acteurs non professionnels que pour avoir
PRQWUpOHSHXSOHGHVeWDWV8QLVHWVHVDVSLUDWLRQVª Dans L’Humanité du
PDUV$UPDQG0RQMRGpFODUHTX·DXFXQ©ÀOPDPpULFDLQQHQRXV
avait encore montré, avec cette authenticité scrupuleuse, la réalité miséraEOHGHODYLHTXRWLGLHQQHGHVRXYULHUVGHFHSD\Vª'DQVOHPrPHMRXUQDO
OHDYULOOHFULWLTXHUHQFKpULWHQDMRXWDQWTX·DXFXQ©ÀOPDPpULFDLQ
DFWXHOOHPHQW SURMHWp HQ )UDQFH QH SRVVqGH FH VRXIÁH FHWWH SXLVVDQFH HW
ces qualités cinématographiques imprégnés du “vent chaud de la colère
sociale” dont parlait Time magazine lors de la sortie du Sel de la terre aux
eWDWV8QLV$XFXQÀOPDPpULFDLQQ·DMDPDLVGpFKLUpDYHFDXWDQWGHFRXUDge le voile qui masque la vérité sur les conditions sociales des travailleurs
GHVeWDWV8QLVª-DFTXHV'RQLRO9DOFUR]HYDQWHOXLpJDOHPHQWOHFRXUDJH
GHVFUpDWHXUVGXÀOP©Le Sel de la terreHVWXQWUqVEHDXÀOPkSUHHWpPRXvant, en dépit d’un certain nombre d’imperfections techniques dues aux
conditions de tournage et qui ne pèsent pas lourd dans la balance en regard
de la courageuse originalité du contenu et de cette saisissante impression
d’authenticité qui s’impose dès les premières imagesª'DQVOHFigaro du
PDUV /RXLV &KDXYHW GpQRQFH OD UpFXSpUDWLRQ FRPPXQLVWH SRXU
PRQWUHUTXHOHÀOPQ·HPEUDVVHDXFXQHLGpRORJLHVLQRQFHOOHGHODGLJQLWp
KXPDLQH©/·RXYUDJHVHVLJQDOHSDUXQHGLJQLWpSUHQDQWHSDUOHFDUDFWqUH
à la fois tenace et pondéré de la révolte qu’il exprime. C’est assez dire que
,IBmRATION MARS P SUITE P &RANCE/BSERVATEUR MARS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD '!22%!5 ,AURENT tels de ceux qui l’applaudirent avec le plus d’ostentation le revendiquent à
WRUWFRPPHJORULÀDQWOHXULGpRORJLH/HVPDFFDUWK\VWHVDPpULFDLQVFRPPLUHQWO·HUUHXUGHOXLLPSXWHUFHTXHOHVFRPPXQLVWHVV·HIIRUFHQWG·\PHWWUH
après coup. Mais il est moins facile de confondre un parti sénatorial avec
O·$PpULTXHOLEpUDOHTXHOHIDX[VRFLDOLVPHDYHFODW\UDQQLHª'DQVOHFigaro
littéraire GXMXLQ&ODXGH0DXULDFDXVVLSUHQGQRWHGHVGpIDXWVWHFKQLTXHVGXÀOPHQV·pYHUWXDQWjOHVYDORULVHU©Le Sel de la terre a été réalisé
SDXYUHPHQWHWDYHFGHVPR\HQVGHIRUWXQH'·RODJULVDLOOHHWO·DXVWpULWp
de ses images. D’où peut-être aussi sa parenté avec les chefs-d’œuvre du cinéma muet. Mais les imperfections techniques et ce côté suranné lui-même
VRQW SHX GH FKRVH SXLVTXH OH UpFLW DWWHLQW j XQH FRQVWDQWH HIÀFDFLWp HW j
cette vraie beauté qui naît au-delà des formes. Acteurs professionnels et
“amateurs” (si on peut nommer ainsi des ouvriers mineurs interprétant
leurs propres personnages dans une œuvre de combat) apparaissent unis
SDUXQHWHOOHFRPPXQLRQTX·RQQHOHVGLVWLQJXHSDVOHVXQVGHVDXWUHVª
Même constat de la part de Jean Rochereau dans La Croix GXPDUV
« Une propagande, aussi abusive que maladroite, tente actuellement de
transformer Le Sel de la terreHQSDUDQJRQGXÀOPPDU[LVWH,OVHUDLWUHJUHWWDEOHTX·XQHWHOOHUpSXWDWLRQDEVROXPHQWLQMXVWLÀpHHQWUDYkWODFDUULqUHGX
ÀOPGpWRXUQDQWGHOXLERQQRPEUHGHVSHFWDWHXUV3RXUQRWUHSDUWQRXV
estimons que Le Sel de la terre mérite d’être vu par tous ceux qui pensent
TXHOHFLQpPDSHXWHWGRLWUHPSOLUXQHIRQFWLRQVRFLDOHª Dans Combat du
PDUVOHFULWLTXHSDULQWpULPHVWLOLQGLTXpjODÀQGHO·DUWLFOHHQ
JXLVHGHVLJQDWXUH+HQU\0DJQDQLQWHUSUqWHOHSURMHWjO·RULJLQHGXÀOP
HQUpIpUHQFHDX[SUDWLTXHVGHODFHQVXUHIUDQoDLVH©6L0)UHQD\ et les
commissions de “lectures” de scénarios qu’il encourage au nom des producteurs impécunieux (au fait… pourquoi les producteurs ne se mettentLOVSDVHQUDSSRUWDYHF03RXMDGH"VL0)UHQD\DYDLWOXOHVFpQDULRGX
Sel de la terre, je gage qu’il l’aurait refusé. (…) C’eût été navrant (peut-être
mon imagination m’entraîne-t-elle trop loin). C’eût été navrant… parce que
l’histoire de cette grève maintenue, soutenue, contenue par des ouvriers
de sang mêlé, de sang blanc, de sang rouge ou de sang blême, est l’histoire même des révoltes propres de notre temps qui connut – il faut bien
l’avouer – de mauvaises raisons pour planter n’importe quel drapeau sur
OHEURXKDKDGHVRQHVSRLUª
À l’image de la presse, la censure française autorisa sans problème l’exSORLWDWLRQGXÀOPVXUOHVpFUDQV0HPEUHGXSDUWLUDGLFDOURFLDOLVWH$Qdré Morice, ministre du Commerce et de l’Industrie et, à ce titre, en charge
du contrôle cinématographique, ne peut être suspecté de complaisance
3UR (ENRI &RENAY VOIR ,AURENT '!22%!5 !RCHIVES SECRnTES DU CINmMA FRANlAIS 0ARIS 0RESSES UNIVER
SITAIRES DE &RANCE ¦ 0ERSPECTIVES CRITIQUES § P # DE 2%#)43 ,E 3EL DE LA TERRE DE "IDERMAN à l’égard de la propagande communiste. En lui accordant le visa requis
sans conditions, il assume l’ambivalence de la position française dans le
rapport de force est-ouest sous la quatrième République.
$X[eWDWV8QLVOHÀOPQHVRUWLWUpHOOHPHQWTX·HQLe Sel de la terre
donna naissance à un grand nombre de commentaires, de commémoraWLRQVHWG·±XYUHVXQOLYUHGH-DPHV-/RUHQFHLQWLWXOpThe Suppression of
Salt of the Earth détaille l’histoire de la production et des manœuvres poOLFLqUHVHWSROLWLTXHVDXWRXUGXÀOPXQRSpUD(VSHUDQ]DIXWFUppHQDR€W
j0DGLVRQ:LVFRQVLQ
(QÀQOHÀOPIXWFKRLVLSDUOH1DWLRQDO)LOP5HJLVWU\HQ&HWRUJDnisme créé en 1989 vise à protéger les œuvres du patrimoine. Il contenait
±XYUHVHQ
3OURCES ET BIBLIOGRAPHIE
")"%2-!. (ERBERT 3ALT OF THE %ARTH 4HE 3TORY OF A &ILM "OSTON "EACON 0RESS #)-%.4 -ICHEL +AZAN PAR +AZAN %NTRETIENS 0ARIS 2AMSAY $)%3 -ARTIN 4HE 4ROJAN (ORSE IN !MERICA .EW 9ORK $ODD -EAD #OMPANY %,%&4%2)/50%22). 6mRONIQUE ¦ ±4HE MOTION PICTURE IS POTENTIALLY ONE OF THE GREATEST WEAPONS FOR THE SAFEGUARD
ING OF DEMOCRACY² ACTIVISME ET CENSURE DANS LE MONDE HOLLYWOODIEN DES ANNmES § 2EVUE FRANlAISE D´mTUDES
AMmRICAINES DmCEMBRE P *%!.#/,!3 *EAN0IERRE ¦ 0HOBIES JAUNES g (OLLYWOOD § -ANInRES DE VOIR #INmMAS ENGAGmS AO}TSEPTEMBRE
,/2%.#% , *AMES 4HE 3UPPRESSION OF 4HE 3ALT OF THE %ARTH (OW (OLLYWOOD "IG ,ABOR AND 0OLITICIANS "LACKLISTED A
-OVIE IN #OLD 7AR !MERICA 5NIVERSITY OF .EW -EXICO 0RESS 4!6%2.)%2 "ERTRAND !MIS AMmRICAINS ENTRETIENS AVEC LES GRANDS AUTEURS D´(OLLYWOOD #OmDITION )NSTITUT ,UMInRE !CTES SUD ,YON 7)%$%2 4HOMAS ,ES 3ORCInRES DE (OLLYWOOD #HASSE AUX ROUGES ET LISTES NOIRES 2AMSAY POCHE CINmMA bMISSION ¦ ,ES "R}LURES DE L´(ISTOIRE #HASSE AUX SORCInRES g (OLLYWOOD § DIFFUSmE LE MAI SUR
&RANCE $6$ ,E 3EL DE LA TERRE ,ES $IX D´(OLLYWOOD $ORIANE ½LMS
"ONUS DE 3OPHIE ,E -ERDY ¦ 'UERRE FROIDE ET MACCARTHYSME § IN $6$ ,A 0RISONNInRE DU DmSERT UN ½LM DE *OHN &ORD
3#%2%.#.$0 ,´%DEN CINmMA 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE %NTRE DOCUMENTAIRE ET ½CTION REPRmSENTATIONS DE L´OUVRIER
DANS #ITY DE *IA :HANGKE
!NTONY &IANT
J
IA ZHANG-KE, NÉ EN 1970FRQVLGpUpFRPPHOHFKHIGHÀOGHVFLQpDVWHV
FKLQRLVGHODVL[LqPHJpQpUDWLRQD\DQWUpDOLVpVRQSUHPLHUÀOPHQ
Q·DSDVDWWHQGXHW24 City pour se confronter au monde
RXYULHUHWjODÀJXUHGHO·RXYULHU6RQJUDQGSURMHWFRQVWLWXDQWOHVXMHWGH
WRXVVHVÀOPVpWDQWGHGpFULUHOHVSURIRQGHVPXWDWLRQVGHOD&KLQHGDQV
le passage du XXe au XXIe siècle, du communisme au libéralisme, avec une
attention quasi exclusive pour les laissés-pour-compte de la croissance exWUDRUGLQDLUHGXSD\VRQYRLWPDOFRPPHQWLODXUDLWSXHQrWUHDXWUHPHQW
FRPPHQWOHFLQpDVWHDXUDLWSXSDVVHUjF{WpGHO·XQHGHVGHX[ÀJXUHVSDUDQJRQVGXFRPPXQLVPHDYHFFHOOHGXSD\VDQFHOOHGHO·RXYULHU
Si Xiao Wu artisan pickpocket, son premier long métrage montre surtout
GHVSD\VDQVGHVSROLFLHUVGHVFRPPHUoDQWVGHVWUDÀTXDQWVGHVK{WHVses de karaoké et autres pickpockets, dès le second, PlatformGRQW
l’action est située entre 1979 et 1989, dans l’après-révolution culturelle, le
monde ouvrier est représenté à travers un père ouvrier qui s’oppose à un
ÀOVVHGLVDQW©RXYULHUGHVDUWVªLODSSDUWLHQWjXQHSHWLWHWURXSHG·DUtistes naviguant entre musique et théâtre, au gré des modes) ou encore à
WUDYHUVXQWUqVEHDXSHUVRQQDJHGHPLQHXUVHVDFULÀDQWSRXUOHVpWXGHV
GH VD V±XU 6XLYURQW GDQV OH UHJLVWUH GH OD ÀFWLRQ OHV RXYULHUV VH WXDQW
jODUpQRYDWLRQGH3pNLQHQSUpYLVLRQGHV-HX[RO\PSLTXHVGHGDQV
The World RXELHQOHVRXYULHUVpPLJUpVGHO·LQWpULHXUWUDYDLOODQWj
#E TEXTE EST UNE VERSION REMANImE DU CHAPITRE ¦ 4ENTATIVE D´HYBRIDATION 24 City § DE MON LIVRE ,E CINmMA
DE *IA :HANGKE .O FUTURE MADE IN #HINA 0RESSES UNIVERSITAIRES DE 2ENNES COLLECTION ¦ ,E 3PECTACULAIRE §
P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &)!.4 !NTONY ODGpPROLWLRQG·XQHYLOOHHQWLqUHGDQVODUpJLRQGXEDUUDJHK\GURpOHFWULTXHGHV7URLV*RUJHVDYDQWVRQLPPHUVLRQGDQVStill Life (QFHTXL
concerne le registre documentaire, on trouve notamment des ouvriers pris
pour modèles par un peintre dans Dong, tourné simultanément à Still Life,
DX PrPH HQGURLW DYHF OHV PrPHV SHUVRQQHV HW OD ÀJXUH GH O·RXYULHU \
HVWSOXVTXHGDQVWRXWDXWUHÀOPH[SORUpHH[SORLWpHVXEOLPpHSDUO·DUW
et Useless GDQVOHTXHO-LDV·LQWpUHVVHjGHVRXYULHUVGXWH[WLOHHWUHtrouve des mineurs.
24 City RSqUHTXDQWjOXLXQHIXVLRQWHQWHXQHK\EULGDWLRQVHMRXDQW
entre deux registres qu’on s’échine à opposer alors qu’ils appartiennent
FODLUHPHQWjODPrPH©HVSqFHªOHFLQpPD-LD\GpYHORSSH la veine industrielle de Useless en donnant cette fois la parole aux ouvriers alors qu’il
QHIDLVDLWTXHSDVVHUSDUPLHX[GDQVOHÀOPSUpFpGHQW­O·RUJDQLVDWLRQ
spatiale de Useless &DQWRQ 3DULV )HQ\DQJ UpSRQG OD FRQFHQWUDWLRQ HQ
un lieu unique et surtout l’organisation temporelle de 24 City qui permet
d’évoquer la Chine d’hier, celle d’aujourd’hui et celle de demain dans un
bel exercice – certes un peu théorique – de mise en perspective relevant de
O·KLVWRULFLWpHWFRQWULEXDQWjOXWWHUFRQWUHXQGpÀFLWGHPpPRLUHRXYULqUH
SDUWLFXOLqUHPHQWLPSRUWDQWGDQVFHSD\V0DLVLOHVWDXIRQGTXHVWLRQGH
ODPrPHFKRVHGDQVOHVGHX[ÀOPVG·XQHLQWHUURJDWLRQVXUODUHFRQQDLVsance ou non d’un travail fourni et de l’inscription d’individus dans cette
vaste communauté qu’est la Chine.
24 City HVW GRQF HQWLqUHPHQW ÀOPp j &KHQJGX TXDWUH PLOOLRQV G·KDELWDQWVYLOOHVLWXpHGDQVOHFHQWUHRXHVWGXSD\VFDSLWDOHGHODSURYLQFH
GX6LFKXDQVpYqUHPHQWWRXFKpHSDUXQWUHPEOHPHQWGHWHUUHHQPDL
DSUqVOHWRXUQDJH3OXVH[DFWHPHQWLOHVWÀOPpGDQVO·XVLQHPLOLWDLUHG·pWDW
QXPpURVSpFLDOLVpHGDQVODFRQVWUXFWLRQG·DYLRQVDXPRPHQWGHVD
transformation en complexe résidentiel et commercial moderne de luxe,
EDSWLVp©&LW\ªHQUpIpUHQFHjXQSRqPHDQFLHQFpOpEUDQWODYLOOHHWTXL
GLWQRWDPPHQW©/HVKLELVFXVÁHXULVVDLHQWGDQVOD&LWp&KHQJGXUHVSOHQGLVVDLWHWSURVSpUDLWª-LD\DUpFROWpXQJUDQGQRPEUHGHWpPRLJQDJHV
sur la vie quotidienne dans cette cité industrielle durant une cinquantaine
d’années. Puis il en a sélectionné quelques-uns, en a condensé d’autres
en un seul et en a même créé de toutes pièces. Il assume là jusqu’au bout
l’ingérence sur le réel que suppose le projet qui est le sien, un projet ambiWLHX[UHODWLIjO·+LVWRLUHGHOD&KLQHHWTXLQpFHVVLWHVHORQOXLG·RXWUHSDVVHUFHUWDLQVFORLVRQQHPHQWVHQFRQYRTXDQWVDQVYHUJRJQHHWDXÀQDOVDQV
véritable distinction, les deux sources d’inspiration du cinéma comme de
tout art que sont le réel et l’imaginaire.
.OTONS QUE CEUX QUI N´ONT PAS mTm RETENUS DANS LE ½LM ONT FAIT L´OBJET DE LA PUBLICATION EN #HINE D´UN LIVRE
INTITULm ª LA RENCONTRE DES OUVRIERS
# DE 2%#)43 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE /HFLQpDVWHGpFODUHDORUVGDQVOHGRVVLHUGHSUHVVHGXÀOP©0HWWUH
HQSDUDOOqOHOHGRFXPHQWDLUHHWODÀFWLRQpWDLWSRXUPRLODPHLOOHXUHIDoRQ
G·DIIURQWHUO·+LVWRLUHGHOD&KLQHHQWUHHW&HWWHKLVWRLUHHVWVLmultanément construite par les faits et par l’imaginationª-LDpYLWHDORUV
ELHQGHVpFXHLOVOLpVjODUHQFRQWUHHQWUH+LVWRLUHHWFLQpPD,OSDUYLHQWLFLj
©SUpVHQWLÀHUªVRQSURSRVjWUDYHUVGHVGLVSRVLWLIVWHVWLPRQLDX[YDULpVHQ
GLYHUVLÀDQWOHVJpQpUDWLRQVGHWpPRLQVHQSDUYHQDQWjpFKDSSHUDXWRXW
nostalgie et même en accédant à des projections vers la Chine de demain.
5.% 3).'5,)È2% 02/0/3)4)/. $2!-!452')15%
/H ÀOP UHSRVH GRQF JUDQGHPHQW VXU GHV WpPRLJQDJHV KXLW H[DFWHment, quatre provenant d’hommes, quatre de femmes, toutes générations
confondues. Au moins quatre modes de transmission d’un vécu ouvrier
VRQWFRQYRTXpVSDUOHÀOPWpPRLJQDJHVUppFULWVWpPRLJQDJHVDXWKHQWLTXHVPDLVLQWHUSUpWpVSDUGHVFRPpGLHQVWpPRLJQDJHVV\QWKpWLVpVHWLQterprétés par des comédiens, témoignages inventés. La démarche, audacieuse, paraîtra assurément choquante pour les tenants d’une certaine
pureté documentaire bien utopique et qui crieront à la tromperie sur la
marchandise. Elle constitue cependant une nouvelle illustration du fait
que pour approfondir la réalité, un cinéaste peut s’autoriser des manipulations de la sorte, un détour par le mensonge pourvu qu’il sache précisément pourquoi il le fait, pourvu qu’il le fasse avec tact et aboutisse à une
certaine vérité. Tout cela n’est donc pas entièrement nouveau, Robert FlaKHUW\PHWWDQW1DQRRNHQVFqQHHQ-RULV,YHQVHW+HQUL6WRUFNUHFRQVtituant en 1933 des manifestations de mineurs pour Borinage, par exemple,
QHIDLVDLHQWÀQDOHPHQWULHQG·DXWUHHWF·HVWGDQVODÀOLDWLRQGHFHX[OjTX·LO
IDXWLQVFULUHOHÀOPELHQSOXVTXHGDQVFHOOHG·XQHSOXW{WQDYUDQWHWHQGDQFHDFWXHOOHHWWpOpYLVXHOOHDX©GRFXÀFWLRQª
Avant de nous interroger sur ce que nous dit de la Chine la parole de
ces ouvriers, il convient de questionner la variété des dispositifs utilisés
SRXUFDSWHUODSDUROHFRPPHWUDFHG·XQSDVVpTXLVHGpOLWH2QVDLWTXHOHV
conditions dans lesquelles on recueille un témoignage agissent fortement
sur celui-ci comme sur sa réception par le spectateur. De ce point de vuelà, Jia a toute latitude et choisir tel ou tel espace pour tel ou tel témoin aura
des implications essentielles dont il aura la pleine responsabilité. PréciVRQVGRQFOHVOLHX[GDQVOHVTXHOVLQWHUYLHQQHQWFHVWpPRLJQDJHV
*)! :HANGKE ¦ ª PROPOS DU ½LM § DANS LE DOSSIER DE PRESSE DE 24 City CONSULTABLE SUR WWWADVITAMDISTRI
BUTIONCOM P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &)!.4 !NTONY 7pPRLQRXYULHUGDQVXQDWHOLHUGpVDIIHFWp
7pPRLQFKHIGHODVpFXULWpGDQVXQHVDOOHGHVSHFWDFOH
7pPRLQRXYULqUHOLFHQFLpHGDQVXQEXV
7pPRLQRXYULqUHGDQVXQEXUHDXGpVDIIHFWp
7pPRLQDVVLVWDQWGXGLUHFWHXUJpQpUDOGDQVXQEDU
7pPRLQRXYULqUHGDQVXQVDORQGHFRLIIXUH
7pPRLQSUpVHQWDWHXUGHWpOpYLVLRQGDQVXQKDOOPRGHUQH
7pPRLQMHXQHIHPPHG·DIIDLUHVGDQVOHO\FpHGpVDIIHFWpGHO·XVLQH
Tous ont à voir avec la condition ouvrière, qu’ils l’aient servie ou l’aient
subie et en parlent avec douleur ou nostalgie, ou bien qu’ils lui aient
échappé (les deux derniers), qu’ils s’en soient émancipés.
3UHPLqUH FRQVWDWDWLRQ OHV WpPRLQV UHVWHQW ÀJpV VHSW IRLV VXU KXLW LOV
restent assis, toujours seuls dans le cadre, presque toujours face caméra.
Cet agencement provoque une certaine sérénité, évacue toute possibilité
GHFRQWUDGLFWLRQRXGHGpEDWWRXWHQIDYRULVDQWXQW\SHG·pPRWLRQOLpj
l’introspection et à la confession. Il délivre chaque fois un et un seul point
de vue, et le cinéaste n’est pas là pour s’opposer au libre cours du témoiJQDJH QL SRXU IDLUH GLUH DX WpPRLQ FH TX·LO Q·D SDV HQYLH GH GLUH +RUV
champ, il peut intervenir ici ou là pour relancer ce dernier mais sa position
GHPHXUHXQHSRVLWLRQGHUHWUDLW2QHQWHQGjSHLQHVHVTXHVWLRQVFRPPH
s’il n’était pas prévu qu’il en pose, loin du seul micro présent entièrement
dévolu à la parole ouvrière.
En termes scénographiques, et plus particulièrement de perspective, il
est intéressant de remarquer que Jia leur a à tous ménagé une profondeur
de champ. La plupart du temps elles passent par des fenêtres ou portes
impliquant un hors-champ prégnant, celui des travaux de transformation
du site. Et lorsque ça n’est plus possible, comme dans l’immense salle de
VSHFWDFOHGHO·XVLQHRQWURXYHXQHVROXWLRQSDOOLDWLYH1RQVDQVXQFHUWDLQ
humour, derrière le témoin, deux joueurs, dont Jia lui-même, se livrent sur
la scène à un match de badminton. C’est que, de l’industrie à l’immobilier
de luxe, du spectacle au sport, du communisme au libéralisme, il n’est
ÀQDOHPHQWTXHVWLRQGDQVFHÀOPTXHGHGpQDWXUDWLRQMXVWLÀDQWGHFHWWH
manière-là aussi le recours au documentaire et jODÀFWLRQ
# DE 2%#)43 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE ,E SECRmTAIRE 'UAN &ENGJIU CHEF DE LA SECTION SmCURITm DE L´USINE 2Q SHXW GLVWLQJXHU OHV WpPRLJQDJHV VH GpURXODQW GDQV GHV OLHX[ GpVDIIHFWpVGHFHX[TXLVRQWÀOPpVGDQVGHVHVSDFHVTXLRQWHQFRUHRXGpMj
XQHIRQFWLRQSUpFLVH/·DWHOLHUOHEXUHDXRXOHO\FpHUHOqYHQWGXSUHPLHU
cas et accueillent les témoignages où l’émotion est la plus forte. Tournés
YHUVOHSDVVpLOVVXVFLWHQWFHSHQGDQWGHVDWWLWXGHVWUqVGLYHUVHVQRVWDOJLH
chez l’ouvrier, tristesse chez l’ouvrière, désir de revanche sociale chez la
jeune femme. La salle de spectacle, le bar et le salon de coiffure semblent
devoir conserver leur fonction initiale. Ils accueillent, eux, des témoignaJHVPRLQVJUDYHVOHJDUGLHQUHVWHGDQVOHVIDLWVOHMHXQHFDGUHHVWGU{OH
dans l’évocation de souvenirs de jeunesse, l’ouvrière du salon de coiffure
parle tout de même de jours heureux. Quant à l’ouvrière dans le bus et le
présentateur de télévision dans le hall moderne, on peut aisément les opposer. L’une évoquant la façon dont elle a été congédiée se retrouve logiquement seule à bord d’un véhicule de transports en commun tandis que
OHMHXQHKRPPHD\DQWUHQRQFpDXPRGqOHFRPPXQLVWHTXHVRQVWDWXWGH
ÀOVG·RXYULHUOXLLPSRVDLWVHUHWURXYHGDQVXQGpFRUUXWLODQWTXLLQFDUQH
la Chine de demain.
En termes de mise en scène, on constate que seuls les deux premiers
WpPRLJQDJHVEpQpÀFLHQWGHSOXVLHXUVD[HVGHSULVHGHYXH'DQVFHFDVLOV
sont en place, prêts à témoigner, dès le premier plan où ils apparaissent,
VDQVPpQDJHPHQWSDUWLFXOLHU/HVVL[DXWUHVWpPRLQVEpQpÀFLHQWGHPLVHV
en situation, suivent un parcours avant de se retrouver dans un disposiWLIWHVWLPRQLDOIDLWG·XQVHXOD[HGHSULVHGHYXHG·XQVHXOSODQÀ[H/D
IHPPHjODSHUIXVLRQGDQVOHVUXHVGHO·XVLQH©3HWLWHÁHXUªVXLYLHGDQV
ses activités de chanteuse au sein d’un collectif féminin, la jeune femme
d’affaires quittant sa chambre valise en main avant de circuler en voiture
de nouveau riche sont autant d’exemples de cette manière d’extirper les
personnages d’un lieu précis, d’activités banales, par le recours évident
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &)!.4 !NTONY au scénario, avant de les installer dans des conditions propices à l’éclosion de la parole et d’un nouvel éclairage sur la condition ouvrière dans
O·XVLQH
0DLVOHGLVSRVLWLIQHVDXUDLWVHUpGXLUHjFHOD/HPRQWDJH\FRQWULEXH
également fortement. Là encore on se doit de distinguer les deux premiers
WpPRLJQDJHVGHVVL[VXLYDQWV'DQVOHSUHPLHUO·RXYULHUHVWÀOPpHQSODQV
rapprochés mais l’ultime plan le montre en plan d’ensemble, seul au miOLHXG·XQLPPHQVHDWHOLHUO·LVRODQWLQVLVWDQWVXUODÀQG·XQHpSRTXHFHOOH
qu’il vient précisément de raconter à sa manière. Le second multiplie les
angles en maintenant toutefois le témoin à bonne distance, comme si l’intérêt du cinéaste se portait davantage sur la partie de badminton ; un plan
de coupe sur celle-ci l’atteste d’ailleurs.
Le fait de montage essentiel de six des huit témoignages (les deux premiers faisant exception), ce sont ces césures matérialisées par des plans
noirs, subits ou obtenus par des fondus, qui scandent chacun d’entre eux.
Acteurs ou non, les témoins sont ainsi soumis à la faillibilité. Le choix de
FHV FpVXUHV UpSRQG j XQH ORJLTXH SXUHPHQW U\WKPLTXH (OOHV QH SURYRquent pas forcément de ruptures sonores, ne viennent pas spécialement
gommer des moments d’intense émotion chez un cinéaste particulièrement pudique, ni ne servent à pallier des phases de silence dues à une
soudaine absence d’inspiration. Elles viennent donc rappeler que l’émergence de souvenirs liés à une époque en train de disparaître se fait plutôt,
et pour diverses raisons, dans la discontinuité. Et comme à son habitude,
à une question de fond Jia donne une réponse de cinéma.
%.42% ./34!,')% $%3 0,53 Ä'b3 %4 %30/)2 $%3 0,53 *%5.%3
Que nous disent au juste de la Chine l’ensemble de ces témoignages ?
Sur des modes bien distincts, ils dressent tout d’abord le portrait d’un
passé récent déjà implicitement regretté. « Je donne une possibilité à ces
personnes de s’exprimer sur leur vie, ce qu’ils n’ont pas souvent l’occasion de faire. En Chine, le travail de mémoire reste quasi inexistant et
cela m’importait de me glisser dans ce territoire immense et inexploréª
précise le cinéaste. Ce passé n’est certes pas idéalisé mais face aux incertitudes de l’avenir, au sentiment, pour les plus âgés, d’être exclus de la
PRGHUQLVDWLRQGXSD\VRQVHQWXQHYRORQWpGHV·\DFFURFKHUHWPrPHG·\
replonger. Le premier témoignage est de ce point de vue particulièrement
VLJQLÀFDWLIG·HQWUpHVDLVLSDUO·pPRWLRQJRUJHQRXpHGDQVOHSUHPLHUSODQ
*)! :HANGKE ¦ #ANNES *OURNAL DU FESTIVAL § PROPOS RECUEILLIS PAR /LIVIER *OYARD ,ES )NROCKUPTIBLES N€
MAI P # DE 2%#)43 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE où il apparaît, l’ouvrier parle d’un attachement quasiment sensuel à l’outil
qu’il manipulait à longueur de journée puis de ses relations avec son maître d’atelier avec lequel Jia organise une émouvante rencontre.
Tous les témoignages oscillent entre histoires individuelles et apparteQDQFHjODQDWLRQFKLQRLVH2QSRXUUDLWSDVVHUHQUHYXHOHVKXLWWpPRLJQDges dans cette perspective, je n’en évoquerai que deux. L’ouvrière dans le
EXV²ODVHXOHIHPPHQRQLQWHUSUpWpHSDUXQHFRPpGLHQQH²UHODWHO·K\SRcrisie de la direction au moment de son licenciement en organisant une
cérémonie d’adieux mais aussi les implications de celui-ci sur sa vie de
famille, sa reconversion en couturière au moment de sa mise au ban de
l’usine, de son exclusion d’un collectif lié à l’idée de nation. Elle a alors
FHWWHSKUDVHPDJQLÀTXHGHVLPSOLFLWp©4XDQGRQDTXHOTXHFKRVHjIDLUH
RQYLHLOOLWSOXVOHQWHPHQWªGDQVODTXHOOHRQSHXWYRLUWRXWHODGpPDUFKH
GXÀOPYRLUHGHO·±XYUHGH-LD=KDQJNHOHTXHOODUHSUHQGG·DLOOHXUVjVRQ
compte par l’intermédiaire d’un intertitre qui vient clore la séquence. En
agissant, en témoignant, en saisissant cette Chine-là, quelque part Jia ralenWLWODFRXUVHHIIUpQpHGDQVODTXHOOHHOOHV·HVWODQFpHLO©UHWLHQWªOHWHPSV
Le second exemple est relatif au jeune cadre, dans un bar, auteur du plus
léger des témoignages, racontant quant à lui son enfance et sa jeunesse
GDQVO·XVLQHGHVLG\OOHVDPRXUHXVHVGHVEDJDUUHVHQWUHFODQV,OUHOLHVRQ
KLVWRLUHjFHOOHGXSD\VHQVHUHPpPRUDQWjKDXWHYRL[FRPPHQWXQMRXUGH
VpTXHVWUpSDUXQFODQULYDOHWSURPLVjXQHERQQHUDFOpHLOIXWpSDUJQpHQKRPPDJHj=KRX(QODL3UHPLHUPLQLVWUHFKLQRLVGHMXVTX·jVD
PRUWFHPrPHMRXUGH$LQVLXQUHSqUHKLVWRULTXHHWQDWLRQDOFROOHFWLI
par excellence, est assimilé à un événement personnel. Ce geste, celui du cinéaste, aussi anecdotique qu’il puisse paraître, peut dès lors être vu comme
une insubordination aux principes premiers du communisme.
,E JEUNE CADRE INTERPRmTm PAR UN ACTEUR
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &)!.4 !NTONY Mais les témoignages n’ont pas pour seule vocation d’évoquer le passé. La Chine d’aujourd’hui mais surtout celle de demain sont plus particulièrement convoquées par les deux derniers, émanant des plus jeunes
SHUVRQQDJHV &RPPH O·pFULW 2OLYLHU 6pJXUHW LO V·DJLW DXVVL GH © MHWHU XQ
QRXYHDXSRQWYHUVFHWWHKLVWRLUHHQFRUHVLSURFKHOHVÀFWLRQVPDFDEUHV
GXFRPPXQLVPHPDRwVWHRXGHODUpYROXWLRQFXOWXUHOOHGRQWOHÀOPIDLW
VRXYHQWpWDWDYDQWG·DIIURQWHUFHOOHVGHO·K\SHUFURLVVDQFHHWGHODVXSHUconsommationª/HMHXQHSUpVHQWDWHXUGHWpOpYLVLRQHWODMHXQHIHPPH
d’affaires, originaires de Chengdu, issus de sa classe ouvrière, de l’usiQHVRQWGRQFOjSRXUPDQLIHVWHUOHXUYRORQWpG·H[WLUSDWLRQGHFODVVH
Le garçon évoque sa précoce volonté d’échapper à un destin tout tracé
UHOHYDQWGHO·HPEULJDGHPHQWWDQGLVTXHODÀOOHSHUVRQQDJHFUppGHWRXWHV
SLqFHVDIÀFKDQWVDFXSLGLWpHWVHVDPELWLRQVSDUOHGHUHYDQFKHVRFLDOH/H
IDLWTX·HOOHFO{WOHÀOPHQGRPLQDQWODYLOOHQ·HVWSDVDQRGLQHWODLVVHSUpVDJHUXQHGRPLQDWLRQpFRQRPLTXHGHOD&KLQHSDUFHW\SHGHSHUVRQQHV
LVVXHVG·XQV\VWqPHTXLOHVDSURIRQGpPHQWPDUTXpHVV·DSSUrWDQWjHQ
servir un tout autre.
(QWUHOD&KLQHG·KLHUHWFHOOHGHGHPDLQHVWFHVLV€UTXH-LDÀOPHOD
Chine d’aujourd’hui ? Entre les ruines du passé et le chantier de l’avenir,
quelle place pour envisager le présent ? Rappelons ici cette réplique de
Xiao Wu, artisan pickpocket dans la bouche du frère du personnage prinFLSDO © /H YLHX[ YD rWUH GpWUXLW PDLV MH QH YRLV MDPDLV YHQLU OH QHXI ª
Avec 24 City OHQHXIHVWOjHQÀQOjjSRUWpHGHPDLQPDLVÀQDOHPHQWj
peine visible et surtout destiné à une petite frange car, pour en rester aux
SHUVRQQDJHV SULQFLSDX[ GX ÀOP FHOD QH FRQFHUQH JXqUH SOXV TXH GHX[
des huit témoins. Ce présent, on ira donc le chercher tout entier dans les
splendides transitions entre les témoignages.
!UDELg DE LA PAROLE
« Depuis quelques années, je me disais que les transformations radicales que subit la Chine, et leurs conséquences sur les individus, appelaient
XQHIRUPHFLQpPDWRJUDSKLTXHVSpFLÀTXH(WMHPHVXLVUHQGXFRPSWHTXH
FHQ·pWDLWSOXVODSHLQHGHVpSDUHUOHUpHOHWO·LPDJLQDLUH&LW\PpODQJH
les deux sans jamais faire apparaître les couturesª6LOHVFRXWXUHVQ·DSSDUDLVVHQW HIIHFWLYHPHQW SDV F·HVW TXH -LD =KDQJNH D SDUWLFXOLqUHPHQW
soigné les phases intermédiaires entre ses témoignages et dans lesquelles
LOHVWSRVVLEOHGHYRLUOHPHLOOHXUGXÀOP
/LIVIER 3EGURET ¦ ± #ITY² LA VIE DES oTRES § ,IBmRATION DU MAI P *)! :HANGKE ¦ #ANNES *OURNAL DU FESTIVAL § ,ES )NROCKUPTIBLES N€ MAI loc. cit P .
# DE 2%#)43 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE 2QSHXWpYRTXHUOjOHVSODQVUpFXUUHQWVVXUO·HQWUpHGHO·XVLQHjPRLQV
de la considérer comme une sortie, rendant ainsi plus aisée l’inévitable
DOOXVLRQDXÀOPGHVIUqUHV/XPLqUHHWSRLQWDQWGXPrPHFRXSODFRQVWDQFH
de la rencontre entre le monde ouvrier et le cinéma, de son invention à
DXMRXUG·KXL/HÀOPV·RXYUHVXUO·XQG·HX[HQSORQJpHHWSODQG·HQVHPble, montrant une foule compacte entrant dans l’usine. Le plan reviendra
régulièrement, à quatre reprises, toujours avec le même axe et la même
pFKHOOHGHSODQPDLVDYHFGHVPRGLÀFDWLRQVQRWDEOHVHQWUpHSHXIUpTXHQtée, entrée déserte, entrée remaniée en ôtant les lettres du nom de l’usine
surplombant la porte principale, entrée relookée, modernisée par le nouYHDXQRPGXOLHX©&LW\ª'qVORUVO·DFFXPXODWLRQGHFHVSODQVSHUmet au cinéaste d’aiguiser son regard sur un monde qui disparaît tandis
TX·XQDXWUHV·DQQRQFH2QHVWDORUVGDQVODVLJQLÀFDWLRQPXHWWHSOXVTXH
GDQVOHV\PEROLVPHG·XQHUHGRXWDEOHHIÀFDFLWpTXDQWDX[PXWDWLRQVVXbies par le monde ouvrier.
Autre élément transitoire primordial, l’insertion d’extraits de poèmes
sur des cartons ou bien à même les plans. Cette touche poétique dans un
monde en pleine déliquescence n’est pas sans échos avec la situation ou
ODSDUROHGHVRXYULHUV3RqPHVFKLQRLVRXELHQSRqPHVGH:LOOLDP%XWOHU
<HDWV VRQW DLQVL FRQYRTXpV 3DUPL FHX[ GX SRqWH LUODQGDLV LO HQ HVW XQ
qui agit plus fortement que les autres sur l’univers décrit. Il s’agit d’un
très court poème de quatre vers, intitulé Split milk (Lait répandu) qui donQHVHORQOHVVRXVWLWUHV©/HVFKRVHVTXHQRXVDYRQVSHQVpHVHWIDLWHVVH
répandent forcément avant de s’estomper. Comme du lait versé sur une
SLHUUHªHWVHORQXQHWUDGXFWLRQXQSHXSOXVVDYDQWH©1RXVTXLDYRQVDJL
et pensé, Qui avons pensé et agi, Devons aller au hasard et nous disperser
&RPPHGXODLWUpSDQGXVXUXQHSLHUUHª
7RXVOHVWpPRLQVGXÀOPSHXYHQWVHUHFRQQDvWUHGDQVFH©QRXVªOHV
SOXVkJpVFRPPHOHVSOXVMHXQHV1XOGRXWHTXH-LDV·HVWOXLUHFRQQXGDQV
la démarche d’un poète justement tiraillé entre réalité et imagination. Et
tous deux prennent soin de ne point sombrer dans la fatalité des bouleversements du monde, ne serait-ce que par le recours à la création. Le plan
refermant la séquence – la poussière investissant la totalité du champ de
ODFDPpUDVXLWHDXG\QDPLWDJHG·XQEkWLPHQWVXUO·DLUG·XQHInternationale
reprise par une chorale féminine – constitue alors un équivalent visuel
YRLUHVRQRUHDXSRqPHGH<HDWV
Les nombreuses poses de nature photographique prises pour Jia par
des individus ou des familles vivant autour de l’usine disent bien, elles
aussi, l’ingérence du cinéaste sur le réel. En leur demandant de poser im
7ILLIAM " 9EATS ,´ESCALIER EN SPIRALE 6ERDIER PRmSENTm ANNOTm ET TRADUIT DE L´ANGLAIS PAR *EAN9VES -AS
SON P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &)!.4 !NTONY PRELOHVHWIDFHFDPpUDHQOHVVDLVLVVDQWGDQVXQFDGUHÀ[HHQJOREDQWOHXU
environnement délabré contribuant à la photogénie, il fait montre, là aussi,
autrement que par la parole, d’une volonté testimoniale. L’étonnante phoWRJpQLHGHFHVSODQVGDQVOHVTXHOVODÀJXUHGHO·RXYULHUHVWVLQJXOLqUHPHQW
sublimée sans pour autant être déconnectée, c’est aussi celle de la Chine
HQSOHLQHPXWDWLRQFHOOHTX·DVXWURXYHUOHFLQpDVWHGHÀOPHQÀOP(WRQ
n’est absolument pas dans une douteuse et irresponsable esthétisation du
prolétariat comme on en voit si souvent.
/UVRIERS POSANT POUR LA CAMmRA DE *IA :HANGKE
24 City montre aussi le travail, principalement un travail de démoliWLRQ PDLV OH ÀOP SURSRVH WRXW G·DERUG OD UHVWLWXWLRQ GH JHVWHV OLpV j OD
IRQWH*HVWHVH[pFXWpVDYHFPDHVWULDVXUXQHPDWLqUHURXJHR\DQWHWRXMRXUV
IDVFLQDQWHjREVHUYHU5pVLGXVG·XQV\VWqPHGHSURGXFWLRQjWUqVJUDQGH
échelle, ces quelques plans ont assurément quelque chose à voir avec la
démarche de cinéastes s’autorisant à reconstituer pour l’éternité (permise
SDUOHFLQpPDXQHSUDWLTXHSHUGXHGH)ODKHUW\j%UDXOWHW3HUUDXOWHQ
passant par Rossellini pour prendre trois exemples liés à la pêche (phoques, marsouins, thon). Saisir un geste avant qu’il ne disparaisse peut être
aussi important que le témoignage oral, même si moins immédiat. Mais
voilà, la Chine moderne et ses pelleteuses frappent à la porte de l’usine et
le processus de destruction est irrémédiablement enclenché. Comme dans
À l’ouest des rails GH:DQJ%LQJPDLVDXVVLFRPPHGDQVStill Life, on casse
tout en sauvant ce qui peut l’être. Jia insiste alors sur ces énormes machines que l’on extirpe des ateliers par camion et qu’il accompagne un temps
sur la route sans pour autant révéler leur destination, possible incarnation
de ce qu’est la mondialisation et son cortège de délocalisations.
2QREVHUYHpJDOHPHQWGDQVFHVSODQVGHWUDQVLWLRQTXHO·LGpHGHFRPmunauté subsiste malgré tout. Même si la Chine des réformes et de la libéralisation économique incite à un passage du collectif à l’individuel, on ne
# DE 2%#)43 2EPRmSENTATIONS DE L´OUVRIER DANS #ITY DE *IA :HANGKE V·DIIUDQFKLWSDVDXVVLIDFLOHPHQWG·XQFHUWDLQUpÁH[HFRPPXQDXWDLUH,OHQ
YDDLQVLGHODVpTXHQFHG·RXYHUWXUHGXÀOPFpUpPRQLHRIÀFLHOOHFpOpEUDQW
ODGpORFDOLVDWLRQGXVLWH/jDXVVLTXHOTXHVSODQVVXIÀVHQW$SUqVXQFKDQW
patriotique, une foule compacte et disciplinée applaudit quand il le faut
un orateur qui leur fait croire que les bouleversements qu’ils subissent
s’inscrivent dans le cadre d’une évolution favorable pour l’usine et, parGHOjSRXUHX[7RXMRXUVPpÀDQWHQYHUVOHVGLVFRXUVRIÀFLHOVjSHLQHO·RUDteur a-t-il entamé le sien que Jia l’abandonne pour son premier témoin,
non sans passer par des couloirs et escaliers contigus à la salle et vides ;
OLHX[RYLHQWV·pFKRXHUODERQQHSDUROHSURIHVVpH(WSXLVLO\DFHSODQ
sur des ouvrières entonnant L’Internationale. Porteur d’un décalage entre
l’utopie du chant et l’état dans lequel se trouve l’usine de ces ouvrières, le
plan replace subtilement la Chine face à ses contradictions.
Pour conclure sur ce superbe hommage à la classe ouvrière, pour insister sur sa dimension historique et ouvrir quelques perspectives, citons Jia
=KDQJNHTXLLQWHUURJpVXUVHVSURMHWVGDQVOHMRXUQDOL’Humanité, évoque
HQWUHDXWUHV©XQORQJ>[email protected]ÀQGHODG\QDVWLH4LQJTXLVHGproule autour de 1900 et va être mon premier sujet historique. Pourquoi ? À
FDXVHGXSUpVHQW'HSXLVOHV&KLQRLVFKHUFKHQWjPRGHUQLVHUOHSD\V
HWFHWWHH[SpULHQFHHVWWRXMRXUVHQFRXUV(QUHYR\DQWO·KLVWRLUHGHFHVFHQW
dernières années, je vais montrer que l’utopie a conduit à des réformes, à
GHO·H[SpULPHQWDWLRQjODUpYROXWLRQPDLVTXHF·HVWOHSHXSOHTXLDSD\p
le prixª
*)! :HANGKE ¦ 4OUTE UNE MmMOIRE COLLECTIVE ALLAIT DISPARAsTRE § PROPOS RECUEILLIS PAR *EAN 2OY ,´(UMANITm DU
MARS P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD Partie V
Varia
,´ENTREPRISE 3IGNAUX 'IROD ,´ENTREPRISE 3IGNAUX 'IROD
DE L´mMAILLERIE FAMILIALE
g LA SOCImTm INTERNATIONALE
&RANCIS 0mROZ
1
OS ROUTES ET NOS AUTOROUTES, LES RUES DE NOS VILLES sont autant
d’itinéraires jalonnés de multiples panneaux de signalisation
routière, d’informations diverses, touristiques et commerciales
SULQFLSDOHPHQW3HXG·XVDJHUVKRUPLVFHX[GX+DXW-XUDVDYHQWTXHOD
société Signaux Girod, une entreprise posée presque comme perdue sur
les hauteurs de Morez, est un des principaux fournisseurs français de ce
matériel routier et urbain.
À première vue, cette localisation géographique surprend. Et les
questions qui viennent alors à l’esprit donnent envie d’en savoir plus,
de connaître l’histoire de cette entreprise. Pourquoi un fabricant de panQHDX[GHVLJQDOLVDWLRQURXWLqUHHVWLOLPSODQWpGDQVOH+DXW-XUDjO·pFDUW
des grands axes de circulation ? Comment expliquer le développement de
cette entreprise ?
,% #!$2% -/2b:)%.
5N SITE DIF½CILE
/H +DXW-XUD HVW XQH WHUUH pOHYpH DX[ SD\VDJHV IDLWV GH PRQWV HW GH
YDX[WpPRLQVYLVLEOHVGHVSOLVDQWLFOLQDX[HWV\QFOLQDX['HODUJHVFURXpes, souvent aplanies, portent les forêts où dominent sapins et épicéas.
8QHWHUUHGHVYDOORQVSHXSURGXFWLYHHWXQFOLPDWGLIÀFLOHQ·RQWSDVSHU-
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS PLVGHVGpIULFKHPHQWVLPSRUWDQWVDYDQWODÀQGX0R\HQ$JH1. Le relief ne
rend pas aisée la circulation des hommes et des marchandises. Blotties au
creux des vallées, les villes se développent tardivement. Dominée par de
hauts escarpements, la cité de Morez est logée au fond de l’étroite vallée
de la Bienne et les habitations s’étirent sur plus de trois kilomètres. Considéré aujourd’hui comme pittoresque, le site de Morez semblait posséder
peu d’atouts pour son développement.
5N DmVELOPPEMENT ARTISANAL TARDIF MAIS ORIGINAL
Au cœur des monts jurassiens, Morez dispose d’eau en abondance. Mais
ce n’est pas avant le XVIe siècle que les premières activités artisanales se saiVLVVHQWGHO·pQHUJLHK\GUDXOLTXHHWV·LPSODQWHQWGDQVODFRPEH(Q
&ODXGH*LURG3, originaire de Bellefontaine, sur les hauteurs de Morez, est
le premier à utiliser l’eau de la Bienne pour actionner un moulin, un martinet et une clouterie. Et pendant tout le XVIe siècle, les créations de petites
HQWLWpVDUWLVDQDOHVVHVXFFqGHQWPRXOLQVVFLHULHVIRUJHVWDLOODQGHULHV«
Un instant menacé par la guerre de Trente Ans, la prospérité morézienne
reprend et de nouveaux artisans s’installent. Parmi eux, Jean-Baptiste Dollard qui obtient au XVIIIe siècle que le tracé de la nouvelle route en direction
GHOD6XLVVHSDVVHSDUODYDOOpHGHOD%LHQQH2XYHUWHjODÀQGXXVIIIe siècle,
cette route favorise l’essor de la ville qui, désormais, sort de son enclaYHPHQW HW V·LQWqJUH DX[ ÁX[ FRPPHUFLDX[ MXUDVVLHQV /D FORXWHULH HW OHV
petites industries mécaniques telles que tireries, laminoirs et rubanneries
prospèrent au XVIIIe siècle et dans la première moitié du XIXe siècle. Comme
6DLQW&ODXGHHW0RUWHDXODYLOOHGH0RUH]HVWOHFHQWUHG·XQV\VWqPHpFRnomique original. Les négociants moréziens rassemblent la production
artisanale dispersée dans les ateliers de la ville et des villages du canton.
Puis ils l’écoulent sur l’ensemble du territoire national, utilisant les serviFHVGHV*UDQGYDOOLHUVFHVWUDQVSRUWHXUVGH6DLQW/DXUHQWHQ*UDQGYDX[
et même à l’étranger. Des méthodes productives artisanales sont ainsi
associées à une organisation commerciale capitaliste. Insérée dans l’économie nationale, l’artisanat morézien est confronté à une vive concurrence. Seule une capacité permanente d’adaptation permet aux entreprises
les plus innovantes et les plus performantes de traverser les décennies.
-HDQ0DUF2OLYLHUDpWXGLpFHSURFHVVXVG·LQGXVWULDOLVDWLRQGDQVVDWKqVH
0IERRE 'RESSER #LAUDE -ERCIER !NDRm 2OBERT ET ALII ,E GUIDE DU *URA 0ARIS ,A -ANUFACTURE P )BIDEM
0EUToTRE ESTCE UN LOINTAIN ANCoTRE DES mMAILLEURS 'IROD 0IERRE 'RESSER #LAUDE -ERCIER !NDRm 2OBERT ET ALII ,E GUIDE DU *URA OP CIT P )BIDEM
#LAUDE)SABELLE "RELOT ¦ 5N mQUILIBRE DANS LA TENSION mCONOMIE ET SOCImTm FRANCCOMTOISE TRADITIONNELLES
DANS 2OLAND &IETIER DIR (ISTOIRE DE LA &RANCHE#OMTm 4OULOUSE 0RIVAT P # DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD consacrée à la lunetterie, thèse publiée par le Comité des travaux histoULTXHVHWVFLHQWLÀTXHV&7+6VRXVOHWLWUHDes clous, des horloges et des lunettes. Les campagnards moréziens en industrie (1780-1914)7. Cette recherche
a été vulgarisée par les musées des techniques et cultures comtoises sous
le titre Une industrie à la campagne. Le canton de Morez entre 1780 et 19148.
L’auteur montre dans son remarquable travail que le modèle morézien de
proto-industrialisation est particulièrement original puisque dépourvu de
centre urbain de commandement. Il en diffère aussi par la poursuite et le
UHQRXYHOOHPHQWGXV\VWqPHSURGXFWLITXLGHODVRUWHQHFRQGXLWSDVjOD
paupérisation et à l’exode rural.
,ES DmBUTS DE L´mMAILLERIE
Au milieu du XIXe siècle, des activités artisanales prennent de l’ampleur
HW VH WUDQVIRUPHQW HQ LQGXVWULHV 2XWUH OD OXQHWWHULH O·KRUORJHULH LQVWDOOpH j 0RUH] GqV HW ODUJHPHQW GpYHORSSpH GDQV OH SUHPLHU WLHUV GX
XIXe siècle9, supplante les clouteries qui ne subsistent que dans les villages les plus reculés, à La Mouille en particulier. La production horlogère
SUHQGUDSLGHPHQWGHO·LPSRUWDQFHKRUORJHVVRQWIDEULTXpHVGDQV
OHFDQWRQGH0RUH]HQHWHQ10. L’émaillerie est une activité complémentaire de l’horlogerie. Jusque dans la seconde moitié du
XVIIIe siècle, les horlogers moréziens ignorent l’art de l’émaillerie et imSRUWHQWGH6XLVVHOHVFDGUDQVG·KRUORJHHQW{OHpPDLOOpH(Q+HQUL
+XJXHQLQ G·2WWDQG XQ 6XLVVH RULJLQDLUH GX /RFOH YLHQW HQVHLJQHU O·DUW
de l’émaillerie aux artisans comtois11. L’émaillerie est un travail délicat.
1pFHVVLWDQW XQ RXWLOODJH LPSRUWDQW QRWDPPHQW XQ IRXU LO VH SUrWH SHX
à la dispersion et les émailleurs sont groupés au XIXe siècle à Morez et à
Morbier (Q XQ pPDLOOHXU WUDYDLOOH j 0RUELHU HW VRL[DQWHKXLW j
Morez. En 1911, l’émailleur de Morbier est devenu un chef d’entreprise
qui fournit du travail à quatre personnes. À Morez, à la même époque,
existent treize ateliers d’émaillerie dont dix emploient du personnel non
IDPLOLDO$XWRWDOSHUVRQQHVYLYHQWGHO·pPDLOOHULHj0RUH]13­ODÀQ
du XIXe siècle, l’artisanat morézien est ainsi en évolution. Des activités anciennes ne correspondent plus à la réalité économique. Travaillant pour
*EAN-ARC /LIVIER, Des clous, des horloges et des lunettes. ,ES CAMPAGNARDS MORmZIENS EN INDUSTRIE 0ARIS #4(3 (ISTOIRE *EAN-ARC /LIVIER 5NE INDUSTRIE g LA CAMPAGNE ,E CANTON DE -OREZ ENTRE ET 3ALINSLES"AINS -USmE
DES TECHNIQUES ET CULTURES COMTOISES 9VES "LANC ,´ARTISANAT DANS LE CANTON DE -OREZ 5NIVERSITm DE &RANCHE#OMTm MmMOIRE DE MAsTRISE D´HISTOIRE
P #LAUDE)SABELLE "RELOT ¦ 5N mQUILIBRE¨ § LOC CIT P 9VES "LANC ,´ARTISANAT¨ OP CIT P )BIDEM P ET P )BIDEM P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS une consommation locale, elles étaient une survivance de l’économie préindustrielle. Au contraire, la capacité d’adaptation des lunetiers, horlogers
et émailleurs leur assure une réelle compétitivité. C’est dans ce contexte
TX·DSSDUDvWO·pPDLOOHULH*LURG
,´b-!),,%2)% -!2#%!5 ')2/$ %4 &),3
!RSnNE 'IROD
Au début du XXe VLqFOH$UVqQH*LURGRXYULHUSHLQWUHVXUpPDLOj0RUH]
comprend vite que la main-d’œuvre et le savoir-faire sont les sources prinFLSDOHVGHSOXVYDOXHGDQVFHW\SHGHWUDYDLO(QjO·kJHGHDQV
D\DQWUpXVVLjUpXQLUXQFDSLWDOGHGpSDUWpTXLYDOHQWjHQYLURQWURLVPRLV
de salaire, il décide de s’établir à son compte. Il installe son atelier dans
sa maison de Morez et son capital est investi dans l’achat d’une cisaille à
main pour la découpe des grandes pièces, d’une cisaille à roulette pour
la réalisation des pièces plus ouvragées et dans la construction d’un four
j FRTXHV SDU XQ PDoRQ /·LQVWDOODWLRQ HVW UpGXLWH OHV W{OHV VRQW GpFRXSpHVGDQVXQHSHWLWHSLqFHTXLWLHQWOLHXG·DWHOLHUHW$UVqQH*LURGUpDOLVH
la décoration, opération la plus délicate sur la table de la cuisine familiale,
devant la fenêtre.
$UVqQH*LURGQHSHXWVHFRQWHQWHUGHSURGXLUHGHVFDGUDQVG·KRUORJH
(QHIIHWHQOHVpPDLOOHXUVPRUEHUDQVHWPRUp]LHQVGpMjHQDFWLYLWp
VXIÀVHQWjDSSURYLVLRQQHUOHVKRUORJHUVORFDX[HWUpJLRQDX[,ORULHQWHVRQ
activité vers la fabrication de plaques funéraires et les destine au marché
national. Il charge un représentant multicarte de démarcher les entreprises de pompes funèbres, les marbriers et même les quincailliers. Le repréVHQWDQWSURVSHFWHOHPDUFKpWUDQVPHWOHVFRPPDQGHVj$UVqQH*LURGTXL
dans un délai d’une à deux semaines, fait parvenir les plaques17. La jeune
entreprise s’inscrit ainsi dans la tradition morézienne d’ouverture sur le
marché national.
La réalisation des plaques funéraires n’est pas un travail régulier dans
O·DQQpH'HX[WHPSVIRUWVU\WKPHQWOHWUDYDLOGHO·pPDLOOHXUOHSULQWHPSV
et principalement les fêtes des Rameaux et de Pâques, instants où les tomEHVVRQWQHWWR\pHVHWUHÁHXULHVHWOD7RXVVDLQWVRQWGHVSpULRGHVG·LQWHQVH
DFWLYLWp$UVqQH*LURGFRQVDFUHDLQVLH[FOXVLYHPHQWOHVWURLVGHUQLqUHVVHmaines d’octobre à la fabrication des plaques funéraires, en en réalisant
#LAUDE)SABELLE "RELOT ¦ 5N mQUILIBRE¨ § LOC CIT P %NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN ,E REPRmSENTANT DE COMMERCE MULTICARTE DIFFUSE LES PRODUITS DE PLUSIEURS ENTREPRISES
%NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN # DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD jusqu’à quatre cents par semaine. Les plaques ont souvent la forme de
cœur et sont alors connues sous le nom de cœurs moréziens18. La fabrication
des plaques funéraires est un travail répétitif. En dehors du texte comméPRUDWLIOHVLQVFULSWLRQVRXOHVGpFRUVVRQWFRPPXQVjWRXVOHVPRGqOHV
SDUH[HPSOH©LFLUHSRVHª©SULH]SRXUOXLªRXHQFRUHOHF±XUVXUPRQWp
G·XQHFURL[3RXUODUpDOLVDWLRQGHFHVGpFRUV$UVqQH*LURGPHWDXSRLQW
des pochoirs192XWUHOHVSODTXHVIXQpUDLUHV$UVqQH*LURGUpDOLVHGHVHQseignes commerciales, des plaques de rue, des plaques de porte et de boîtes aux lettres, des plaques pour les bidons de lait déposés dans les fruitières, des plaques nominatives pour les bancs d’église avec parfois dans
FHGHUQLHUFDVGHVFRPPDQGHVTXLSHXYHQWDWWHLQGUHSLqFHVTXDQGXQ
curé décide de rénover son église.
-ARCEAU 'IROD
$UVqQH*LURGPHXUWHQjO·kJHGHDQV,OODLVVHSUpPDWXUpPHQW
ODGLUHFWLRQGHO·HQWUHSULVHjVRQÀOV0DUFHDXÇJpGHDQVDYHFGpMjTXDtre années d’expérience professionnelle dans l’émaillerie, ce dernier continue de travailler sous la conduite de sa mère avant de diriger réellement
la petite entreprise. Pendant la première moitié du XXe siècle, l’entreprise
FRQVHUYHXQFDUDFWqUHIDPLOLDO2XWUHOHVPHPEUHVGHODIDPLOOH*LURGHOOH
n’emploie qu’un ouvrier et qu’un apprenti. Cette modestie n’est pas due à
XQPDQTXHG·DPELWLRQ(OOHUpSRQGjXQHVLPSOHFRQVLGpUDWLRQÀVFDOHFDU
pour les entreprises artisanales, seule la plus-value qui résulte du travail
de la main-d’œuvre non familiale est imposée par l’État.
0RGHVWHSDUVDWDLOOHO·pPDLOOHULH*LURGQ·HQHVWSDVPRLQVLQQRYDQWH
0DUFHDX *LURG HVW XQ WHFKQLFLHQ LQYHQWLI ©$YHF VRQ ERQ VHQV LO D IDLW
prospérer cette petite entreprise par un tas d’astuces pour travailler plus
YLWH,ODWURXYpGHVFRPELQHVSRXUIDLUHODGpFRUDWLRQGHVSLqFHVªVHVRXYLHQWVRQÀOVDvQp0LFKHO0DUFHDX*LURGPHWDLQVLDXSRLQWODWHFKQLTXH
du brossage. Au lieu d’écrire à la main les textes des plaques funéraires,
l’inscription est composée à partir de lettres découpées dans du carton.
L’innovation vient surtout du fait qu’une première couche d’émail, mélanJHGHVDEOHVLOLFHX[G·R[\GHVGHSRWDVVLXPHWGHVRGLXPHWG·R[\GHVPptalliques, est déposée sous une forme liquide sur la plaque de tôle. Après
séchage, une seconde couche de couleur différente est appliquée. Après
)BIDEM #F AUSSI 4OMBES D´AUTREFOIS OUVRAGE COLLECTIF ,ONSLE3AUNIER 3OCImTm D´mMULATION DU *URA PHOTO N€
)BIDEM
)BIDEM
!NONYME DANS 2mALITmS FRANCCOMTOISES OCTOBRE P %NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN !NONYME DANS ,A 6OIX DU *URA OCTOBRE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS un temps de séchage, le pochoir est mis sur la plaque et l’artisan, avec une
brosse, enlève l’émail en surplus, faisant ainsi apparaître l’inscription.
Puis la pièce passe au four pour cuire et durcir l’émail. Quelques années
SOXV WDUG 0DUFHDX *LURG DGRSWH OH SURFpGp DQJODLV GH O·pFUDQ GH VRLH
Au lieu d’appliquer l’émail au pistolet sur la pièce et de retirer ensuite le
surplus par brossage, l’émailleur emploie un tissu léger comportant des
zones perméables qui pourront être traversées par l’émail liquide et des
zones rendues imperméables. L’émail liquide n’est plus appliqué au pistolet. Une mince lame d’acier, la racle, le fait passer à travers le tissu.
Ces améliorations techniques, et en particulier l’usage de l’écran de
soie, permettent d’envisager des productions en série. Dans l’entre-deuxJXHUUHVO·pPDLOOHULH*LURGIDEULTXHRXWUHOHVDUWLFOHVGpMjFLWpVGHVSODques publicitaires, la clientèle étant prospectée par l’intermédiaire d’agenFHV GH SXEOLFLWp 0DLV F·HVW XQH FOLHQWqOH GLIÀFLOH TXL FKHUFKH WRXMRXUV j
IDLUHEDLVVHUOHVSUL[HQDUJXDQWGHVGpIDXWVPLQLPHVOLpVVXUWRXWjODÀGplité des couleurs.
-ICHEL ET 0IERRE 'IROD
3HQGDQWOD6HFRQGH*XHUUHPRQGLDOHHQ0DUFHDX*LURGIDLWWUDYDLOOHUO·DvQpGHVHVVL[HQIDQWV0LFKHODORUVkJpGHDQV(QVRQ
frère Pierre entre dans l’entreprise muni d’un brevet commercial. À cette
pSRTXHO·pPDLOOHULH*LURGHPSORLHpJDOHPHQWXQRXYULHUHWXQDSSUHQWL.
$X GpEXW GHV DQQpHV FLQTXDQWH OHV *LURG SqUH HW ÀOV HVWLPHQW TXH OD
concurrence est trop rude sur le marché de la publicité. Ils se tournent vers
la fabrication de panneaux de signalisation routière. Cette conversion est
facilitée par le développement de l’automobile mais aussi par l’apparition
d’un nouveau procédé technique, la sérigraphie. Ce procédé industriel
d’impression, dérivé du pochoir et de l’écran de soie, permet un travail
encore plus rapide, plus régulier. Il ouvre la voie à la production en grande
série8QHDXWUHPRGLÀFDWLRQPDMHXUHDSSDUDvWDYHFOHVDQQpHVVRL[DQWH
L’émail disparaît des panneaux de signalisation routière et est remplacé
SDUXQÀOPUpWURUpÁpFKLVVDQWXQHLQQRYDWLRQELHQW{WUHQGXHREOLJDWRLUH
SDUOHPLQLVWqUHGHV7UDQVSRUWV&HÀOPHVWFROOpVXUXQSDQQHDXHQDOXPLnium &HWWH PXWDWLRQ WUDQVIRUPH FRQVLGpUDEOHPHQW O·HQWUHSULVH *LURG
La fabrication des articles émaillés, plaques funéraires, plaques de rue et
)BIDEM
)BIDEM
%NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN )BIDEM
!NONYME DANS ,A 6OIX DU *URA LOC CIT
%NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN # DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD SODTXHVSRXUOD61&)HVWSRXUVXLYLHMXVTX·HQSXLVSUHVTXHWRWDOHment abandonnée. L’entreprise concentre alors son activité sur la signalisation routière30. Cette évolution est favorisée par le développement des
UpVHDX[URXWLHUVHWDXWRURXWLHUVIUDQoDLVHWSDUOHIDLWTX·LOQ·\DHQ)UDQFH
au début des années soixante que deux fabricants de panneaux de signalisation. Il fallait alors près de six mois pour obtenir un panneau31.
Cette nouvelle activité bouleverse considérablement l’émaillerie famiOLDOH$SUqVOD6HFRQGH*XHUUHPRQGLDOHHOOHHPSOR\DLWRXWUH0DUFHDXHW
VHVGHX[ÀOVXQRXYULHUHWXQDSSUHQWLHWHOOHRFFXSDLWXQORFDOGHPqtres carrés. Progressivement, la surface des ateliers augmente. Elle passe à
PqWUHVFDUUpVSXLVjDXGpEXWGHVDQQpHVVRL[DQWH/HGpYHORSSHment de l’activité de signalisation routière rend les locaux moréziens trop
exigus et impose un déménagement. Toutefois, l’entreprise demeure attaFKpHDXFDGUHGX+DXW-XUD(OOHQHVHGpSODFHTXHGHTXHOTXHVNLORPqWUHV
HWHQHOOHV·LQVWDOOHj%HOOHIRQWDLQHVXUOHSODWHDXTXLGRPLQH0RUH]
et qui s’ouvre vers Chapelle-des-Bois. C’est dans cette petite commune
jusqu’alors assez peu concernée par l’artisanat et sans aucune tradition
d’émaillerieTXHO·HQWUHSULVH*LURGSUHQGSRVVHVVLRQGHPqWUHVFDUrés de locaux dans lesquels elle emploie vingt-cinq personnes33.
5.% ./56%,,% %.42%02)3%
,A DmCORATION URBAINE
/·pPDLOOHULH *LURG RSqUH DX GpEXW GHV DQQpHV VRL[DQWHGL[ XQ YpULtable changement d’échelle. D’entreprise familiale, elle devient une soFLpWp SDU DFWLRQV HW SUHQG OH QRP GH 6LJQDX[ *LURG (OOH HPSORLH TXDUDQWHSHUVRQQHVHQFHQWYLQJWKXLWHQ et deux cent cinquante
en 1997/HFKLIIUHG·DIIDLUHVFRQQDvWpJDOHPHQWXQHIRUWHSURJUHVVLRQ IUDQFVHQHQPLOOLRQVGHIUDQFVHQ
PLOOLRQVHQHWPLOOLRQVHQ37 avec une fabrication annuelOHGHSOXVGHSDQQHDX[GHVLJQDOLVDWLRQjODÀQGHVDQQpHV38.
)BIDEM
!NONYME DANS 2mALITmS FRANCCOMTOISES LOC CIT
9VES "LANC ,´ARTISANAT¨ OP CIT P %NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN !NONYME DANS 2mALITmS FRANCCOMTOISES loc. cit
!NONYME DANS ,E 0ROGRnS MARS !NONYME DANS 2mALITmS FRANCCOMTOISES LOC CIT
!NONYME DANS ,E 0ROGRnS MARS !NONYME DANS ,E 0ROGRnS OCTOBRE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS $XPDUVODVRFLpWp6LJQDX[*LURGDUpDOLVpXQFKLIIUHG·DIIDLUHVGH
HXURV39.
(Q HW PDOJUp FHWWH FURLVVDQFH O·HQWUHSULVH 6LJQDX[ *LURG UHVWH
XQHHQWUHSULVHIDPLOLDOHDXFDSLWDOGHHXURV(OOHHVWFRQWU{OpH
SDUODVRFLpWpjDFWLRQVVLPSOLÀpHV6RFLpWpIDPLOLDOHGHJHVWLRQ*LURGTXL
HVWGLULJpHSDU3KLOLSSH*LURGUHSUpVHQWDQWGHODFLQTXLqPHJpQpUDWLRQGH
ODIDPLOOH/DIDPLOOH*LURGGpWLHQWGXFDSLWDOGH6LJQDX[*LURGHW
GHVGURLWVGHYRWHFRUUHVSRQGDQWDX[DFWLRQV.
/·HQWUHSULVH6LJQDX[*LURGYHXWDSSDUDvWUHUDSLGHPHQWFRPPHXQGpcorateur urbain. Elle propose, dès les années 1990, une gamme très diverVLÀpH G·DUWLFOHV GH VLJQDOLVDWLRQ HW G·LQIRUPDWLRQ SDQQHDX[ GH JDUH HQ
plastique avec éclairage incorporé, plans des pistes des stations de ski,
panneaux de téléjalonnement qui informent en temps réel sur les places
GHVWDWLRQQHPHQWGLVSRQLEOHVGDQVXQHYLOOHÁpFKDJHVOXPLQHX[SDUGLRdes électroluminescentes… Le savoir-faire de l’entreprise a considérablement évolué en une trentaine d’années et le service de recherche et de
développement industriel est désormais vital pour la vie de l’entreprise.
Au début du XXIe VLqFOHFHVHIIRUWVQHÁpFKLVVHQWSDVHWODVRFLpWp6LJQDX[
*LURGGRQWOHVORJDQHVW©$PpQDJHRQVHQVHPEOHODYLOOHHWODURXWHªHVW
SUpVHQWHGDQVGHQRPEUHX[VHFWHXUV
‡signalisation de police routière (panneaux du code de la route)
‡signalisation électronique
‡signalisation directionnelle
‡signalisation horizontale
‡aménagement de chaussées et pavés en résine
‡plaques de rues et numéros de maison
‡produits en émail
‡mise en valeur du patrimoine
‡mobilier urbain, notamment abris de bus
‡ÁHXULVVHPHQWGHVYLOOHV
#ROISSANCE EXTERNE
/·HQWUHSULVH6LJQDX[*LURGQHJUDQGLWSDVXQLTXHPHQWSDUFURLVVDQFH
LQWHUQHOLPLWpHDXVLWHGH%HOOHIRQWDLQH(OOHFUpHDXVVLGHVÀOLDOHVHQ)UDQce puis à l’étranger. Cette formule augmente le prix de revient mais elle
permet de prendre sur place un volume plus important de commandes.
'HSOXVOHVÀOLDOHVGLVSRVHQWGHVWRFNVTXLSHUPHWWHQWGHVDWLVIDLUHUDSL
$OCUMENTS 3IGNAUX 'IROD.
)BIDEM
%NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN #ATALOGUE 3IGNAUX 'IROD # DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD dement les clients et ainsi d’améliorer l’image de marque de l’entreprise.
/HVÀOLDOHVVRQWFUppHVVRLWSDUODUHSULVHG·XQFRQFXUUHQWHQIDLOOLWHFRPPH
ce fut le cas à Toulouse avec la société Romain-Schelle, soit par association
avec une entreprise concurrente, en particulier avec l’entreprise nantaise
Lacroix. (Q VL OH VLqJH GH OD VRFLpWp 6LJQDX[ *LURG HVW WRXMRXUV j
Bellefontaine dans le Jura, l’entreprise est présente sur une vingtaine de
VLWHVHQ)UDQFH
‡ SAS Signalisation à Avranches (Manche)
‡ Île de France Signalisationj(FTXHYLOO\<YHOLQHV
‡ Électronique, Signalisation, Installation (ESI)j6DLQW/DXUHQW%ODQFK\
(Pas-de-Calais)
‡ Picardie Signalisation à Amiens (Somme)
‡ Est Girod à Fains-Veel (Meuse)
‡ Signaux Girod Ouest à La Crèche (Deux-Sèvres)
‡ Signalisation Centralej&OHUPRQW)HUUDQG3X\GH'{PH
‡ Rodez Signalisationj2QHWOH&KkWHDX$YH\URQ
‡ Chelle Cahors à Cahors (Lot)
‡ Chelle Adour Signalisation à Saint-Paul-les-Dax (Landes)
‡ Tarn Aveyron Signalisation à Albi (Tarn)
‡ Chelle Signalisationj7RXORXVH+DXWH*DURQQH
‡ Signalisation Audoisej&DUFDVVRQQHHW1DUERQQH$XGH
‡ Signalisation catalaneDX6ROHU3\UpQpHV2ULHQWDOHV
‡ Signal Centre à Arpajon-sur-Cère (Cantal)
‡ LRS Signalisationj%DLOODUJXHV+pUDXOW
‡ A 2 S Signalisation à Carros (Alpes-Maritimes)
‡ ALP’Signalisation à Fontenex (Savoie)
‡ Rangheard Signalisation à Décines (Rhône)
‡ Saône-et-Loire Signalisationj&KDUQD\OHV0DFRQ6D{QHHW/RLUH
‡ Signaux Girod%RXUJRJQHj'LMRQ&{WHG·2U
‡ Application 2000j&ROPDU+DXW5KLQ
‡ Girod Signal à Chavelot (Vosges)
(Q O·HQWUHSULVH FUpp XQH QRXYHOOH ÀOLDOH Signaux Girod Services
Routiers. Basée à Arbois (Jura), cette nouvelle société est spécialisée dans
les activités de marquage au sol, de pose et de location de matériels de
signalisation et de balisage de chantier. Et la société Application 2000 a pris
le nom de Signaux Girod Alsace, une volonté nette de renforcer l’identité de
l’entreprise jurassienne.
!NONYME DANS 2mALITmS FRANCCOMTOISES LOC CIT
)BIDEM
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS '·DXWUHVÀOLDOHVVRXYHQWGLULJpHVSDUGHVSHUVRQQHVTXLRQWFRPPHQFp
OHXUFDUULqUHj%HOOHIRQWDLQHVRQWGpYHORSSpHVjO·pWUDQJHU
‡ Ringway SignsHQ*UDQGH%UHWDJQH
‡ GS Plus en République tchèque
‡ Senales Girod en Espagne
‡ SNSV au Portugal
‡ Alpha GirodHQ+RQJULH
‡ Girod Simnalisare Rutiera SRL en Roumanie
‡ SSS au Canada
$YHFFHVÀOLDOHVTXLSURGXLVHQWSRXUOHPDUFKpORFDOVXUOHTXHOHOOHVVRQW
LPSODQWpHVO·HQWUHSULVH6LJQDX[*LURGHVWGHYHQXHOHGHX[LqPHIDEULFDQW
européen de panneaux de signalisation2XWUHVDÀOLDOHFDQDGLHQQH666
HOOHDUDFKHWpXQFRQFXUUHQWj&DOJDU\/·HQWUHSULVH6LJQDX[*LURGGpWLHQW
DLQVLGXPDUFKpFDQDGLHQHWHPSORLHVRL[DQWHGL[SHUVRQQHV(OOHD
aussi créé une société de commercialisation aux États-Unis.
/HV FRPSWHV GH O·H[HUFLFH DUUrWpV DX PDUV ODLVVHQW DSSDUDvWUHXQFKLIIUHG·DIIDLUHVGHHXURVFRQWUHHXURV
DX PDUV GH FH UpVXOWDW SURYLHQQHQW GHV DFWLYLWpV UpDOLVpHV
HQ )UDQFH HXURV GHV DFWLYLWpV UpDOLVpHV HQ (XURSH
HXURVHWGHVDFWLYLWpVH[WUDHXURSpHQQHVHXURV
&HVFKLIIUHVUHODWLYLVHQW OD GLYHUVLÀFDWLRQJpRJUDSKLTXH GHVDFWLYLWpV /D
FRPSDUDLVRQGHVFKLIIUHVGHHWGHWpPRLJQHQWGHODVXMpWLRQGHV
activités de l’entrepris aux aléas climatiques. Toutes les activités de signalisation routière et urbaine sont tributaires de la météorologie. Un hiver
long, un automne et un printemps pluvieux ne permettent pas d’appliTXHU GH OD SHLQWXUH DX VRO '·R OD EDLVVH GH GX FKLIIUH G·DIIDLUHV
UpDOLVpHQ)UDQFHHQGHSRXUOHVDFWLYLWpVHXURSpHQQHVDORUVTXH
OHVDFWLYLWpVFDQDGLHQQHVFRQQDLVVDLHQWXQHFURLVVDQFHGH
Ces chiffres montrent aussi la prudence des dirigeants de l’entreprise
TXL QH UHFKHUFKHQW SDV XQH FURLVVDQFH j WRXW SUL[ 3RXUWDQW HQ OHV
LQYHVWLVVHPHQWV RQW pWp LPSRUWDQWV VH PRQWDQW j PLOOLRQV G·HXURV
GRQWPLOOLRQVFRQVDFUpVjGHVDFKDWVGHWHUUDLQVHWjGHVFRQVWUXFWLRQVGH
EkWLPHQWVDORUVTXHO·DQQpHSUpFpGHQWHPLOOLRQVG·HXURVDYDLHQWpWp
LQYHVWLV/·HQGHWWHPHQWGH6LJQDX[*LURGUHVWHUDLVRQQDEOH,OVHPRQWHDX
PDUVjHXURVVRLWGXFKLIIUHG·DIIDLUHV.
#ATALOGUE 3IGNAUX 'IROD !NONYME DANS ,A 6OIX DU *URA LOC CIT
)BIDEM
$OCUMENT 3IGNAUX 'IROD.
# DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD ,! 02/",b-!4)15% $% ,! $)6%23)&)#!4)/. $%3 !#4)6)4b3
Cette stratégie d’ouverture va de pair avec une ouverture du capital.
/·HQWUHSULVH6LJQDX[*LURGHVWFRWpHVXUOHVHFRQGPDUFKpGHODERXUVHGH
/\RQGHSXLVOHPRLVGHMXLQ. De la sorte, l’entreprise peut solliciter
OHPDUFKpERXUVLHUSRXUÀQDQFHUVHVLQYHVWLVVHPHQWVHWSHXWRSpUHUGHV
GLYHUVLÀFDWLRQVSDUOHELDLVGHSULVHVGHSDUWLFLSDWLRQ. Les dirigeants de
l’entreprise considèrent en effet que se limiter à la mono-industrie de la siJQDOLVDWLRQURXWLqUHTXLGpSHQGjGHVFRPPDQGHVGXVHFWHXUSXEOLF
est dangereux car il est trop soumis à la possibilité d’une soudaine concurrence ou à l’éventualité d’un changement de politique gouvernementale
ou régionale.
&·HVWDLQVLTXHO·HQWUHSULVH6LJQDX[*LURGV·HVWSRUWpHDFTXpUHXUGHOD
totalité de l’entreprise Soudométal, un fournisseur parisien de fer à souGHUGHGXFDSLWDOGHODVRFLpWp©-DQG-ªFUpDWULFHGHSDUIXPVHW
GHFRVPpWLTXHVHWGHGXFDSLWDOGH©-HDQ/HYHW6$ªXQHOXQHWWHULHFUppHHQHWLQVWDOOpHj&KDX[GX'RPELHI.Ces associations sont
EpQpÀTXHVDX[HQWUHSULVHVFRQFHUQpHV6LJQDX[*LURGGLYHUVLÀDQWVHVDFWLYLWpV HW OLPLWDQW DLQVL OHV ULVTXHV ÀQDQFLHUV O·DXWUH HQWUHSULVH UHFHYDQW
une aide technique et un soutien à l’exportation. Mais cette volonté de
GLYHUVLÀFDWLRQGHVDFWLYLWpVGDQVGHVVHFWHXUVQHUHOHYDQWSDVGLUHFWHPHQW
GXFRUSVGHPpWLHUVHUpYqOHSDUIRLVGLIÀFLOH6LJQDX[*LURGVHUHWLUHELHQ
YLWHGXFDSLWDOGH©-DQG-ªHWGH©-HDQ/HYHW6$ªHWHQODVRFLpWp
6RXGR0pWDOHVWYHQGXH'pVRUPDLVO·HQWUHSULVH6LJQDX[*LURGFRQFHQWUH
ses efforts et sa volonté de développement sur des secteurs liés à l’aménagement urbain.
En quelques années, l’entreprise de Bellefontaine a réussi à s’approprier
près du quart du marché national du panneau routier, autoroutier, urbain
et touristique. L’entreprise occupe le second rang mondial de la signalisation verticale. Cette position a été acquise par le rapprochement de l’entreprise et de ses clients. Les panneaux sont le plus souvent conçus, fabriTXpVGLVWULEXpVHWPLVHQSODFHSDUO·LQWHUPpGLDLUHGHVÀOLDOHVLPSODQWpHV
dans les régions françaises ou à l’étranger. Elle emploie 1100 personnes
GDQVOHPRQGHGRQWHQ)UDQFHHWVXUOHVHXOVLWHGH%HOOHIRQWDLQH
Le site originel de Bellefontaine qui reste le principal site du groupe est
RUJDQLVpDXWRXUGHTXHOTXHVJUDQGVVHUYLFHVSODQLÀFDWLRQGHODSURGXF-
!NONYME DANS 2mALITmS FRANCCOMTOISES DmCEMBRE P )BIDEM
)BIDEM
)BIDEM
!NONYME DANS ,E 0ROGRnS MARS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS tion, bureau d’études graphiques, bureau d’études mécaniques, atelier de
tôlerie, atelier d’émaillage, atelier de montage, atelier de sérigraphie.
5N RENOUVEAU DE L´mMAIL
En changeant son nom initial d’Émaillerie Marceau Girod et Fils en celui
GH6LJQDX[*LURGHQSDVVDQWGXVWDWXWGHSHWLWHHQWUHSULVHORFDOHjFHOXL
de société multinationale, l’entreprise a-t-elle rompu tout lien avec ses origines ? Il n’en est rien et les travaux d’émaillerie représentent toujours 3 à
GXFKLIIUHG·DIIDLUHV/·HQWUHSULVH6LJQDX[*LURGUHVWHO·XQGHVTXDWUH
derniers émailleurs industriels français. Présente dans les activités de l’entreprise, l’émaillerie est aussi, et peut-être toujours, profondément ancrée
GDQVODSHQVpHGHVGLULJHDQWVGHO·HQWUHSULVH3RXU0LFKHO*LURGO·pPDLO
doit réapparaître dans les objets de la vie courante. Sans vouloir dévoiler
ses projets, il précise qu’il est en contact avec des architectes d’intérieur.
Il œuvre aussi pour réintroduire l’émail au cœur des villes. Deux exemSOHVPRQWUHQWVRQDFWLRQ­O·LVVXHGHO·pGLWLRQGHOD)rWHGX+DXW
-XUD0LFKHO*LURGDRIIHUWjODFRPPXQHGH%RLVG·$PRQWXQEODVRQIDLW
de bois sculpté et de panneaux émaillés représentant les quatre spécialités
GXYLOODJHOHFORFKHUOHWUDYDLOGXERLVOHVpSLFpDVHWXQVNLHXU3OXVVLJQLÀFDWLIHQFRUHGHFHSRVVLEOHUHWRXUGHO·pPDLOSRXUODVHFRQGHDQQpH
scolaire consécutive, des élèves du collège des Rousses ont travaillé, avec
O·DVVLVWDQFH GH 0LFKHO *LURG VXU XQ SURMHW G·HQVHLJQHV HQ W{OH pPDLOOpH
pour les commerces des Rousses. À cette date, la première enseigne, celle
de la Poste, est en place.
,A VOLONTm D´UN DmVELOPPEMENT DURABLE
1pHHQWHUUHKDXWMXUDVVLHQQHGDQVXQHQYLURQQHPHQWQDWXUHOGHTXDOLWpHWSURFKHGXSDUFQDWXUHOGX+DXW-XUDDYHFGHVGLULJHDQWVSURFKHV
des milieux sportifs et proches du milieu montagnard, l’entreprise Signaux
*LURGHVWSDUWLFXOLqUHPHQWVHQVLEOHjODSUpVHUYDWLRQGHO·HQYLURQQHPHQW
Elle a mis en place une politique volontariste de développement durable
au travers de trois aspects. Pour elle, la notion de développement durable
n’est pas seulement un vocable écologique au sens noble de l’expression.
'pYHORSSHPHQWGXUDEOHVLJQLÀHHQSUHPLHUOLHXGXUDELOLWpGHO·HQWUHSULVH
par la proximité géographique des clients et la prise de participation dans
GHVVRFLpWpVLQQRYDQWHVjIRUWHYDOHXUDMRXWpHHWSRVVpGDQWGHVV\QHUJLHV
#ATALOGUE 3IGNAUX 'IROD !NONYME DANS ,A 6OIX DU *URA LOC CIT
%NTRETIEN DE L´AUTEUR AVEC -ICHEL 'IROD JUIN !NONYME DANS ,E 0ROGRnS SEPTEMBRE # DE 2%#)43 ,´ENTREPRISE 3IGNAUX 'IROD fortes avec le groupe. Il s’agit ainsi de ne plus renouveler les erreurs des
années 1990 qui ont vu des implications dans des sociétés étrangères à la
signalisation.
3RXU6LJQDX[*LURGGpYHORSSHPHQWGXUDEOHVLJQLÀHDXVVLUHVSHFWGH
O·HQYLURQQHPHQW/·HQWUHSULVHDREWHQXODFHUWLÀFDWLRQ,62OHRFWREUHHQGRWDQWOHVLWHGH%HOOHIRQWDLQHG·XQHVWDWLRQGHWUDLWHPHQW
GHV HDX[ GH W\SH SK\VLFRFKLPLTXH G·XQ GLVSRVLWLI G·DVSLUDWLRQ GHV IXmées dégagées et a mis en place des silencieux. Elle procède en outre au
VWRFNDJHGHVGpFKHWVGDQJHUHX[DYDQWOHXUUHF\FODJH(OOHV·HIIRUFHDXVVL
de suivre attentivement la consommation des ressources (eaux, gaz et
électricité). Les dirigeants portent aussi un regard particulier au choix des
matériaux, utilisant de préférence aluminium et fer et valorisant les déFKHWVUHF\FODEOHVWHOVTXHSDSLHUVÀOPVSODVWLTXHVYHUUHRXHQFRUHFDUWRXches d’imprimante.
L’aspect social est le dernier volet de cette politique volontariste de
GpYHORSSHPHQWGXUDEOH(QWUHSULVHUHVWpHIDPLOLDOH6LJQDX[*LURGSRUWH
XQH DWWHQWLRQ SDUWLFXOLqUH j VHV HPSOR\pV WUqV PDMRULWDLUHPHQW HQ &',
/D PR\HQQH G·kJH GH DQV HW XQH DQFLHQQHWp PR\HQQH GH WUHL]H DQV
PRQWUHODÀGpOLWpGXSHUVRQQHO&HWWHVLWXDWLRQDVVH]SHXIUpTXHQWHV·H[SOLTXHSDUODSROLWLTXHVDODULDOHHWVRFLDOHGH6LJQDX[*LURG'HVDYDQWDJHV
PXOWLSOHVVRQWDFFRUGpVDXSHUVRQQHOLQWpUHVVHPHQWUpPXQpUDWLRQFRPplémentaire variable, politique annuelle de hausse collective des salaires
pJDOHRXVXSpULHXUHjO·LQÁDWLRQPLVHjGLVSRVLWLRQG·XQVHUYLFHGHWUDQVport collectif et titres-restaurants.
(QSOXVG·XQVLqFOHO·HQWUHSULVH*LURGHVWSDVVpHGHODVWUXFWXUHDUWLVDnale, avec un capital et un personnel limités, à une structure internationale.
L’ouverture de l’entreprise sur les marchés extra-régionaux ajoutée à une
perception toujours intacte de la nécessaire évolution des produits par des
efforts constants d’innovation expliquent cette évolution. Comme Jean0DUF2OLYLHUO·DPRQWUpjWUDYHUVO·H[HPSOHGHODOXQHWWHULHODUpXVVLWHGH
O·HQWUHSULVH*LURGHVWOHIUXLWG·XQHG\QDPLTXHHQWUHSUHQHXULDOHQRXUULH
d’une culture technique et commerciale éprouvée par plusieurs générations d’une même famille qui ont toutes eu, pour reprendre les termes de
-HDQ0DUF2OLYLHU©ODYRORQWpLQGLYLGXHOOHHWFROOHFWLYHGHSHUSpWXHUXQH
VRFLpWpSDVWRUDOHpTXLWDEOHJDUDQWLHGHVpTXLOLEUHVDQFLHQVª(WGHIDLWOD
UpXVVLWHÀQDQFLqUHGHVJpQpUDWLRQVGHODIDPLOOH*LURGHWSDUWLFXOLqUHPHQW
GHVSOXVUpFHQWHVQHV·HVWSDVDIÀFKpH
/DWUDQVIRUPDWLRQGHO·HQWUHSULVH*LURGQ·HVWSDVXQFDVLVROpGDQVOH
+DXW-XUD /D UpJLRQ Q·RIIUDQW SDV GH SHUVSHFWLYHV DJULFROHV VXIÀVDQWHV
$OCUMENT 3IGNAUX 'IROD 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 0b2/: &RANCIS pour assurer une prospérité même minime à ses habitants, ceux-ci ont dû
développer l’artisanat et surtout accroître leurs débouchés commerciaux
par une ouverture sur le territoire national et par une innovation permanente. Ainsi sont nées des entreprises pérennes et actives. L’industrie du
MRXHWHQRIIUHGHPXOWLSOHVH[HPSOHV0RQQHUHW6PRE\
Cette vitalité industrielle de la montagne jurassienne met à mal l’image
actuelle de l’aménagement du territoire français. La proximité des voies de
FRPPXQLFDWLRQTXLGUDLQHQWOHVÁX[GHPDUFKDQGLVHVHWODSUR[LPLWpGHV
centres urbains importants, véritables nœuds dans le réseau des échanges
modernes, ne sont pas des nécessités absolues pour développer une enWUHSULVHPXOWLQDWLRQDOH(QDORUVTXHOHXUVORFDX[PRUp]LHQVGHYHQDLHQWWURSH[LJXV0LFKHOHW3LHUUH*LURGQ·RQWSDVJDJQpXQHSODLQHDYHF
GHVFRPPXQLFDWLRQVDLVpHV/HXUDWWDFKHPHQWDX+DXW-XUDQHOHVDSDV
empêchés de développer davantage leur entreprise en une quarantaine
d’années qu’en trois quarts de siècle. Et surtout leur implantation à Bellefontaine a permis le maintien, dans un premier temps, puis le développement de l’emploi local, contribuant ainsi à l’aménagement d’une portion
GXWHUULWRLUHQDWLRQDOpYLWDQWXQSRVVLEOHSKpQRPqQHGHGpVHUWLÀFDWLRQ
6LOH+DXW-XUDHVWHQFRUHDXMRXUG·KXLXQH]RQHUHODWLYHPHQWDFWLYHHW
assez densément peuplée, il le doit à la persévérance d’entrepreneurs qui,
FRPPHODIDPLOOH*LURGVRQWGHPHXUpVDWWDFKpVjOHXUFDGUHJpRJUDSKLTXH WRXW HQ GpYHORSSDQW OHXU VDYRLUIDLUH /H +DXW-XUD WpPRLJQH DLQVL
G·XQHVSpFLÀFLWpLQGXVWULHOOHTX·LOFRQYLHQGUDLWGHGDYDQWDJHpWXGLHUWDQW
par des monographies d’entreprises que par un regard d’ensemble, dans
ODOLJQHWUDFpHSDU-HDQ0DUF2OLYLHU
#F !RMAND 3PICHER ,E JOUET JURASSIEN ,ONSLE3AUNIER # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR
9VES#LAUDE ,EQUIN
L
ES COUVERTS DE TABLE SONT-ILS DES OBJETS D’HISTOIRE ? Peut-on associer
histoire et conception industrielle, en une histoire qui – permetWDQWGHFRPSUHQGUHOHXUJHQqVHHWOHXUVVLJQLÀFDWLRQVPXOWLSOHV²
éclaire les concepteurs et les usagers de demain ? Réexaminer ces couverts
de table – objets aussi banals et inaperçus que possible – pourtant si riches de sens et nous instruisant d’évolutions sociales passées et présentes,
constitue un préalable pour celui qui veut les reconcevoir ou en créer de
nouveaux1. Comme F. Dagognet, c’est grâce à une « philosophie inverVpHªDOODQWGHO·REMHWDX[LGpHVTX·RQSHXW©HQWUHUGDYDQWDJHªGDQVOH
UpHOWRXWHQVHVLWXDQWGDQVXQHSHUVSHFWLYHG·DFWLRQDQDO\VHUO·REMHWSRXU
le transformer (ou plutôt le conformer à de nouveaux besoins).
3%04 #/56%243 $% "!3% 5. #(/)8 "!.!, 'DQVODIRXOHLQQRPEUDEOHGHVREMHWVPpQDJHUVUHWHQRQVHQVHSWSDUmi les récipients (creux et passifs) assiette, verre et bol et pour les ustensiOHV©SODWVªHWDFWLIVFRXWHDXFXLOOHUIRXUFKHWWHHWSHWLWHFXLOOHUTXHMH
distinguerai de sa grande sœur). Ils forment un ensemble.
,A FAMILLE DES SEPT COUVERTS
$VVLHWWHFRQoXHGqVOHQpROLWKLTXHHQFpUDPLTXHGpFRUpHFRPPHREjet de prestige ou plat collectif, elle n’apparaît que tardivement comme
%RWIN 6AN (ANDENHOVEN 9VES#LAUDE ,EQUIN ET &ABIENNE (IMBAUT $mCOUVRONS LES COUVERTS #AEN #2$0 DE
#AEN EN PARTENARIAT AVEC LA SOCImTm 'UY $EGRENNE &RANlOIS $AGOGNET bLOGE DE L´OBJET 0ARIS 6RIN P DU MoME AUTEUR ,ES DIEUX SONT DANS LA CUISINE 0A
RIS ,ES EMPoCHEURS DE PENSER EN ROND P 6OIR AUSSI #OLLECTIF /BJETS CIVILS DOMESTIQUES PRINCIPES
D´ANALYSE SCIENTI½QUE 0ARIS )MPRIMERIE NATIONALE P
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES assiette personnelle, d’abord sur la table princière de la Renaissance, pour
devenir familière au XIXe siècle.
9HUUH DQFLHQ VRXV GLYHUVHV IRUPHV HW PDWLqUHV FRUQH FRXSH HWF l’essor du verre comme matériau industriel au XIXe favorise la diffusion
JpQpUDOHGXYHUUHjERLUHVRXVTXDWUHIRUPHVVLPSOLÀpHVJREHOHWYHUUHj
SLHGÁ€WHFRXSHOHIDPHX[©GXUDOH[ªVLPSOHHWUpVLVWDQWHVWLQYHQWp
HQjSDUWLUGHODIRUPHJREHOHW/HJREHOHWHQSODVWLTXHRXFDUWRQVH
propage dans les années 1980.
%ROÀOVGHO·pFXHOOHUpFLSLHQWUHPRQWDQWDX[SOXVDQFLHQQHVFLYLOLVDtions et qui contint des aliments liquides (soupes, bouillies) pendant des
centaines de millénaires, le bol triomphe avec la production industrielle
de la céramique et… avec l’essor du petit déjeuner.
&XLOOHU F·HVW FHUWDLQHPHQW OH YpWpUDQ GX FRXYHUW DVVRFLp j O·pFXHOOH
Elle matérialise le geste de la main en creux qui puise l’eau ; faite d’abord
d’éléments naturels (coquillages, coques de fruits) puis en os ou en bois,
elle sera en métal à partir de l’époque moderne.
&RXWHDXVLRQSUHQGHQFRPSWHOHVELIDFHVTXLVHUYDLHQWQRWDPPHQW
jGpFRXSHUODYLDQGHLOÀJXUHDXVVLSDUPLOHVSOXVDQFLHQVLO\DWUHQWH
PLOOpQDLUHVODWDLOOHGXVLOH[pWDLWDVVH]SHUIHFWLRQQpHSRXUIRXUQLUGHÀQHV
lames emmanchables dans du bois.
)RXUFKHWWH LQYHQWpH SUREDEOHPHQW DX 0R\HQ2ULHQW SXLV GLIIXVpH
en Europe via l’Italie, au XVe siècle, utilisée d’abord pour manger les pâtes
puis pour piquer les fruits qu’on découpait (les pommes, par exemple), elle
n’eut d’abord que deux dents, avant de progressivement passer à trois puis
quatre à l’ère industrielle. En rupture historique avec les centaines de milOpQDLUHVRO·KRPPHPDQJHDLWDYHFOHVPDLQVHOOHÀWVFDQGDOHjOD5HQDLVVDQFHHWpWDLWHQFRUHPDODFFHSWpHSDU0RQWDLJQHjODÀQGXXVIe siècle3.
3HWLWH FXLOOHU XWLOLVpH GqV O·$QWLTXLWp UHGpFRXYHUWH DX XVIIIe, avec le
FKRFRODW HW OH FDIp HOOH V·HVW JpQpUDOLVpH DSUqV DYHF OH VXFFqV GHV
\DRXUWVHWDXWUHVODLWDJHV
Sous des formes diverses, ces sept couverts répondent aux fonctions de
EDVHGXUHSDVFRQWHQLUSLTXHUFRXSHUSUHQGUHERLUH«3DUUDSSRUWjOD
très longue histoire humaine, ce n’est que tardivement et pour une durée
TXL QH GpSDVVH JXqUH OH VLqFOH TXH FHV VHSW FRXYHUWV VH VRQW
FRQVWLWXpVHQXQH©IDPLOOHªG·REMHWVpYROXDQWHQVHPEOHVXUQRVWDEOHVDX
U\WKPHGHODYLHIDPLOLDOH
¦ *E DsNERAIS SANS NAPPE MAIS g L´ALLEMANDE SANS SERVIETTE BLANCHE TRnS INCOMMODmMENT JE LES SOUILLE PLUS
QU´EUX ET LES )TALIENS NE FONT ET M´AIDE PEU DE CUILLER ET DE FOURCHETTE § -ONTAIGNE %SSAIS ))) $E L´EXPm
RIENCE # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR $ES MONOBLOCS COMPLEXES
5NE TECHNIQUE SOPHISTIQUmE
Même s’ils ne sont faits que d’une seule pièce, leur complexité est grande ; un bricoleur averti qui voudrait réaliser une petite cuiller (avec un
DXWUH PDWpULDX TXH OH ERLV HW HQFRUH FRQFOXUD YLWH j O·LPSRVVLELOLWp G·\
parvenir ; après le choix et l’obtention des matériaux voulus, la fabricaWLRQSDVVHSDUSOXVLHXUVpWDSHVGpFRXSDJHODPLQDJHSRXUSURGXLUHXQ
ÁDQ, forme découpée à plat), détourage, estampage, émerisage et surtout
SROLVVDJHRSpUDWLRQVLLPSRUWDQWHTXHOHUpVXOWDWGRLWrWUHSDUIDLWFKDFXQ
SHXWHVVD\HUXQHFXLOOHUPDOIDLWHRXDEvPpHLOQHV·\UHSUHQGUDSDVjGHX[
IRLVWDQWODVHQVDWLRQOXLVHUDGpVDJUpDEOHSRXUXQHUDLVRQVLPSOHGDQV
le corps humain, les terminaisons nerveuses (grâce auxquelles nous recevons nos impressions sensorielles) sont exceptionnellement concentrées
dans la main et surtout la bouche et les lèvres, zones ultra-sensibles. La
petite cuiller doit être douce au contact des lèvres sous peine de susciter
immédiatement le rejet. C’est dire que si la petite cuiller n’est pas compliquée (une seule pièce), la plus grande technicité est requise pour qu’elle
remplisse sa fonction.
5NE PRODUCTION DIVERSI½mE
Les objets produits pour permettre à l’homme de manger sont historiquement d’une grande diversité, qui doit beaucoup à leur diversité
originelle, celle des situations géographiques, écologiques et culturelles
dans lesquelles ils furent produits2QQHSHXWOHVUDSSRUWHUVHXOHPHQWj
la logique d’une technique abstraite qui appartiendrait aux humains qui
QRXV RQW SUpFpGpV QL j OD VHXOH ORJLTXH SK\VLTXH RX HUJRQRPLTXH TXL
prendrait l’humain d’aujourd’hui comme canon de l’espèce dans le passé
ou pour le futur. L’humanité est une espèce en évolution, en fonction de
ses contextes historiques et topographiques, et les objets usuels qu’elle
produit en portent trace.
5NE RICHE SYMBOLIQUE
$ERUGRQVPDLQWHQDQWFHVFRXYHUWVVRXVXQDXWUHDQJOHFHOXLGHODV\Pbolique dont ils sont porteurs. Traditionnellement (probablement depuis
ODQXLWGHVWHPSVODFXLOOHUHVWV\PEROHIpPLQLQJpQpUDOHPHQWPDWHUQHO
et porteur de vie ; on le voit dans les cuillers préhistoriques ou « primiti
*ACQUES "ARRAU ,ES HOMMES ET LEURS ALIMENTS ESQUISSE D´UNE HISTOIRE mCOLOGIQUE ET ETHNOLOGIQUE DE L´ALIMEN
TATION HUMAINE 0ARIS 3CANDmDITIONS4EMPS !CTUELS P
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES YHVªTXLSUHQQHQWVRXYHQWXQHIRUPHIpPLQLQHYRLUHFHOOHG·XQYHQWUH
HWRX G·XQH IHPPH HQFHLQWH (Q UHYDQFKH OH FRXWHDX HVW JpQpUDOHPHQW
V\PEROH PDVFXOLQ YRLUH GRPLQDWHXU DJUHVVLI OH pater familias le porta
longtemps dans un étui de ceinture, et vers 1900 encore, le père de famille
en était souvent le seul détenteur, découpant le pain pour la famille. La
fourchette, quant à elle, a longtemps eu une réputation sulfureuse, quasi
satanique, pour diverses raisons, la plus fondamentale étant qu’elle inWURGXLVDLWXQDUWLÀFHXQLQWHUPpGLDLUHDUWLÀFLHOHQWUHODPDLQKXPDLQHHW
les objets de la Création. C’est une critique souvent opposée aux objets
LQQRYDQWVHWSDVVHXOHPHQWjFHX[TXLVRQWK\SHUVRSKLVWLTXpVRXTXLDSSDUWLHQQHQWjO·XQLYHUVGHOD©WHFKQRVFLHQFHªFHUWDLQVREMHWVTXLQRXV
VHPEOHQWDXMRXUG·KXLGHVSOXVVLPSOHVRXTXDVL©QDWXUHOVªRQWVXVFLWp
en d’autres temps ou d’autres lieux, critique ou rejet dès lors qu’ils moGLÀDLHQWXQXVDJHRXTX·LOVKHXUWDLHQWXQHUHSUpVHQWDWLRQGRPLQDQWHGX
PRQGH3ODWRQMXJHDLWOHOLYUHFRPPHXQREMHWDUWLÀFLHOHWQpJDWLI, et la
hiérarchie catholique désavoue aujourd’hui le préservatif, utilisé pourtant
depuis la préhistoire. Quant à la fourchette, même si on sait que manger
avec les doigts fut (du fait même de leur grande sensibilité) une source
particulière d’agrément, avec sa forme miniaturisant la fourche, elle s’exSRVDLWELHQjFHW\SHG·DFFXVDWLRQ
6US PAR UNE TECHNOLOGIE HUMANISTE
Ces couverts, on devrait les examiner sous toutes leurs coutures, comme tous les objets techniques ; c’est l’objectif de l’approche technologique,
conçue comme science humaine :
« Ce qui caractérise une science, c’est le point de vue et non l’objet. Par
exemple voici une table. Elle peut être étudiée du point de vue mathéPDWLTXH«SK\VLTXH«FKLPLTXH«ELRORJLTXH«GHVVFLHQFHV
humaines, l’origine et la fonction de la table pour les hommes (…).
Il est clair que pour un objet fabriqué, c’est le point de vue humain de
sa fabrication et de son utilisation par les hommes qui est essentiel, et que
si la technologie doit être une science, c’est en tant que science des activités humaines7ª
0LATON ¦ 0nRE DES CARACTnRES DE L´mCRITURE TU ES EN TRAIN PAR COMPLAISANCE DE LEUR ATTRIBUER UN POUVOIR CON
TRAIRE g CELUI QU´ILS ONT #ONDUISANT CEUX QUI LES CONNAsTRONT g NmGLIGER D´EXERCER LEUR MmMOIRE C´EST L´OUBLI
QU´ILS INTRODUIRONT DANS LEURS hMES » 0HnDRE EE
0HILIPPE !RInS (ISTOIRE DES POPULATIONS FRANlAISES ET DE LEURS ATTITUDES DEVANT LA VIE DEPUIS LE 86)))E SInCLE ¦ ,ES
TECHNIQUES DE LA VIE § P 0ARIS 3EUIL P mDITION ORIGINALE 0ARIS 3ELF !NDRm'EORGES (AUDRICOURT ¦ ,A TECHNOLOGIE SCIENCE HUMAINE § DANS ,A 0ENSmE P !RTICLE RE
PRODUIT !NDRm'EORGES (AUDRICOURT ,A TECHNOLOGIE SCIENCE HUMAINE 2ECHERCHES D´ETHNOLOGIE DES TECHNIQUES
INTRODUIT PAR &RANlOIS 3IGAUT 0ARIS -AISON DES SCIENCES DE L´(OMME P
# DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR /HVFRXYHUWVVRQWSDUPLOHVSOXVDQFLHQVFRPSDJQRQVGHO·KRPPHRQ
DWURXYpj2OGXYDLGHVUHOLHIVGHUHSDVFDUQpVURQJHXUVSHWLWHVDQWLORSHV
datant d’environ cinq cents millénaires ; la cuisson des aliments remonte
au moins à trois cents millénaires8 et des éléments de vaisselle (plats, bols,
cuillers) d’environ quinze millénaires, antérieurs au néolithique et à la séGHQWDULVDWLRQRQWpWpUHWURXYpVQRWDPPHQWDX0R\HQ2ULHQW9. S’agissaitil d’objets de prestige, accompagnant des festins ou destinés à montrer la
SUppPLQHQFHGHOHXUVGpWHQWHXUVD\DQWGRQFXQHIRQFWLRQSOXVV\PEROLque qu’utilitaire ? Mais bientôt ils entreraient aussi dans l’usage courant,
DX0R\HQ2ULHQWFKH]OHVFKDVVHXUVFXHLOOHXUVGXQDWRXÀHQSLORQVSRXU
EUR\HUOHVJUDLQHVpFXHOOHVHWRXWLOVFRXSDQWV­O·qUHQpROLWKLTXHGHSXLV
dix millénaires), lorsque l’agriculture, la sédentarisation, les villes et les
villages se propagent, l’habitat abrite les repas du groupe et des ustensiles
ménagers. Les objets trouvés font preuve d’une étonnante diversité territoriale10.
Beaucoup plus tard, depuis cinq siècles seulement, au moment de la
5HQDLVVDQFH HXURSpHQQH LOV FRQQDLVVHQW XQH UHPDUTXDEOH DFFpOpUDWLRQ OHVW\SHVGHFRXYHUWVSUROLIqUHQWMXVTX·DXXVIIe siècle (où ils parviennent à
ODFRQÀJXUDWLRQDFWXHOOHSXLVLOVVHGLIIXVHQWjO·HQVHPEOHGHODSRSXODtion européenne, entre le XIXe et le XXe siècle, atteignant un apogée qui se
VLWXHUDLW GDQV OHV DQQpHV 3DUFRXURQV WUqV EULqYHPHQW FHWWH ORQJXH
histoire, en sélectionnant sept périodes.
3%04 0b2)/$%3 #(!2.)È2%3
Au cours des deux ou trois millions d’années de la préhistoire, on ne
SHXW TXH FRQMHFWXUHU OHV PpWKRGHV HW PR\HQV XWLOLVpV SRXU PDQJHU FDU
© MXVTXH YHUV DQV DYDQW QRWUH qUH F·HVWjGLUH MXVTX·j O·DSSDULWLRQ
de la première céramique, les documents sur la préparation et la cuisson
des aliments sont presque nuls11ª(QFRPSDUDQWOHVREMHWVWURXYpVDX[
©JURXSHVSULPLWLIVªGX XXe siècle, qui ne connaissaient « pas la cuisson
dans des récipients, les aliments animaux ou végétaux étaient rôtis à la
ÁDPPHRXVRXVODFHQGUHªRQSHXWSHQVHUTX·©jSDUWLUGXPRXVWpULHQ
-ARYLnNE 0ATOU-ATHIS .mANDERTAL UNE AUTRE HUMANITm 0ARIS 0ERRIN /N VERRA AUSSI LE ½LM DE *ACQUES
-ALATERRE !O LE DERNIER .EANDERTAL SORTIE ½N SEPTEMBRE "RIAN (AYDEN ,´HOMME ET L´INmGALITm ,´INVENTION DE LA HImRARCHIE DURANT LA 0RmHISTOIRE, 0ARIS #.23 bDITIONS
!VANT MoME LE NmOLITHIQUE ¦ *E CONSIDnRE L´mMERGENCE DES ¨ SOCImTmS COMPLEXES DES CHASSEURS
CUEILLEURS ¨ COMME LA MUTATION LA PLUS IMPORTANTE ENTRE LA PREMInRE APPARITION DES CHASSEURSCUEILLEURS
HUMAINS IL Y A DEUX MILLIONS D´ANNmES ET L´AVnNEMENT DE LA TECHNOLOGIE INDUSTRIELLE ET NUCLmAIRE § P !NDRm ,EROI'OURHAN -ILIEU ET TECHNIQUES 0ARIS !LBIN -ICHEL RE mDITION .OTAMMENT P ¦ !BSORPTION DES ALIMENTS §
!NDRm ,EROI'OURHAN ¦ ,A PRmHISTOIRE § DANS -AURICE $AUMAS DIR (ISTOIRE GmNmRALE DES TECHNIQUES ,ES
ORIGINES DE LA CIVILISATION TECHNIQUE TOME P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES tout au moins, les mêmes pratiques peuvent être prêtées aux hommes préKLVWRULTXHV ª 4XRL TX·LO HQ VRLW © OH SHWLW PRELOLHU DOLPHQWDLUH HVW WUqV
UpGXLWªDXPDJGDOpQLHQ/DVFDX[RQWURXYHGHVSRLQoRQVGHVVSDWXOHV
plates, en os, des cuillers proches des spatules « à concavité très peu marTXpH ª GRQW ULHQ QH SURXYH XQ XVDJH FRXUDQW (Q UHYDQFKH GHSXLV GL[
PLOOpQDLUHVHQYLURQ©GHYpULWDEOHVFXLOOqUHVDSSDUDLVVHQWHQOLDLVRQDYHF
ODGLIIXVLRQGHODFpUDPLTXHª/DFpUDPLTXHQDvWDX0R\HQ2ULHQWGDQV
une période située entre neuf et sept millénaires par rapport à nous et « de
OD&DOLIRUQLHDX3pURXjXQHpSRTXHSHXWrWUHXQSHXSOXVUpFHQWHª13. Les
conditions sont alors réunies pour la mise en œuvre de récipients durables
et résistants à la chaleur et pour une évolution des modes alimentaires (à
laquelle d’autres aspects concourent). Bientôt survient l’écriture (depuis
cinq millénaires) parfois porteuse d’informations sur ce qui était fait de
ces ustensiles.
-mSOPOTAMIE UNE TRnS ¦ GRANDE CUISINE § 2QFLWHVRXYHQW+RPqUHRXOHVIHVWLQVURPDLQVOHPRQGHELEOLTXHRX
OHVeJ\SWLHQV pour évoquer les repas et les couverts d’autrefois… il serait plus juste de décrire la cuisine mésopotamienne, celle de Sumer et de
%DE\ORQHTXLDWDQWLQQRYpYRLFLFLQTjVL[PLOOpQDLUHVHWLQÁXHQFpWDQWGH
FLYLOLVDWLRQVGX0R\HQ2ULHQW«HWG·DLOOHXUV
(QFHGRPDLQHFRPPHHQWDQWG·DXWUHVFHSD\VTXLGpERUGDLWO·,UDT
IXW JUDQG LQLWLDWHXU © GqV O·DXURUH GHV WHPSV KLVWRULTXHV LO H[LVWDLW HQ
0pVRSRWDPLHXQHWHFKQLTXHHWXQDUWFXOLQDLUHDXVVLFRPSOH[HVHWUDIÀnés que tout ce que nous pouvons savoir par ailleurs de cette civilisation
étonnante, opulente et recherchée ª /HV IRXLOOHV DUFKpRORJLTXHV \ RQW
GpFRXYHUW©SDUPRQFHDX[OHVUHVWHVG·XQHIRUWULFKHEDWWHULHGHFXLVLQHª
/HVGHQUpHVXWLOLVpHVVRQWWUqVQRPEUHXVHVHWGLYHUVHVFpUpDOHVOpJXPHV
IUXLWVEXOEHVHWUDFLQHVVSpFLDOHPHQW©OHWULRELHQFRQQXDLORLJQRQHW
SRLUHDXªWUXIIHVHWFKDPSLJQRQVYLDQGHVHWSRLVVRQVPDQQHVHWPLHO
sel et cendres ; leur conservation et leur transformation étaient très soSKLVWLTXpHVERXLOOLVHWVDXFHVGLYHUVHVOpJXPHVSkWpVFKDUFXWHULHSHXW
être ; pain, bière et vin. Datant de 3 700 ans before present, des tablettes
)BIDEM P )BIDEM P 'RhCE g DES PAPYRUS ET g DES INSCRIPTIONS DANS DES TOMBES ON A UNE IDmE CONCRnTE DES REPAS PHARAONI
QUES ROYAUX g 4ELL AL !MARNA PAR EXEMPLE ¦ ON VOIT LE ROI ;!KHmNATON= DmVORER g BELLES DENTS UNE SORTE DE
BROCHETTE TANDIS QUE CERTAINES PRINCESSES MORDENT DANS DES POULETS ENTIERS § TANDIS QUE LE PETIT PEUPLE
SEMBLE ¦ ESSENTIELLEMENT NOURRI DE DIFFmRENTES VARImTmS DE PAINS OBTENUS g PARTIE D´ORGE OU DE BLm ET D´UNE
BInRE HENEKET TRnS mNERGmTIQUE § 0IERRE 4ALLET ,A CUISINE DES PHARAONS !IXEN0ROVENCE 3INDBAB!CTES 3UD
P P 1UANT AUX 'AULOIS¨ ON PEUT SE REPORTER g *EAN,OUIS "RUNAUX .OS ANCoTRES LES 'AULOIS,
IDmES RElUES SUR LA 'AULE 0ARIS 3EUIL P *EAN "OTTmRO ¦ ,A PLUS VIEILLE CUISINE DU MONDE » DANS ,´(ISTOIRE P # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR d’argile en écriture cunéiforme portent des dizaines de recettes de cuisine,
DYHF©XVDJHPRGXOpGHSOXVLHXUVW\SHVGHFXLVVRQHWG·XVWHQVLOHVGLYHUV
adaptés chacun à son propre rôle (…) le tout dans le but manifeste de reFKHUFKHUGHVVDYHXUVFRPSOH[HVHWXQJR€WSDUWLFXOLHUª. Selon J. Bottero,
ces tablettes s’adressaient à des professionnels avec un rôle « essentiellePHQWDGPLQLVWUDWLIHWQRUPDWLIªHOOHVÀ[DLHQWGHVQRUPHVSRXUODFXLVLQH
« qui se pratiquait au Palais (ou au Temple) (…) au service des grands de
FHPRQGH²RXGHO·DXWUHª&HWWHFXLVLQHVHGLVWLQJXDLWDVVXUpPHQWGHOD
FXLVLQHSRSXODLUH©DIIDLUHGHIHPPHVªPDLVO·DXWHXUHVWLPHTXHFHOOHV
ci devaient savoir « confectionner des plats, toutes proportions gardées,
DXVVLJR€WHX[HWLPDJLQDWLIVªQRWDPPHQWSRXUFXLUHYLDQGHVRXOpJXPHV
au bouillon gras dans des vases ; il ajoute que si cette civilisation a disparu
des mémoires durant deux millénaires (et avec elle ses tours de main),
HOOHVXEVLVWHHQFRUHGDQVODFXLVLQHDXMRXUG·KXLUpSDQGXH©GHOD*UqFHDX
IRQGGHO·,UDTª
Comme toujours, on connaît moins bien les couverts usuels, sans doute
XWLOLVpVHWXVpV©MXVTX·jODFRUGHªUHF\FOpVSRXUG·DXWUHVXVDJHVRXWRXW
simplement érodés par le temps, et notamment ceux qui furent – conjoinWHPHQWjO·XVDJHGHODPDLQ²OHV©DQFrWUHVªGHVXVWHQVLOHVFXLOOHUHWFRXteau) et de l’écuelle pour les liquides ou les bouillies.
!U -OYEN ÄGE ENCORE AVEC LES MAINS
,O \ D PLOOH DQV VRLW WURLV RX TXDWUH PLOOpQDLUHV DSUqV O·DSRJpH PpVRSRWDPLHQQHRHQpWDLHQWOHV©FRXYHUWVªHQ(XURSH"2XWUHOHVYHVWLJHV
archéologiques, on dispose d’exceptionnelles images, notamment dans
OD 7DSLVVHULH GH %D\HX[ FRQIHFWLRQQpH XQH TXLQ]DLQH G·DQQpHV DSUqV OD
FRQTXrWHQRUPDQGHGHO·$QJOHWHUUHGH&HWWHVRUWHGHEDQGHGHVVLQpH
GHPGHORQJVXUFPGHODUJHFRQWLHQWGHX[VFqQHVGHIHVWLQDYHF
OHXUV SUpSDUDWLIV FHOXL G·+DUROG HQ$QJOHWHUUH HW FHOXL GH *XLOODXPH OH
&RQTXpUDQWLPDJHVQƒHW6XUODSUHPLqUHOHVKRPPHVPDQJHQWGDQV
des écuelles et boivent dans des verres en forme de cornes ; juste avant
la seconde, on voit des cuisiniers chauffer un chaudron et griller des volailles en brochettes puis apporter celles-ci à table ; en haut de la scène du
UHSDVXQHLQVFULSWLRQODWLQHLQGLTXH©HWLFLO·pYrTXHEpQLWODERLVVRQHW
OHVDOLPHQWVªVL[FRQYLYHVVRQWDVVLVVXUXQVHXOF{WpFRPPHWRXMRXUV
à cette époque) derrière une table en arc de cercle (probablement des tré
3OPHIE !RCHAMBAULT DE "EAUNE ,´HOMME ET L´OUTIL ,´INVENTION TECHNIQUE DURANT LA PRmHISTOIRE 0ARIS #.23
mDITIONS P ¦ LES MATmRIAUX EN MATInRE ORGANIQUE LES PLUS FRAGILES SE DmGRADENT TRnS RAPIDEMENT
¨ #ECI EXPLIQUE QUE NOUS NE DISPOSIONS POUR LES PmRIODES ANCIENNES QUE DE MATmRIAUX DURABLES COMME LA
PIERRE ET ¨ OS DENT IVOIRE OU BOIS DES CERVIDmS #ELA TEND g RENFORCER L´IMPRESSION D´HOMOGmNmITm DU BAGAGE
TECHNIQUE DES POPULATIONS LES PLUS ANCIENNES § P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES teaux) ; au devant, un serviteur agenouillé et tenant une serviette, présente
un plat. Sur la table, couverts et aliments sont posés sans ordre particulier
(contrairement à ce qu’on fera à l’époque moderne17 2Q GLVWLQJXH SOXVLHXUV IRUPHV VDQV GRXWH GHV SDLQV HW GHV WUDQFKRLUV GHV pFXHOOHV GHV
plats et des coupes contenant des aliments présentés simultanément (et
QRQHQSOXVLHXUV©VHUYLFHVªFRPPHDXMRXUG·KXLDLQVLTX·XQYDVHSRXU
OHYLQ"OHVVHXOVXVWHQVLOHVSUpVHQWpVVRQWGHX[FRXWHDX[O·XQjODPH
pointue, pouvant servir à piquer les aliments, l’autre à lame recourbée,
pour les trancher. Un personnage défait un poisson avec ses doigts et en
porte des morceaux à la bouche. À l’époque, quel que soit le milieu social
on mange avec les doigts ; pas d’assiette, ni de couverts, sauf les couteaux
TXLSHXYHQWrWUHjXVDJHFROOHFWLI2QHVWDORUVjO·DSRJpHG·XQHFLYLOLVDWLRQ
UXUDOHMXVWHDYDQWOD©UpYROXWLRQIpRGDOHªLQGXVWULHOOHHWXUEDLQHTXLYD
métamorphoser la société médiévale européenne des XIIe et XIIIe siècles.
2ENAISSANCE PREMIERS COUVERTS INDIVIDUELS
PREMInRES NORMALISATIONS
Un autre document nous guidera à la table (princière) de la RenaisVDQFHLOV·DJLWG·XQHJUDYXUHDOOHPDQGHGH18, donc située juste avant
la découverte européenne de l’Amérique, ou avant le soulèvement du
Bundschuh GDQVOHVSD\VJHUPDQLTXHV19.
2Q GpFRXYUH XQH WDEOH UHFtangulaire sur des pieds (et non
plus un tréteau), recouverte
d’une nappe sur laquelle pluVLHXUV pOpPHQWV VRQW GLVSRVpV un tranchoir rectangulaire, avec
deux morceaux (de viande ?),
que le roi s’apprête à saisir de la
main ou à la pointe de son couteau ; à sa gauche un morceau
de pain, au centre une coupe (en
argent ?) contient des morceaux
d’aliments découpés ; à droite
XQJREHOHWF\OLQGULTXHUHFRXYHUW
'RAVURE REDESSINmE PAR 3YLVAIN 'UICHARD
*EAN #UISENIER ,ES &RANlAIS ET LA TABLE CATALOGUE DU MUSmE NATIONAL DES !RTS ET 4RADITIONS POPULAIRES P
$´APRnS UNE GRAVURE INTITULmE ¦ ,E 2OI 3ALOMON ET SES FEMMES § .UREMBERG .EW 9ORK -ETROPOLITAN
-USEUM OF !RT
'EORGES "ISCHOFF ,A GUERRE DES PAYSANS ,´!LSACE ET LA RmVOLUTION DU "UNDSCHUH 1493-1525 3TRASBOURG ,A .UmE
"LEUE # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR d’un couvercle en forme de couronne (un gobelet identique a été retrouvé
HQ$OOHPDJQHWRXWHQDUJHQWLOPHVXUHFPGHKDXWjO·DYDQWVDQV
GRXWH GHX[ VRUWHV GH SDLQV 'RQF XQ VHXO FRXYHUW XQ FRXWHDX 'HX[
DXWUHVSHUVRQQDJHVXQpFX\HUWUDQFKDQWJHQWLOKRPPHTXLGpFRXSHOHV
aliments (à l’aide d’un grand couteau pointu et d’une spatule) et les goûte ; un serviteur apporte trois écuelles couvertes, serrées par une granGH VHUYLHWWH &HWWH JUDYXUH QRXV UHQYRLH G·DERUG j O·pW\PRORJLH GX PRW
©FRXYHUWªTXLVHUDSSRUWHSUREDEOHPHQWDX[SUpFDXWLRQVTX·RQSUHQDLW
alors dans les cours pour se prémunir de l’empoisonnement, d’où le genWLOKRPPHTXLJR€WHVRXVOHV\HX[GXURLRXHQFRUHDX[PpWKRGHVXVLWpHV
pour garder les plats chauds en les couvrant.
2Q HVW GDQV XQ PRQGH TXL FKDQJH R OHV pFKDQJHV VRQW GDYDQWDJH
LQWHUQDWLRQDX[ GHSXLV GHX[ VLqFOHV 0DUFR 3ROR D UDSSRUWp j 9HQLVH GH
ODSRUFHODLQHGH&KLQHGXF{WpEDOWLTXHOD+DQVHHVWjVRQDSRJpHHQ
Espagne, la ReconquistaYDELHQW{WV·DFKHYHUHQDYHFODSULVHGH*UHQDGHFRXSDQWO·(XURSHGHO·LQÁXHQFHPXVXOPDQHRXPR\HQRULHQWDOHVL
féconde jusque-là ; en revanche, on est aussi à la veille de la découverte de
O·$PpULTXH4X·LOVSURYLHQQHQWG·$PpULTXHRXGX0R\HQ2ULHQWFHVÁX[
commerciaux apporteront bientôt, sur la table d’Europe septentrionale, de
QRXYHDX[PHWVKDULFRWEODQFPDwVVDUUDVLQSRPPHGHWHUUHFKRXÁHXU
laitue, artichaut, pomme, melon, fraise, etc.) qui appelleront de nouveaux
ustensiles, comme la fourchette. Cette scène représente une situation muWDQWHLO\DXQHWDEOHÀ[HPDLVSDVHQFRUHGHIRXUFKHWWHQLG·DVVLHWWH/HV
aliments ne sont guère variés, les couverts sont rares mais luxueux. Les
GHX[ SHUVRQQDJHV TXL DVVXUHQW OH VHUYLFH VRQW ÀqUHPHQW GUHVVpV HW QRQ
plus agenouillés comme lors des siècles précédents. Cette période est celle
R DSSDUDLVVHQW OHV FRXYHUWV LQGLYLGXHOV VXU OD WDEOH GHV © JUDQGV ª HQ
WRXWFDVHWRFRPPHQFHQWjVHÀ[HUOHVXVDJHVGHWDEOHHQ(UDVPH
publie un Traité de civilité puérile, ouvrage de savoir-vivre promis à un sucFqVSOXULVpFXODLUHGRQWOHTXDWULqPHFKDSLWUH©'HVUHSDVªSUHVFULWSDU
exemple qu’« il est grossier de plonger ses doigts dans les sauces ; que
l’enfant prenne du plat le morceau qu’il veut, soit avec son couteau, soit
DYHFVDIRXUFKHWWHª2QHVWDXF±XUG·XQHSpULRGHGHWUDQVLWLRQ
3InCLE DE ,OUIS 8)6 SOPHISTICATION ET ¦ GOUVERNEMENT DE LA TABLE §
­WDEOHOH*UDQG6LqFOHHVWPRLQVPDUTXpSDUO·LQQRYDWLRQWHFKQLTXH
(la diffusion des couverts se poursuit), que par une recherche très poussée
de nouveautés (dans les domaines des recettes, des goûts ou de la spéciali-
-AURICE $AUMAS DIR (ISTOIRE GmNmRALE DES TECHNIQUES 0ARIS 05& TOME )) P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES sation des couverts), parallèlement à un contrôle politique des manières.
De même que l’État régente le langage (la création de l’Académie franoDLVHHQFRQGXLW&RUQHLOOHjUppFULUHle Cid pour se conformer aux
QRXYHDX[FDQRQVTX·LOWUDFHOHSODQ©LGpDOªGHVMDUGLQV©jODIUDQoDLVHª
HQFRQVWUXLVDQW9HUVDLOOHVGHPrPHLOJpRPpWULVHOHV©SODQVGHWDEOHª
FRGLÀHOHPDLQWLHQGHVGvQHXUVHWYDMXVTX·jQRUPDOLVHUODIRUPHGHVFRXWHDX[8QpGLWUR\DOGHLQWHUGLWOHVFRXWHDX[SRLQWXVHWH[LJHTXH
WRXWFRXWHDXGHWDEOHVRLWGpVRUPDLVDUURQGLDYHFO·HVVRUGHODIRXUFKHWWH
le couteau n’est plus utile pour piquer la viande et c’est surtout l’occasion
GHSDFLÀHU²PDWpULHOOHPHQWHWV\PEROLTXHPHQW²GHVUHSDVTXLSHQGDQW
des siècles avaient occasionné mainte rixe sanglante©'pIHQGRQVDXVVL
très expressément à tous hôtes, cabaretiers et à toutes personnes de quelques qualité et condition qu’elles soient, de se servir sur leurs tables, dans
leurs logis ou ailleurs, en quelque manière que ce puisse être, de couteaux
SRLQWXVOHXUHQMRLJQRQVDX[PrPHVSHLQHVTXHGHVVXVHQFDVTX·LOVHQ
eussent en leur pouvoir, de les faire émousser trois jours après la publicaWLRQGHQRWUHSUpVHQWHRUGRQQDQFH«ª
&H©JRXYHUQHPHQWªGHODWDEOHGHVRQpTXLSHPHQWGHODIDoRQGHOD
GLVSRVHUGHODPDQLqUHGHV·\WHQLUHWQRWDPPHQWGHVHVHUYLUGHVFRXYHUWV
YDVHGLIIXVHUGDQVOHSD\VHWGXUDQWOHVGHX[VLqFOHVVXLYDQWVGDQVOHVPLOLHX[HWOHVSD\VTXLSUHQQHQWOD)UDQFHSRXUPRGqOH3OXVTXHMDPDLV©OD
SROLWLTXHªDXGRXEOHVHQVGHSROLWHVVHHWG·RULHQWDWLRQSDUO·eWDWSpQqWUH
dans l’univers des couverts (comme elle le faisait au moins dès l’époque
mésopotamienne).
2mVOLUTION FRANlAISE ET 8)8E SInCLE DES COUVERTS POUR TOUS UNE AUTRE RmVOLUTION
Précédée et préparée par les révolutions anglaises (au XVIIe siècle) et améULFDLQHOD5pYROXWLRQIUDQoDLVHLPSXOVHUDjVRQWRXUXQYDVWHPRXvement européen (puis latino-américain) de révolutions libérales entre 1789
HW$YHFHOOHVV·DIÀUPHQWOHFLWR\HQHWODOLEHUWpG·HQWUHSULVHTXLRXYUH
la voie à la révolution industrielle (et à ses inégalités sociales). Indissociablement (surtout en France) progressent l’individualisation de la personne
(poursuivant un mouvement perceptible dès la Renaissance) et le sens de
#´EST L´mPOQUE O| ¯ EN DIVERS DOMAINES ¯ TOUTE UNE LITTmRATURE SCHmMATISE ET ¦ RATIONALISE § LES PRATIQUES
(0ASCAL $UBOURG 'LATIGNY ET (mLnNE 6mRIN DIR 2mDUIRE EN ART ,A TECHNOLOGIE DE LA 2ENAISSANCE AUX ,UMInRES,
0ARIS bDITIONS DE LA -3( P CE MOUVEMENT ACCOMPAGNE LA GESTATION DE L´¦ hGE CLASSIQUE § CHER g
-ICHEL &OUCAULT
bDIT DONNm g 3AINT'ERMAIN EN ,AYE EN JUIN ENREGISTRm g 4OURNAI LE JUILLET APRnS AVOIR CONSTATm
QUE DANS LES NOUVELLES PROVINCES DE &LANDRE LA PAIX mTAIT FRmQUEMMENT TROUBLmE PAR DES BAGARRES AU COU
TEAU ET QU´UNE PREMInRE ORDONNANCE DU JANVIER N´AVAIT GUnRE EU D´EFFETS LE ROI DmCIDE DE DURCIR LES
PEINES D´INTERDIRE LA FABRICATION DES COUTEAUX POINTUS AINSI QUE LEUR USAGE g TABLE
# DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR l’égalité des droits. Les couverts témoignent à leur façon de ces deux tenGDQFHV(QXQVLqFOHOHFRXYHUWLQGLYLGXHOVHJpQpUDOLVHGDQVOHVSD\VLQGXVtriels européens (signes d’un partage relativement égal du repas), en même
WHPSVTX·LOVHGLIIpUHQFLHGHSOXVHQSOXV'DQVOHVPLOLHX[DLVpVV·DIÀUPH
une extraordinaire spécialisation des ustensiles selon les plats.
Plusieurs facteurs technico-économiques concourent à cette transforPDWLRQKLVWRULTXHGXUHSDVHQ(XURSHRFFLGHQWDOHODPXWDWLRQDJULFROH
(généralisation de la pomme de terre, puis de l’élevage, bovin notamment,
qui fournit d’autres viandes que la poule au pot dominicale), la révolution
industrielle qui produit massivement des matériaux (métaux, céramique
HW SRUFHODLQH YHUUH V·\ DMRXWHQW O·XUEDQLVDWLRQ OHQWH HQ )UDQFH HW OHV
transformations de l’habitat. Suite à l’évolution du travail et à une relative
abondance, les repas se déplacent dans la journée, pour aboutir à notre
U\WKPHXVXHOSHWLWGpMHXQHUGpMHXQHUGvQHURXVRXSHU. La propagation
de la table offre un support aux couverts et à un nouveau mode de repas.
6LJQDORQVHQÀQ²ELHQDYDQWO·kJHGHO·pOHFWULFLWpGRQWOHVLQFLGHQFHVVXUOD
vie courante sont plus proches et mieux connues – les effets exceptionnels
du remplacement de l’âtre par le fourneauGDQVOHVFDPSDJQHVO·kWUH
autour duquel gravitait la vie familiale, à la fois source de lumière, de
chaleur, lieu de cuisson et fréquemment de repas autour de la marmite,
est progressivement rejeté à la périphérie par l’installation du fourneau
PpWDOOLTXHELHQW{WVXLYLGHODWDEOHSXLVGHODOXPLqUHpOHFWULTXHGpVRUmais la famille s’assoit autour de la table, avec assiettes et autres couverts.
Il s’agit d’un changement décisif dans la vie quotidienne, à la fois individuelle et familiale.
Avec l’essor de la métallurgie, capable désormais de produire des outils
à meilleur marché, et celui du commerce (quincailleries, sociétés de vente
SDUFRUUHVSRQGDQFHWHOOHODVRFLpWp0DQXIUDQFHIRQGpHHQ), se généralise un mode de vie où la famille des sept couverts est associée aux
trois repas familiaux. Vers 1900, la table et le fourneau sont partout et les
IDPLOOHVSRSXODLUHVEpQpÀFLHQWGpVRUPDLVGHFRXYHUWVDVVRUWLVHWQRQSOXV
GpSDUHLOOpV FRPPH DYDQW SXLV YHUV GH VHUYLFHV FRPSOHWV RIIHUWV
0HILIPPE 'ILLET 3OYONS &RANlAIS g TABLE , 0ARIS 0AYOT P
-ARIE&RANCE 3IX ¦ ,´HISTOIRE DU PETIT DmJEUNER DE L´!NTIQUITm g NOS JOURS § DANS #AHIERS DE NUTRITION ET DE
DImTmTIQUE P !PRnS DES MILLmNAIRES O| LE PREMIER REPAS SE DISTINGUAIT PEU DES AUTRES AVEC L´UR
BANISATION ET L´ESSOR DES mCHANGES LE ¦ PETIT DmJEUNER § g BASE DE PRODUITS LACTmS DE CAFm CHOCOLAT ET CHICORmE
GAGNE LES CITADINS ENTRE LE 8)8E ET 88E SInCLE
-AURICE 2HEIMS ¦ (ISTOIRE DU MOBILIER § DANS *EAN 0OIRIER DIR (ISTOIRE DES M®URS 0ARIS 'ALLIMARD SIX VOLU
MES 4 ) VOL P 3UR LA TABLE P 3UZANNE 4ARDIEU ,A VIE DOMESTIQUE DANS LE -hCONNAIS RURAL PRmINDUSTRIEL THnSE )NSTITUT D´ETHNOLOGIE DE 0ARIS
/N LE VOIT ENCORE CHEZ *EAN&RANlOIS -ILLET
4HnSE EN COURS D´!URmLIE "RAYET #UISINES ET ARTS MmNAGERS (ISTOIRE MmMOIRE ET PATRIMOINE DES OBJETS QUOTI
DIENS UNIVERSITm *EAN-ONNET 3AINTbTIENNE
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES QRWDPPHQWHQFDGHDX[GHPDULDJHOHV©PpQDJqUHVª$SUqVGHVGL]DLQHV
GHPLOOpQDLUHVG·pYROXWLRQODIDPLOOHGHVFRXYHUWVHVWHQÀQFRQVWLWXpH
,ES 4RENTE 'LORIEUSES ENTRE FORMICA ET FRIGIDAIRE LA MmNAGnRE
$SUqVOD)UDQFHFRQQDvWXQHSXLVVDQWHFURLVVDQFHLQGXVWULHOOHSUpcédée (dans un contexte qu’on retrouve internationalement) d’un temps
fort de démocratisation sociale et politique, qui intervient à sa façon dans
OHVFRXYHUWVHQ)UDQFHOHVIHPPHVDFFqGHQWHQÀQDXGURLWGHYRWHHW
V·DIÀUPHURQWHQFRUHGDYDQWDJHDYHFO·HVVRUGXWUDYDLOVDODULpjO·XVLQHRX
au bureau ; c’est aussi l’heure de la Sécurité sociale et de revenus garantis
(retraite, puis SMIC, etc.). Autant d’éléments qui contribuent à l’évolution
GH OD YLH IDPLOLDOH HW TXH VDLVLVVHQW GHV LQGXVWULHOV LQJpQLHX[ HQ OD VRFLpWp 'XUDOH[ 6DLQW*REDLQ VRUW OH YHUUH © JLJRJQH ª SURPLV j XQ
JUDQGDYHQLUGHVRQF{WpHQ*X\'HJUHQQHFUpHXQHHQWUHSULVHGH
FRXYHUWVGRQWO·REMHFWLIHVWGH©GpPRFUDWLVHUOHOX[HªHWTXLEpQpÀFLHGH
ODJpQpUDOLVDWLRQGHVDFLHUVLQR[\GDEOHV/HVFRQGLWLRQVVRQWUpXQLHVSRXU
une popularisation d’équipements ménagers que saisiront les jeunes ménages s’installant en ville.
À la grande industrie s’adjoignent les grands ensembles urbains, noWDPPHQWGDQVOHV=83ORLGHGDQVFHV)RX)GHQRPEUHXVHV
familles découvrent le chauffage central, la salle de bains, les meubles en
IRUPLFDHWOHIULJLGDLUH'DQVOHVUD\RQVHWOHVWLURLUVRQWURXYHGpVRUPDLV
des couverts meilleur marché, mais moins de modèles que ceux des « méQDJqUHVªGHODJpQpUDWLRQSUpFpGHQWHSRXUDVVXUHUXQHSURGXFWLRQGH
masse, les industriels réduisent le nombre des pièces.
$EPUIS TRENTE ANS g NOUVEAU AVEC LES MAINS ,´nRE DU JETABLE LES COUVERTS S´EFFACENT Sous l’empire de l’agroalimentaire, règnent le mou et l’insipide30. Ustensiles ou récipients, les couverts continuent à se banaliser.
(DXYLQELqUHIUXLWVOpJXPHVYLDQGHVO·HVVHQWLHOHVWGpVRUPDLVIRXUQLSDUO·LQGXVWULHDJURDOLPHQWDLUHHWOHUDSSRUWjOD©WHUUHQRXUULFLqUHªGHvient plus distant. L’industrie, dont les groupes jouent désormais un rôle
prépondérant dans la société, propose d’autres aliments, d’autres outils,
&RANlOIS 4OMAS -ARIO "ONILLA ET *EAN.OpL "LANC ,ES GRANDS ENSEMBLES¨ UNE HISTOIRE QUI CONTINUE 3AINT
bTIENNE 0UBLICATIONS DE L´UNIVERSITm DE 3AINTbTIENNE P
$EUX PROTOTYPES DE LA NOUVELLE ALIMENTATION LE HAMBURGER *OSEPH /ZERSKY 4HE HAMBURGER ! HISTORY 9ALE
9ALE 5NIVERSITY 0RESS OU LA GOLDEN 9VES#LAUDE ,EQUIN ¦ ,A TECHNOLOGIE EST UNE SCIENCE HUMAINE §
DANS 3CIENCES (UMAINES JUIN P # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR d’autres façons de vivre et de penser. Avec la quasi-généralisation de
l’automobile (trois quarts des ménages français depuis les années 1970),
GHV JUDQGHV VXUIDFHV OH SUHPLHU K\SHUPDUFKp IUDQoDLV GDWH GH HW
de la publicité télévisée, l’industrie tout puissante suscite l’ère du jetable (bouteilles, assiettes, gobelets, ustensiles en plastique ou en PET). Elle
parvient à imposer le couvert jetable à une part non négligeable des FranoDLV SRXUWDQW UpSXWpV SRXU OHXU HVSULW GH FRQVHUYDWLRQ (OOH \ SDUYLHQW
HQSURPRXYDQWXQFRQVXPpULVPHGHODIDFLOLWp«DXSUL[IRUWJDVSLOODJH
de matériaux, d’énergie, prolifération de déchets durables, et – le dernier
mais non le moindre – aliénation par des objets qui ne font plus rêver, car
²OLWWpUDOHPHQW²LOVQHVLJQLÀHQWSOXVULHQ
&HVQRXYHDX[FRXYHUWVHQSODVWLTXHWHQGHQWjXQHH[WUrPHVLPSOLÀFDWLRQGHVIRUPHVGXYHUUHQ·HVWUHWHQXHTXHODIRUPH©JREHOHWªTXLVHUYLUD
aussi bien aux boissons fraîches qu’au café ; la petit cuiller se dissout dans
sa plus simple expression, la touillette, le couteau ne sert plus qu’à couper
des aliments mous et la fourchette perd une, voire deux dents… Ce n’est
TXHUpFHPPHQWHWPDUJLQDOHPHQWTX·RQUHF\FOHFHVFRXYHUWVVLSHXpFRlogiques, et encore plus rarement qu’on envisage de les remplacer par des
couverts biodégradables ou même… consommables, après usage.
,E REPAS NOMADE Même là où ils persistent, les couverts sont en matériaux communs
HWVHGpSDUHLOOHQWGDQVOHVWLURLUVHWOHVUD\RQVVHF{WRLHQWGHVREMHWVGH
GLYHUVHVSURYHQDQFHVRQQ·RIIUHSOXVJXqUHGH©PpQDJqUHVªDX[MHXQHV
PpQDJHVHWODFXLVLQHGHV©IDPLOOHVUHFRPSRVpHVªUHJURXSHGHVFRXYHUWV
dépareillés. Poisson pané, surgelés et plats tout prêts en barquettes passent directement du micro-ondes sur la table sans autre forme de procès.
Dans les cantines scolaires ou d’entreprises, les couverts sont impersonQHOV2QOHVYRLWPrPHFRPSOqWHPHQWGLVSDUDvWUHGDQVODUHVWDXUDWLRQUDSLGHKDPEXUJHUG|QHUVDQGZLFKHWFTX·RQHPSRUWHHWPDQJH©VXUOH
SRXFHªHQPDUFKDQWVDQVRXEOLHUSRWVHWWXEHV©EXYDEOHVªRX©VXoDEOHVª«/HUHSDVHVWPRLQVXQHFpUpPRQLHIDPLOLDOHUHVSHFWDQWXQULWXHO
PLQLPDOODWDEOHHVWHQGpFOLQHQ« 32 % des Français prennent leur repas de midi sans se mettre à table, 37 % mangent ou boivent dans la rue au moins
une fois par jour (…). Un peu plus d’un sur quatre mange au moins une fois
dans les transports en commun au cours d’une semaine31. » Même à la maison,
HOOHSHUGVRQU{OHFHQWUDODXSURÀWGXJULJQRWDJHRXGHVSODWHDX[TXLVH
déplacent devant le téléviseur ou l’écran d’ordinateur. Dehors ou dedans,
'mRARD -ERMET &RANCOSCOPIE 2003 0ARIS ,AROUSSE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES le repas devient nomade et les couverts s’adaptent à cette nouvelle situation… ou favorisent le nomadisme.
-UTATIONS PRmCARITm ET PAUVRETm
/HFRQWH[WHJpQpUDOFKDQJHOXLDXVVL/HV7UHQWH*ORULHXVHVRQWHQIDLW
duré moins de vingt ans, pour céder la place à des décennies incertaiQHVHWSOXVLQpJDOLWDLUHV'qVOHVDQQpHVOHVVLJQHVGHUDOHQWLVVHPHQW
VHPXOWLSOLHQWHWOHVFRQWUDVWHVVRFLDX[VHFUHXVHQWO·$13(HVWFUppHHQ
HQXQSXLVVDQWPRXYHPHQWVRFLDOVXUWRXWSRSXODLUHDIIURQte l’autoritarisme de l’État et des entreprises ; c’est aussi un mouvement
GHGpVRFLDOLVDWLRQRO·LQGLYLGXDOLVPHV·DIÀUPHHWRODFHOOXOHIDPLOLDOH
V·DIIDLEOLW$SUqVOHSLFGHODFRXUEHGHVPDULDJHVÁpFKLWHWO·XQLRQ
OLEUHGpSDVVHGHVFRXSOHVHQOHVIDPLOOHVPRQRSDUHQWDOHVVRQW
SDVVpHVGHjSHQGDQWODPrPHSpULRGH(QWUHWUDYDLOHWpYROXtion des mœurs, le temps consacré à la cuisine et aux tâches ménagères
diminue insensiblement, évoluant désormais à un niveau comparable au
temps passé devant la télévision.
1·RXEOLRQVSDVODUHPRQWpHGHODSDXYUHWpTXLWRXFKHPDLQWHQDQWOH
GL[LqPHGHV)UDQoDLVGRQWPLOOLRQVRQWGHVWUDYDLOOHXUVRFFXSDQWXQ
emploi33). La crise sociale et économique actuelle aura probablement des
effets aggravants, mais ne sous-estimons pas la possibilité de réactions
populaires assez fortes et assez politiques pour réorienter le cours des
pratiques alimentaires. Peut-être sommes-nous à une nouvelle croisée des
chemins avant un refaçonnement des repas et couverts ? Car ceux-ci ne se
UpGXLVHQWQLjO·pYROXWLRQGHVP±XUVQLDX[PXWDWLRQVWHFKQLTXHVFRPPH
à toutes les époques ils sont indissociables des changements économiques,
sociaux, culturels et politiques.
3OIT H JOURPERSONNE EN IBIDEM P %T DE H JOUR EN MAI INDIVIDUS DE QUATRE ANS ET
PLUS 3OURCE -mDIAMmTRIE
3TABILISm g DE LA POPULATION DEPUIS MALGRm LA CROISSANCE DU 0)" LE TAUX DE PAUVRETm AUGMENTE g
NOUVEAU DEPUIS LES ANNmES %N LA &RANCE COMPTE ENVIRON PERSONNES SANS DOMICILE ½XE
POUR QUI LA NOTION DE TABLE ET DE COUVERTS N´A PLUS QUE RAREMENT UN SENS ,E PHmNOMnNE N´EST PAS MARGINAL
CAR MILLIONS DE PERSONNES VIVENT EN DESSOUS DU SEUIL DE PAUVRETm EUROSMOIS POUR UNE PERSONNE
SEULE cf -ADIOR &ALL ET $ANIEL 6ERGER ).3%% ¦ 0AUVRETm RELATIVE ET CONDITIONS DE VIE EN &RANCE § DANS bCO
NOMIE ET STATISTIQUE 0ARIS ).3%% 6OIR AUSSI LE E RAPPORT DE L´/BSERVATOIRE NATIONAL DE LA PAUVRETm ET
DE L´EXCLUSION SOCIALE AVRIL ª L´mCHELLE PLANmTAIRE CE SONT MILLIONS DE PERSONNES QUI SOUFFRENT DE
DmNUTRITION¨ET ENFANTS QUI MEURENT DE FAIM CHAQUE JOUR !&)3 !SSOCIATION POUR L´INFORMATION SCIEN
TI½QUE !LIMENTATION ET SANTm MYTHES PEURS ET RmALITmS $OSSIER EN LIGNE HTTPWWWPSEUDOSCIENCESORG
SPIPPHPARTICLE CONSULTm LE DmCEMBRE 4OUTEFOIS DES RmSISTANCES SE FONT JOUR QUI ¯ ELLES AUS
SI ¯ POURRAIENT MODI½ER L´EXISTENCE DES POPULATIONS CONCERNmES¨ ET LEURS REPAS ,AURENT $ELCOURT ¦ bTAT DES
RmSISTANCES DANS LE 3UD FACE g LA CRISE ALIMENTAIRE § DANS !LTERNATIVES 3UD 0ARIS ,OUVAIN bDITIONS 3YLLEPSE
#ENTRE TRICONTINENTAL 6OL 86 # DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR 15%,,%3 0%230%#4)6%3 $% 2%#/.#%04)/. 4XLYHXWSDUWLFLSHUjO·pYROXWLRQGHVFRXYHUWVGRLWUpÁpFKLUDX[FRQWH[WHVLQÀQLPHQWFRPSOH[HVGDQVOHVTXHOVLOVVHPHXYHQWFDULOVQHVRQWQL
universels, ni isolés.
.OS COUVERTS NE SONT PAS UNIVERSELS
Ce qu’on considère comme norme en matière de couverts est daté et
ORFDOLVpHQSODFHGHSXLVVHXOHPHQWGHX[VLqFOHVHWHQFRXUVG·pYROXWLRQ
QRVFRXYHUWVVRQW©RFFLGHQWDX[ªG·DERUGHXURSpHQVLOVVHVRQWSURSDgés là où la culture européenne s’est imposée dans la vie quotidienne.
Cependant d’autres façons de manger prévalent sur de quasi-continents,
l’Asie avec les baguettes, l’Afrique noire avec des plats et ustensiles issus
des fruits du calebassier… De nos jours, parmi les six milliards d’êtres
humains, la grande majorité mange sans couverts ! Ceci correspond généralement à des civilisations où le rapport à la nature reste essentiel, et on
QHSHXWUDPHQHUFHVSUDWLTXHVjGHVpWDWVDUULpUpVPDQJHUDYHFVHVGRLJWV
demande une grande dextérité, qui met en jeu une motricité complexe.
Manger avec des baguettes constitue un autre rapport au corps, à la nature
et au monde… Au Japon, grande puissance industrielle aux techniques
de pointe, les habitants préfèrent généralement manger dans la position
©DJHQRXLOOpHªVXUOHVWDORQVVDQVFKDLVHQLWDEOHSRXUPDQJHU«4XHVWLRQ
de civilisation. Une mondialisation qui voudrait ramener tous les objets
TXRWLGLHQVjGHVPRGqOHVXQLTXHVVHUDLWXQHIRUPLGDEOHYLROHQFHV\PERlique et culturelle à l’échelle planétaire !
En Europe même, les couverts ne sont pas identiques, comme le savent
ELHQOHVHQWUHSULVHVTXLH[SRUWHQWGHVFRXYHUWVOHVJUDQGHVFXLOOqUHVQ·RQW
SDV OD PrPH IRUPH SDUWRXW QL OHV PrPHV GLPHQVLRQV SOXV ORQJXHV HQ
)UDQFHTXHGDQVEHDXFRXSG·DXWUHVSD\VDGDSWpDX[©FRQVRPPpVªOH
cuilleron britannique est plus ramassé et plat ; à peine plus courte (19 cm),
ODFXLOOHUDPpULFDLQHFRUUHVSRQGDX[PXJVORQJXHFPODUJHHWpYDsée, la cuiller néerlandaise sert aux plats de pommes de terre… S’il en va
ainsi c’est que les usages (et les valeurs auxquelles ils renvoient) ne sont
SDVLGHQWLTXHV©2QQHWLHQWSDVVDFXLOOqUHjSRWDJHGHODPrPHIDoRQ
en France, où l’on présente l’extrémité à ses lèvres, et en Angleterre, où
c’est la partie latérale de la cuillère qui est portée à la boucheª&·HVWGLUH
)GOR DE 'ARINE ¦ ,ES MODES ALIMENTAIRES HISTOIRE DE L´ALIMENTATION ET DES MATInRES DE TABLE § DANS *EAN 0OIRIER
DIR (ISTOIRE DES M®URS OP CIT 4 ) VOL P AVEC ABONDANTE BIBLIOGRAPHIE ET PLUS SPmCI½QUEMENT
P !UTRE ASPECT UNE SOCImTm QUI EXPORTE DES MmNAGnRES DOIT LES CONCEVOIR AVEC UN NOMBRE DIFFmRENT
D´ARTICLES SELON LES PAYS DESTINATAIRES /N LE VOIT PAR EXEMPLE DANS LES CATALOGUES COMMERCIAUX DE LA SOCImTm
'UY $EGRENNE %NTRETIENS AVEC LES RESPONSABLES DES SERVICES COMMERCIAUX DE CETTE SOCImTm 6IRE 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES qu’au-delà d’évidents traits communs à l’Europe, cette diversité des couverts (qu’on retrouve d’ailleurs dans bon nombre d’autres objets usuels)
exprime la diversité des cultures nationales, parfois plus résistantes que
OHVeWDWVGDQVOHVTXHOVHOOHVRQWSUL[FRUSVHWTXLFRQÀUPHO·LQDQLWpG·XQ
prétendu modèle universel.
,ES COUVERTS mVOLUENT EN SYSTnMES
#HAQUE COUVERT FORME UN SYSTnME
Fût-il d’une seul pièce, comme le verre ou la cuiller, tout objet forme un
V\VWqPHFRPSOH[HFDULOLQWqJUHOHVGLYHUVHVGLPHQVLRQVGHODVRFLpWpTXL
l’a produit et qui en use.
1UATRE APPROCHES
&·HVW FH TX·D UpVXPp GHSXLV XQH WUHQWDLQH G·DQQpHV<YHV 'HIRUJH HQ
un célèbre schéma, mille fois reproduit en milieu scolaire, trop souvent
UpGXLWjXQHPpWKRGHVDQVODUpÁH[LRQTXLO·DSURGXLWH
MARCHANDISE
PRODUIT
CHAQUE OBJET
USAGES
SIGNES
7RXWREMHWHVWjODIRLVOHSURGXLWG·XQHpFRQRPLHXQHPDUFKDQGLVH
(ou don, échange, service gratuit) qui circule ; un outil dont on se sert ; et
XQREMHWTXLDXQVHQVDXGHOjGHVRQXVDJHDXWUHPHQWGLWXQ©VLJQHª
car il peut faire penser à autre chose qu’à lui-même (comme l’indique la
sémiologie). Par conséquent tout objet intègre les caractéristiques de son
WHPSVFHOOHVGHVV\VWqPHVGHSURGXFWLRQG·pFKDQJHG·XVDJHHWGHO·HQsemble de la civilisation dont il fait partie.
/N TROUVE CE SCHmMA PRmSENTm ET COMMENTm PAR EXEMPLE P DANS 9VES $EFORGE De l’éducation technologique à la culture technique. Pour une maîtrise sociale de la technique 0ARIS %3& P
# DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR bVITER UNE LECTURE MmCANISTE
2QDVRXYHQWIDLWGHFHVFKpPDXQHOHFWXUHSURGXFWLYLVWHHQWRXWFDV
GpWHUPLQLVWH LVVX GH O·LQJpQLRVLWp DUWLVDQDOH RX LQGXVWULHOOH HQ YXH GH
UHPSOLUXQHFHUWDLQHIRQFWLRQSXLVGLIIXVpSDUOHV\VWqPHG·pFKDQJHO·REMHWDFTXpUDLWÀQDOHPHQWXQVHQVGDQVODPDLVRQRXDLOOHXUVORUVGHVRQ
insertion dans des ensembles d’autres objets (avec lesquels il s’apparierait
RXHQWUHUDLWHQUXSWXUH©MXUHUDLWªHQVRPPH&·HVWXQHOHFWXUH©RULHQWpH ª G·XQH ORJLTXH WUqV IUDQoDLVH HQ WRXW FDV SRVLWLYLVWH TXL YHXW TXH
l’évolution humaine soit tout entière déterminée par les progrès de la
science et de la raison, donc universelle. Pour prendre un exemple actuel
(sans doute en caricaturant !), à l’âge des nanotechnologies correspondrait
la cuisine moléculaire.
Procéder à une investigation systémique
2QSHXWLPDJLQHUHWSUpIpUHUXQHYLVLRQLQYHUVpHSURGXLWVRFLDOO·REMHW
©H[SULPHªGHVEHVRLQVUHVVHQWLVjWUDYHUVXQHFHUWDLQHFXOWXUHXQV\VWqPHGHUHSUpVHQWDWLRQGRQQpHFHOXLG·XQPLOLHXVRFLDOG·XQWHUULWRLUH
d’un temps). Autrement dit, on peut lire le même schéma dans un sens
©RSSRVpªSURGXLWG·XQHFXOWXUHXQREMHWHVWG·DERUG©VLJQHªYLUWXHO
SXLVEHVRLQH[SULPpHQYXHG·XQXVDJHSURIHVVLRQQHOSHUVRQQHORXV\Pbolique), avant d’être conçu et produit matériellement puis d’être mis en
circulation, puis d’être transformé par l’usage, c’est-à-dire par les usagers.
$XWUHPHQWGLWHQFRUHHQDPRQWG·XQREMHWRQWURXYHG·DERUGODVRFLpWp
(non la nature et sa connaissance par les sciences de la matière). En fait,
SHXLPSRUWHOHVHQVGHOHFWXUHSRXUYXTX·HOOHVRLWV\VWpPLTXHQRQKLpUDUchisée et que l’exploration de l’objet porte bien sur toutes ses dimensions
sans exception.
,ES COUVERTS FORMENT UN SYSTnME ENTRE EUX
Qu’ils soient rangés dans un meuble ou disposés sur la table, les couYHUWVIRUPHQWXQHQVHPEOHSUpYXSDUOHIDEULFDQWRXFRGLÀpSDUGHVUqJOHV
(écrites ou coutumières). L’apparition d’un nouveau venu (telle la fourchette au XVe siècle) a des effets sur les autres (le couteau dans ce cas) et
sur l’ensemble de la prise d’aliments. Une évolution de matériaux touFKHUDO·HQVHPEOHFRPPHOHÀUHQWODJpQpUDOLVDWLRQGHO·LQR[DSUqVHW
celle des matières plastiques après 1980). Bien entendu, les changements
alimentaires retentissent directement sur les couverts, qu’il s’agisse de la
généralisation de la viande au XIXe siècle (qui appelle des couverts plus
robustes) ou à l’inverse la prolifération récente du mou et des laitages.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES )LS SONT EN SYSTnME AVEC LEUR ENTOURAGE IMMmDIAT
/HV PR\HQV XWLOLVpV SRXU FXLVLQHU ODYHU UDQJHU LQWHUYLHQQHQW pYLdemment aussi, comme cause ou comme conséquence de l’évolution des
FRXYHUWV 2Q O·D YX DX XIXe siècle, avec le remplacement de l’âtre par le
fourneau et avec l’arrivée de la table (et du plat qui remplace la marmite
suspendue). C’est également le cas avec l’arrivée du chauffage central (qui
permet de manger n’importe où et pas seulement dans la cuisine, en tout
cas dans la pièce où l’on chauffe), ou plus récemment avec celle du microondes ou du lave-vaisselle.
,ES COUVERTS FONT SYSTnME AVEC ¦ L´AIR DU TEMPS §
$LQVL UpVXPpH O·LGpH VXUSUHQG HW SRXUWDQW« 2Q VDLW j O·pYLGHQFH OH
rapport étroit des couverts avec leur civilisation (ce que montre leur diYHUVLWpSHUVLVWDQWHPDOJUpOD©PRQGLDOLVDWLRQª©/DFRQVRPPDWLRQDOLPHQWDLUHHVWXQpYpQHPHQWVRFLDOHOOHIDLWO·REMHWG·XQHUpSDUWLWLRQGRQW
OHVPRGDOLWpVVRQWUpJOpHVSDUXQV\VWqPHGHQRUPHVpWURLWHPHQWDOLJQpHV
avec celles qui règlent les rapports entre les individus, la société, le cosmos
et les puissances surnaturellesª/HVFRXYHUWVVRQWDVVRFLpVjODFLYLOLVDtion occidentale, comme les baguettes le sont à l’Asie. Roland Barthes le
VRXOLJQDLW DSUqV DYRLU GpFULW OHV IRQFWLRQV VSpFLÀTXHV j OD © GRXEOH EDJXHWWHª©'DQVWRXVFHVXVDJHVGDQVWRXVOHVJHVWHVTX·HOOHLPSOLTXHOD
baguette s’oppose à notre couteau (et à son substitut prédateur, la fourchette) ; elle est l’instrument alimentaire qui refuse de couper, d’agripper,
de mutiler, de percer (…)37ª7RXWHWHQWDWLYHSRXUPDULHUOHVGHX[PDQger avec des baguettes dans une assiette, par exemple) aboutit surtout à
DPXVHUOHV$VLDWLTXHV©1RVªFRXYHUWVVRQWVDQVGRXWHW\SLTXHVG·XQH
civilisation de la viande et du fer…
Si les couverts font corps avec une civilisation, ils sont également de
OHXUWHPSV'HPrPHTXHGDQVOHPRELOLHULO\DXQVW\OH/RXLV;,9RX
/RXLV;9XQVW\OHEDURTXHGDQVO·DUFKLWHFWXUHRXODPXVLTXHLO\DXQVW\OHG·pSRTXHGDQVOHVREMHWVOHVSOXVEDQDOV<YHV'HIRUJHHWVHVpWXGLDQWV
de l’université de technologie de Compiègne l’ont depuis longtemps montré pour de nombreux objets courants, par exemple en les comparant sur
SOXVLHXUVGpFHQQLHV38
)GOR DE 'ARINE ¦ ,ES MODES ALIMENTAIRES¨ § LOC CIT /N PEUT AUSSI VOIR (ISTOIRE DES CHOSES BANALES 86))E8)
DE $ANIEL 2OCHE 0ARIS &AYARD P
2OLAND "ARTHES ¦ "AGUETTES § DANS ,´EMPIRE DES SIGNES 0ARIS 3KIRA&LAMMARION P 6OIR AUSSI LE
½LM ,´ODEUR DE LA PAPAYE VERTE DE 4RAN !NH (UNG 9VES $EFORGE SCHmMA REPRODUIT P DANS 4ECHNOLOGIE ET GmNmTIQUE DE L´OBJET INDUSTRIEL, 0ARIS -ALOINE P
8E SInCLES)
# DE 2%#)43 #OUVERTS g REDmCOUVRIR ET g RECONCEVOIR &·HVWGLUHTXHOHVREMHWVpYROXHQW©HQV\VWqPHªPrPHORUVTXHULHQQH
semble les relier ; rien, sauf la civilisation dont ils font partie, sauf ce qu’on
QRPPHUDIDXWHGHPLHX[©O·DLUGXWHPSVªHWTXLVHWUDGXLWSDUGHVGRPLQDQWHVGHIRUPHVPDWpULDX[FRXOHXUVHWF&RPPHRQDSXO·HQWUHYRLU
SOXVKDXWOHVFRXYHUWVQ·pFKDSSHQWSDVj©O·DLUGXWHPSVªPDOJUpOHXU
DVSHFWELHQpWDEOLHWTX·RQFURLUDLWGpÀQLWLYHPHQWVWDELOLVp
2ECONCEVOIR DES COUVERTS C´EST COMPRENDRE ¦ L´AIR DU TEMPS §
3OXW{WTXHGXGHVVLQLQVSLUpRXTX·XQVW\OHGpFRUDWLIOHGHVLJQHVWXQ
GHVVHLQUpÁpFKL2QOHFRQIRQGVRXYHQWDYHFXQHFUpDWLRQDUWLVWLTXHTXL
aurait toute liberté (oubliant au passage que celle-ci, non plus, n’échappe
pas à son temps), comme s’il s’agissait de plaquer de l’art sur des objets
usinés. Le design s’apparente plutôt à la conception industrielle, comme
recherche tout à la fois fonctionnelle, ergonomique, esthétique, imaginative et riche de sens. Plutôt que coups d’éclat ou extravagances, on attend
GXGHVLJQTX·LOFRQoRLYHGHVVROXWLRQVQRXYHOOHVHQSHUFHYDQW
– les besoins nouveaux générés par l’évolution sociale (par exemple la
généralisation du travail salarié des femmes a suscité de nouvelles pratiques alimentaires dans les familles) ;
– les nouvelles possibilités (matériaux, énergie, etc.) ;
²OHVWHQGDQFHVGXPRPHQW©O·DLUGXWHPSVªTXHFHVRLWSRXUV·\
adapter ou pour rompre avec elles, selon les besoins qu’il s’agit de satisfaire.
Si les couverts sont appelés à évoluer de nouveau, sous l’impulsion des
mutations de la vie quotidienne contemporaine, la conception industrielle
(et en son sein le rôle du design) est elle-même à revoir ; tandis que son
importance continuera de croître dans le processus de production, c’est
VD FRQGXLWH PrPH TXL GHYUDLW rWUH UpYLVpH DÀQ GH SDVVHU G·XQ SLORWDJH
centralisé et autoritaire à une orientation démocratique de l’innovation
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,%15). 9VES technique39, par exemple en associant l’usager aux choix stratégiques de
conception. C’est la seule voie possible si l’on veut par exemple s’orienter vers une écoconception tournant le dos au gaspillage du jetable pour
concevoir des couverts ajustés aux nouveaux usages et économes en ressources.
#/.#,53)/.
/HGHVLJQQHSHXW©IDLUHWHQGDQFHªTX·HQLQVFULYDQWVRQGHVVHLQGDQV
ce que les tendances de son temps et de ses lieux comportent de nouveau
(besoins, possibles, imaginaire). Ceci vaut et vaudra pour les couverts
comme pour tout autre objet technique, aussi simple ou aussi sophistiqué
soit-il. Leur devenir sera le nôtre. Que seront les couverts français ou
HXURSpHQV GDQV GL[ RX FLQTXDQWH DQV QXO QH SHXW OH SUpGLUH ERUQRQV
QRXV j SDUDSKUDVHU FH TX·pFULYDLW -DFTXHV /DÀWWH HQ j SURSRV GHV
PDFKLQHV©SRXUREWHQLU«XQPDFKLQLVPHOLEpUDWHXUDJLVVDQWVXUOHV
facteurs de l’évolution mécanique, nous devons connaître, comprendre et
régler nos besoins. [Les machines] Elles seront ce que nous saurons devenir nous-mêmes. Et rien n’indique que nous saurons un jour vouloir notre
devenirªOHVFRXYHUWVGHVSURFKDLQHVGpFHQQLHVVHURQWFHTXHO·KXPDnité européenne saura devenir.
Ce texte correspond à une communication présentée à l’occasion de la Biennale du design,
lors d’un colloque organisé par l’université Jean Monnet de Saint-Étienne sous la direction de
-DFTXHOLQH%D\RQOHQRYHPEUHVXU©2EMHWVHWHQWUHSULVHVGHV$UWVPpQDJHUVXQHKLVWRLUHHWGHVSDWULPRLQHVG·HQWUHSULVHVjVDXYHJDUGHUª
9VES#LAUDE ,EQUIN #HOIX ET DmMOCRATIE TECHNIQUEs DmCEMBRE SUR LE SITE DU &ORUM MONDIAL 3CIENCES
ET DmMOCRATIE HTTPFMSCIENCESORG OU HTTPFMSCIENCESORGSPIPPHPARTICLE
9VES#LAUDE ,EQUIN IN ½LM DE 2AFAEL 'UTIERREZ #ES OBJETS QUI NOUS ENTOURENT AVEC 0AUL 6AN DER #RIJP "RUNO
*ACOMY #HRISTIAN ,AUGIER #mLINE .´'UYEN¨ #AP #ANAL MIN
*ACQUES ,A½TTE 2m¾EXIONS SUR LA SCIENCE DES MACHINES 0ARIS 2mmDITION 6RIN P
# DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX "EFORE THE )NTERNET
4HE &RENCH %XPERIENCE WITH 6IDEOTEX
!NDREW &EENBERG
).&/2-!4)/. /2 #/--5.)#!4)/.
1RWLRQVOLNH©SRVWLQGXVWULDOVRFLHW\ªDQGWKH©LQIRUPDWLRQDJHªDUHIRUHFDVWVVRFLDOVFLHQFHÀFWLRQVRIDVRFLDORUGHUEDVHGRQNQRZOHGJH. The
ROGZRUOGRIFRDOVWHHODQGUDLOURDGVZLOOHYDSRUDWHLQDFORXGRILQGXVWULDO
VPRNHDVDQHZRQHEDVHGRQFRPPXQLFDWLRQVDQGFRPSXWHUVLVERUQ7KH
SRSXODUL]HUVRIWKLVYLVLRQSXWDFKHHUIXOVSLQRQPDQ\RIWKHVDPHWUHQGV
GHSORUHGE\G\VWRSLDQFULWLTXHVXFKDVKLJKHUOHYHOVRIRUJDQL]DWLRQDQG
LQWHJUDWLRQRIWKHHFRQRP\DQGWKHJURZLQJLPSRUWDQFHRIH[SHUWLVH
&RPSXWHUVSOD\DVSHFLDOUROHLQWKHVHIRUHFDVWVEHFDXVHWKHPDQDJHment of social institutions and individual lives depends more and more
RQVZLIWDFFHVVWRGDWD1RWRQO\FDQFRPSXWHUVVWRUHDQGSURFHVVGDWD
WKH\FDQEHQHWZRUNHGWRGLVWULEXWHLWDVZHOO,QWKHSRVWLQGXVWULDOIXWXUH
FRPSXWHUPHGLDWHGFRPPXQLFDWLRQ&0&ZLOOSHQHWUDWHHYHU\DVSHFWRI
GDLO\OLIHDQGVHUYHWKHULVLQJGHPDQGIRULQIRUPDWLRQ
$WWKHHQGRIWKHVWKHVHSUHGLFWLRQVZHUHWDNHQXSE\SROLWLFDODQG
EXVLQHVVOHDGHUVZLWKWKHSRZHUWRFKDQJHWKHZRUOG2QHOHDUQVDJUHDW
GHDODERXWDYLVLRQIURPDWWHPSWVWRUHDOL]HLW:KHQDVLQWKLVFDVHWKH
UHVXOWVVWUD\IDUIURPH[SHFWDWLRQVWKHWKHRULHVWKDWLQVSLUHGWKHRULJLQDO
IRUHFDVWDUHFDOOHGLQWRTXHVWLRQ7KLVFKDSWHUH[SORUHVWKHJDSEHWZHHQ
WKHRU\DQGSUDFWLFHLQDSDUWLFXODUO\LPSRUWDQWFDVHRIPDVVFRPSXWHUL]DWLRQWKHLQWURGXFWLRQRIYLGHRWH[LQ)UDQFHWKDWZDVNQRZQXQGHUWKH
)UHQFKQDPH´7HOHWHOµDFFHVVLEOHE\WKHIDPRXV´PLQLWHOµ
9LGHRWH[LVDW\SHRIVRIWZDUHGHVLJQHGIRUWKHGHOLYHU\RIGDWDRQFRPSXWHUQHWZRUNV9LGHRWH[V\VWHPVZRUNDVRQOLQHOLEUDULHVWKDWVWRUH´SD
4EXT PUBLISHED IN !LTERNATIVE -ODERNITY 5NIVERSITY OF #ALIFORNIA 0RESS $ANIEL "ELL 4HE #OMING OF 0OST)NDUSTRIAL 3OCIETY .EW 9ORK "ASIC "OOKS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW JHVµRILQIRUPDWLRQLQWKHPHPRU\RIDKRVWFRPSXWHUDFFHVVLEOHWRXVHUV
HTXLSSHGZLWKDWHUPLQDODQGPRGHP7RGD\WKH,QWHUQHWSHUIRUPVWKLV
IXQFWLRQEXWYLGHRWH[RULJLQDOO\SLRQHHUHGDVLPLODUV\VWHP7KLVWKHQ
ZDVWKHÀUVWPDMRUWHFKQRORJLFDOFRQFUHWL]DWLRQRIWKHQRWLRQRIDSRVWLQGXVWULDOVRFLHW\
7KHWKHRU\RIWKHLQIRUPDWLRQDJHSURPLVHGDQHPHUJLQJYLGHRWH[PDUNHWSODFH([SHULHQFHZLWKYLGHRWH[LQWXUQWHVWHGVRPHRIWKDWWKHRU\·V
PDMRUDVVXPSWLRQVLQSUDFWLFH(DUO\SUHGLFWLRQVKDGHYHU\RQHOLQNHGWR
YLGHRWH[VHUYLFHVZHOOEHIRUHWKHV%\WKHHQGRIWKHV(XURSHDQ
WHOHFRPPXQLFDWLRQVPLQLVWULHVDQG$PHULFDQFRUSRUDWLRQVZHUHSUHSDUHG
WR PHHW WKLV FRQÀGHQWO\ SUHGLFWHG IXWXUH ZLWK QHZ LQWHUDFWLYH V\VWHPV
([SHULPHQWDO V\VWHPV ZHUH ODXQFKHG WR WHVW GLIIHUHQW FRQÀJXUDWLRQV RI
WKHWHFKQRORJ\%XWPRVWRIWKHVHH[SHULPHQWVZHUHGLVPDOIDLOXUHV
7KLVRXWFRPHPD\KDYHEHHQGXHLQSDUWWRDQWLWUXVWUXOLQJVWKDWSUHvented giant telephone and computer companies from merging their comSOHPHQWDU\WHFKQRORJLHVLQODUJHVFDOHSXEOLFV\VWHPV,QWKH86$WKH)Hderal Communication Commission’s failure to set a standard for terminals
DJJUDYDWHGWKHVLWXDWLRQ/DFNLQJWKHUHVRXUFHVDQGNQRZKRZRIWKHELJ
FRPSDQLHVWKHLUHIIRUWVXQFRRUGLQDWHGE\JRYHUQPHQWLWLVQRWVXUSULVLQJ
WKDWVPDOOHUHQWHUWDLQPHQWDQGSXEOLVKLQJÀUPVZHUHXQDEOHWRPDNHD
success of commercial videotex3.
'LVDSSRLQWLQJ UHVXOWV LQ WKH 8QLWHG 6WDWHV ZHUH FRQÀUPHG E\ DOO IRUHLJQ H[SHULPHQWV ZLWK YLGHRWH[ ZLWK WKH H[FHSWLRQ RI WKH )UHQFK 7HOHWHOV\VWHP7KH%ULWLVK3UHVWHOLQWURGXFHGYLGHRWH[WKUHH\HDUVEHIRUHWKH
)UHQFKFDPHRQWKHVFHQH,URQLFDOO\WKH)UHQFKSOXQJHGLQWRYLGHRWH[RQ
a grand scale in part out of fear of lagging behind Britain.
Prestel KDGWKHDGYDQWDJHRIVWDWHVXSSRUWZKLFKQR$PHULFDQV\VWHP
FRXOG ERDVW %XW LW DOVR KDG D FRUUHVSRQGLQJ GLVDGYDQWDJH RYHUFHQWUDOL]DWLRQ $W ÀUVW LQIRUPDWLRQ VXSSOLHUV FRXOG QRW FRQQHFW UHPRWH KRVWV
WRWKHV\VWHPZKLFKVHYHUHO\OLPLWHGJURZWKLQVHUYLFHV:KDWLVPRUH
Prestel UHOLHGRQXVHUVWREX\DGHFRGHUIRUWKHLUWHOHYLVLRQVHWVDQH[SHQVLYHSLHFHRIKDUGZDUHWKDWSODFHGYLGHRWH[LQFRPSHWLWLRQZLWKWHOHYLVLRQ
SURJUDPPLQJ7KHVXEVFULEHUEDVHJUHZZLWKSDWKHWLFVORZQHVVULVLQJWR
RQO\LQWKHÀUVWÀYH\HDUV.
0HDQZKLOHWKHVXFFHVVIXODSSOLFDWLRQVRI&0&ZHUHDOORUJDQL]HGE\
DQGIRUSULYDWHEXVLQHVVHVXQLYHUVLWLHVRUFRPSXWHUKREE\LVWV7KHJHQH
!NNE "RANSCOMB ±6IDEOTEXT 'LOBAL 0ROGRESS AND #OMPARATIVE 0OLICIES² IN *OURNAL OF #OMMUNICATION PP *EAN-ARIE #HARON ¦ 4ELETEL DE L´INTERACTIVITm HOMMEMACHINE g LA COMMUNICATION MmDIATISmE § IN -ARIE
-ARCHAND ED ,ES 0ARADIS )NFORMATIONNELS 0ARIS -ASSON P 2ENATE -AYNTZ AND 6OLKER 3CHNEI
DER ±4HE $YNAMICS OF 3YSTEM $EVELOPMENT IN A #OMPARATIVE 0ERSPECTIVE )NTERACTIVE 6IDEOTEX IN 'ERMANY
&RANCE AND "RITAIN² IN 2ENATE -AYNTZ ET 4HOMAS (UGHES EDS 4HE $EVELOPMENT OF ,ARGE 4ECHNICAL 3YSTEMS
"OULDER 7ESTVIEW 0RESS P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX UDOSXEOLFVWLOOKDVOLWWOHRUQRDFFHVVWRWKHVHQHWZRUNVDQGQRQHHGWRXVH
VXFK VSHFLDOL]HG RQOLQH VHUYLFHV DV ELEOLRJUDSKLF VHDUFKHV DQG VRIWZDUH
banks. Thus after a brief spurt of postindustrial enthusiasm for videotex,
&0&ZDVUHJDUGHGDVVXLWDEOHSULPDULO\IRUZRUNQRWIRUSOHDVXUHLWZDV
expected to serve professional needs rather than leisure or consumption.
$VZHZLOOH[SODLQEHORZWKH7HOHWHOVWRU\LVTXLWHGLIIHUHQW%HWZHHQ
WKHGDWHRIWKHÀUVWWHVWVRIWKH)UHQFKV\VWHPDQGWKHHQGRIWKHGHFDGH7HOHWHOEHFDPHE\IDUWKHODUJHVWSXEOLFYLGHRWH[V\VWHPLQWKHZRUOG
ZLWKWKRXVDQGVRIVHUYLFHVPLOOLRQVRIXVHUVDQGKXQGUHGVRIPLOOLRQVRI
GROODUVLQUHYHQXHV8QWLOLWZDVHFOLSVHGE\WKH,QWHUQHW7HOHWHOZDVWKH
EULJKWHVWVSRWLQWKHRWKHUZLVHXQLPSUHVVLYHFRPPHUFLDOYLGHRWH[SLFWXUH
7HOHWHOVWLOOH[LVWVEXWWKH,QWHUQHWKDVUHSODFHGLWIRUPDQ\SXUSRVHV
This outcome is puzzling. Could it be that the French are different from
HYHU\RQHHOVH"7KDWUDWKHUVLOO\H[SODQDWLRQEHFDPHOHVVSODXVLEOHDV&RPSX6HUYHDQGWKH6HDUV,%03URGLJ\ V\VWHPJUHZWRDPLOOLRQVXEVFULEHUV
LQWKHHDUO\V7KHVKHHUVL]HRIWKHVHHDUOLHUV\VWHPVFRQÀUPHGWKH
H[LVWHQFHRIDKRPHYLGHRWH[PDUNHWEXWDWÀUVWRQO\WKH)UHQFKNQHZKRZ
WRSURÀWIURPLW+RZWKHQFDQZHDFFRXQWIRUWKHDVWRQLVKLQJVXFFHVVRI
7HOHWHODQGZKDWDUHLWVLPSOLFDWLRQVIRUWKHLQIRUPDWLRQDJHWKHRU\WKDW
inspired its creation?
Teletel LV SDUWLFXODUO\ LQWHUHVWLQJ EHFDXVH LW HPSOR\HG QR WHFKQRORJ\
QRWUHDGLO\DYDLODEOHLQDOOWKRVHRWKHUFRXQWULHVZKHUHYLGHRWH[ZDVWULHG
DQGIDLOHG,WVVXFFHVVFDQRQO\EHH[SODLQHGE\LGHQWLI\LQJWKHsocial inventions WKDWDURXVHGZLGHVSUHDGSXEOLFLQWHUHVWLQ&0&$FORVHORRNDW
WKRVHLQYHQWLRQVVKRZVWKHOLPLWDWLRQVQRWRQO\RISULRUH[SHULPHQWVZLWK
YLGHRWH[EXWDOVRRIWKHWKHRU\RIWKHLQIRUPDWLRQDJH.
4(% %-%2'%.#% /& ! .%7 -%$)5:KLOH 7HOHWHO HPERGLHV JHQHUDOO\ YDOLG GLVFRYHULHV DERXW GRPHVWLF
&0&LWLVDOVRSHFXOLDUO\)UHQFK0XFKWKDWLVXQLTXHDERXWLWVWHPVIURP
WKHFRQÁXHQFHRIWKUHHIDFWRUVDVSHFLÀFDOO\)UHQFKSROLWLFVRIPRGHUQL]DWLRQWKHEXUHDXFUDF\·VYROXQWDULVWLFLGHRORJ\RIQDWLRQDOSXEOLFVHUvice; and 3) a strong oppositional political culture. Each of these factors
FRQWULEXWHGWRDUHVXOWQRVLQJOHJURXSLQ)UHQFKVRFLHW\ZRXOGZLOOLQJO\
KDYH VHUYHG LQ WKH EHJLQQLQJ 7RJHWKHU WKH\ RSHQHG WKH VSDFH RI VRFLDO
experimentation that Teletel PDGHWHFKQLFDOO\SRVVLEOH
*AMES %TTEMA ±)NTERACTIVE %LECTRONIC 4EXT IN THE 5NITED 3TATES #AN 6IDEOTEX %VER 'O (OME !GAIN² IN *ERRY
, 3ALVAGGIO AND *ENNINGS "RYANT EDS -EDIA 5SE IN THE )NFORMATION !GE EMERGING PATTERNS OF ADOPTION AND
CONSUMER USE (ILLSDALE .* ,AWRENCE %RLBAUM !SSOCIATES P !NDREW &EENBERG #RITICAL 4HEORY OF 4ECHNOLOGY .EW 9ORK /XFORD CHAP 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW -ODERNIZATION
7KHFRQFHSWRIPRGHUQLW\LVDOLYHLVVXHLQ)UDQFHLQDZD\WKDWLVGLIÀFXOWWRLPDJLQHLQWKH8QLWHG6WDWHV$PHULFDQVH[SHULHQFHPRGHUQLW\DV
a birthright; America does not strive IRUPRGHUQLW\LWGHÀQHVPRGHUQLW\RU
at least so it believes. For that reason, the United States does not treat its
RZQPRGHUQL]DWLRQDVDSROLWLFDOLVVXHEXWUHOLHVRQWKHFUHDWLYHFKDRVRI
the market.
France, on the other hand, has a long tradition of theoretical and poOLWLFDOFRQFHUQZLWKPRGHUQLW\DVVXFK,QWKHVKDGRZRI(QJODQGDWÀUVW
DQG ODWHU RI *HUPDQ\ DQG WKH 86 )UDQFH KDV VWUXJJOHG WR DGDSW LWVHOI
WRDPRGHUQZRUOGLWKDVDOZD\VH[SHULHQFHGWRVRPHH[WHQWDVDQH[WHUQDO FKDOOHQJH 7KH H[WUDRUGLQDU\ EDFNZDUGQHVV RI WKH )UHQFK WHOHSKRQH
V\VWHP ZDV D V\PERO RI WKLV JHQHUDO FRQVHUYDWLVP DQG VR LWV UDSLG PRGHUQL]DWLRQXQGHU3UHVLGHQW*LVFDUGG·(VWDLQJVLJQLÀHGWKHZLOOWRPHHW
WKH FKDOOHQJH 7KLV LV WKH VSLULW RI WKH IDPRXV 1RUD0LQF 5HSRUW ZKLFK
*LVFDUG FRPPLVVLRQHG IURP WZR WRS FLYLO VHUYDQWV WR GHÀQH WKH PHDQV
DQGJRDOVRIDFRQFHUWHGSROLF\RIPRGHUQL]DWLRQIRU)UHQFKVRFLHW\LQWKH
ODVW\HDUVRIWKHFHQWXU\7.
1RUDDQG0LQFFDOOHGIRUDWHFKQRORJLFDORIIHQVLYHLQ´WHOHPDWLFVµWKH
WHUP WKH\ FRLQHG WR GHVFULEH WKH PDUULDJH RI FRPSXWHUV DQG FRPPXQLFDWLRQV7KHWHOHPDWLFUHYROXWLRQWKH\DUJXHGZLOOFKDQJHWKHQDWXUHRI
PRGHUQVRFLHWLHVDVUDGLFDOO\DVWKHLQGXVWULDOUHYROXWLRQ%XWWKH\DGGHG
´·7HOHPDWLFV·XQOLNHHOHFWULFLW\GRHVQRWFDUU\DQLQHUWFXUUHQWEXWUDWKHU
LQIRUPDWLRQ WKDW LV WR VD\ SRZHUµ ´0DVWHULQJ WKH QHWZRUN LV WKHUHIRUH
DQHVVHQWLDOJRDO,WVIUDPHZRUNPXVWWKHUHIRUHEHFRQFHLYHGLQWKHVSLULW
of public service”8,QVXPMXVWDVZDULVWRRLPSRUWDQWWREHOHIWWRWKH
generals, so postindustrial development is too important to be left to businessmen and must become a political affair.
1RUDDQG0LQFSDLGSDUWLFXODUDWWHQWLRQWRWKHQHHGWRZLQSXEOLFDFFHSWDQFH RI WKH WHOHPDWLF UHYROXWLRQ DQG WR DFKLHYH VXFFHVV LQ WKH QHZ
international division of labor through targeting emerging telematic markets9 7KH\ DUJXHG WKDW D QDWLRQDO YLGHRWH[ VHUYLFH FRXOG SOD\ D FHQWUDO
UROH LQ DFKLHYLQJ WKHVH REMHFWLYHV 7KLV VHUYLFH ZRXOG VHQVLWL]H WKH VWLOO
EDFNZDUG)UHQFKSXEOLFWRWKHZRQGHUVRIWKHLQIRUPDWLRQDJHZKLOHFUHDting a huge protected market for computer terminals. Leveraging the inWHUQDOPDUNHW)UDQFHZRXOGHYHQWXDOO\EHFRPHDOHDGLQJH[SRUWHURIWHUPLQDOVDQGVREHQHÀWIURPWKHH[SHFWHGUHVWUXFWXULQJRIWKHLQWHUQDWLRQDO
3IMON .ORA AND !LAIN -INC ,´INFORMATISATION DE LA SOCImTm 0ARIS %DITIONS DU 3EUIL )BIDEM P )BIDEM P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX HFRQRP\LQVWHDGRIIDOOLQJIXUWKHUEHKLQG107KHVHLGHDVOD\DWWKHRULJLQRI
WKH7HOHWHOSURMHFWZKLFKDVDSHFXOLDUPL[RISURSDJDQGDDQGLQGXVWULDO
SROLF\KDGDGLVWLQFWO\VWDWLVWÁDYRUIURPWKHYHU\EHJLQQLQJ
6OLUNTARISM
6RFRQFHLYHGWKHSURMHFWIHOOQDWXUDOO\LQWRWKHKDQGVRIWKHFLYLOVHUYLFH 7KLV FKRLFH ZKLFK VHHPV VWUDQJH WR $PHULFDQV FRQWHPSWXRXV RI
EXUHDXFUDWLFLQHSWQHVVPDNHVSHUIHFWVHQVHLQ)UDQFHZKHUHEXVLQHVVKDV
an even more negative image than government.
:KHQLWLVWKHEXUHDXFUDF\UDWKHUWKDQWKHFRUSRUDWLRQWKDWVSHDUKHDGV
modernization, the esprit de corps of the civil service leaves its mark on
the outcome. In France this is not such a bad thing. French bureaucrats
GHÀQH WKH QDWLRQ LQ WHUPV RI WKH XQLIRUP SURYLVLRQ RI VHUYLFHV VXFK DV
mail, phone, roads, schools, and so on. Delivering these services is a moral mission predicated on the “republican” ideal of egalitarianism. The
French call this bureaucratic approach “voluntaristic” because, for better
RUZRUVHLWLJQRUHVORFDOVLWXDWLRQVDQGHFRQRPLFFRQVWUDLQWVWRVHUYHD
universal public interest.
2QH PXVW NHHS WKLV YROXQWDULVWLF VHQVH RI PLVVLRQ LQ PLQG WR XQGHUVWDQGKRZWKHJRYHUQPHQWRZQHG)UHQFKWHOHSKRQHFRPSDQ\FKDUJHGZLWK
developing Teletel, could have conceived and implemented a national viGHRWH[VHUYLFHZLWKRXWDQ\JXDUDQWHHRISURÀWDEOHRSHUDWLRQ,QIDFW7HOHWHO
ZDVOHVVDPRQH\PDNLQJVFKHPHWKDQDOLQNLQWKHFKDLQRIQDWLRQDOLGHQWLW\$VVXFKLWZDVLQWHQGHGWRUHDFKHYHU\)UHQFKKRXVHKROGDVSDUWRIWKH
LQIUDVWUXFWXUHRIQDWLRQDOXQLW\MXVWOLNHWKHWHOHSKRQHDQGWKHPDLOV11.
7RDFKLHYHWKLVUHVXOWWKHWHOHSKRQHFRPSDQ\SURFHHGHGWRGLVWULEXWH
millions of free terminals, called “0LQLWHOVµ$OWKRXJK HDUO\ DGYHUWLVLQJ
ZDVPDLQO\GLUHFWHGDWSURVSHURXVQHLJKERUKRRGVDQ\RQHFRXOGUHTXHVW
D0LQLWHO(YHQWXDOO\DOOSKRQHVXEVFULEHUVZHUHWREHHTXLSSHG)UDQFH
ZRXOGOHDSIURJRXWRILWVSRVLWLRQDVWKHLQGXVWULDOFRXQWU\ZLWKWKHPRVW
EDFNZDUGWHOHSKRQHV\VWHPULJKWLQWRWKHWHFKQRORJ\RIWKHQH[WFHQWXU\
$Q $PHULFDQ WHOHSKRQH FRPSDQ\ ZRXOG FHUWDLQO\ KDYH FKDUJHG IRU
such an elaborate upgrade of the users’ equipment. Even the French goYHUQPHQWZDVDELWZRUULHGDERXWMXVWLI\LQJWKLVXQSUHFHGHQWHGERXQW\
7KHH[FXVHLWFDPHXSZLWKZDVWKHFUHDWLRQRIDQDWLRQDOHOHFWURQLFSKRQH
GLUHFWRU\DFFHVVLEOHRQO\E\0LQLWHOEXWLQIDFWWKHPDLQSRLQWRIWKHH[HUFLVHZDVVLPSO\WRJHWDKXJHQXPEHURIWHUPLQDOVRXWWKHGRRUDVTXLFNO\
)BIDEM P 3IMON .ORA AND !LAIN -INC ,´INFORMATISATION¨ OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW as possible. Free distribution of terminals preceded the development of a
PDUNHWLQVHUYLFHVZKLFKLWZDVVXSSRVHGWREULQJDERXW-XVWDVURDGVLGH
EXVLQHVVHVIROORZKLJKZD\VVRWHOHPDWLFEXVLQHVVHVZHUHH[SHFWHGWRIROORZWKHGLVWULEXWLRQRI0LQLWHOs.
7KH ÀUVW 0LQLWHOs ZHUH GHOLYHUHG LQ 13 WHQ \HDUV ODWHU RYHU
KDG EHHQ GLVWULEXWHG 7KH VSHHG DQG VFDOH RI WKLV SURFHVV DUH
clues to the economics of the great telematic adventure. The telephone
FRPSDQ\·VDPELWLRXVPRGHUQL]DWLRQSURJUDPKDGPDGHLWWKHODUJHVWVLQJOHFXVWRPHUIRU)UHQFKLQGXVWU\LQWKHV7KHGDULQJWHOHPDWLFSODQ
ZDVGHVLJQHGWRWDNHXSWKHVODFNLQWHOHSKRQHSURGXFWLRQWKDWZDVVXUH
WRIROORZWKHVDWXUDWLRQRIWKDWPDUNHWWKHUHE\DYRLGLQJWKHFROODSVHRID
major industrial sector.
/PPOSITION
$VRULJLQDOO\FRQFHLYHG7HOHWHO ZDVGHVLJQHGWREULQJ)UDQFHLQWRWKH
LQIRUPDWLRQDJHE\SURYLGLQJDZLGHYDULHW\RIVHUYLFHV%XWLVPRUHLQIRUPDWLRQZKDWHYHU\KRXVHKROGQHHGV"$QGZKRLVTXDOLÀHGWRRIIHU
LQIRUPDWLRQVHUYLFHVLQDGHPRFUDF\"7KHVHTXHVWLRQVUHFHLYHGDYDULHW\
RIFRQÁLFWLQJDQVZHUVLQWKHHDUO\\HDUVRI)UHQFKYLGHRWH[
0RGHUQL]DWLRQWKURXJKQDWLRQDOVHUYLFHGHÀQHVWKHSURJUDPRIDKLJKO\
FHQWUDOL]HGDQGFRQWUROOLQJVWDWH7RPDNHPDWWHUVZRUVHWKH7HOHWHOSURMHFWZDVLQLWLDWHGE\DFRQVHUYDWLYHJRYHUQPHQW7KLVFRPELQDWLRQDWÀUVW
LQVSLUHGZLGHVSUHDGGLVWUXVWDQGDZDNHQHGWKHZHOONQRZQIUDFWLRXVQHVV
of important sectors of opinion. The familiar pattern of central control and
SRSXODUUHVLVWDQFHZDVUHSHDWHGRQFHDJDLQZLWK7HOHWHODSURJUDPWKDW
ZDV´SDUDFKXWHGµRQDQXQVXVSHFWLQJSXEOLFDQGVRRQWUDQVIRUPHGE\LW
LQZD\VLWVPDNHUVKDGQHYHULPDJLQHG
The press led the struggle against government control of videotex.
:KHQWKHKHDGRIWKH)UHQFKWHOHSKRQHFRPSDQ\DQQRXQFHGWKHDGYHQW
RIWKHSDSHUOHVVVRFLHW\LQ'DOODVRIDOOSODFHVSXEOLVKHUVUHDFWHGQHJDWLYHO\RXWRIIHDURIORVLQJDGYHUWLVLQJUHYHQXHVDQGLQGHSHQGHQFH7KH
G\VWRSLDQLPSOLFDWLRQVRIDFRPSXWHUGRPLQDWHGVRFLHW\GLGQRWSDVVXQQRWLFHG2QHLUDWHSXEOLVKHUZURWH´+HZKRJUDVSVWKHZLUHLVSRZHUIXO
+H ZKR JUDVSV WKH ZLUH DQG WKH VFUHHQ LV YHU\ SRZHUIXO +H ZKR ZLOO
-ARIE -ARCHAND ,A 'RANDE !VENTURE DU -INITEL 0ARIS ,AROUSSE P )BIDEM P 2AYMOND3TONE )WAASA ¦ 4mLmMATIQUE GRAND PUBLIC L´INFORMATION OU LA COMMUNICATION ,ES CAS DE 'RmTEL ET
DE #OMPUSERVE § IN ,E "ULLETIN DE L´)$!4% P -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX VRPHGD\ JUDVS WKH ZLUH WKH VFUHHQ DQG WKH FRPSXWHU ZLOO SRVVHVV WKH
SRZHURI*RGWKH)DWKHU+LPVHOIµ.
7KH SUHVV WULXPSKHG ZLWK WKH DUULYDO RI WKH VRFLDOLVW JRYHUQPHQW LQ
7RSUHYHQWSROLWLFDOLQWHUIHUHQFHZLWKRQOLQHFRQWHQWWKHWHOHSKRQH
FRPSDQ\LWVHOIZDVDOORZHGWRRIIHURQO\LWVHOHFWURQLFYHUVLRQRIWKHWHOHSKRQHGLUHFWRU\0HDQZKLOHWKHGRRUVWR7HOHWHOZHUHRSHQHGZLGHE\
WKHVWDQGDUGVRIWKHGD\DQ\RQHZLWKDSXEOLVKHU·VOLFHQVHFRXOGFRQQHFW
DKRVWWRWKHV\VWHP,QHYHQWKLVUHVWULFWLRQZDVDEDQGRQHGWRGD\
DQ\RQHZLWKDFRPSXWHUFDQKRRNXSWRWKHV\VWHPOLVWDSKRQHQXPEHU
LQWKHGLUHFWRU\DQGUHFHLYHDVKDUHRIWKHUHYHQXHVWKHVHUYLFHJHQHUDWHV
IRUWKHSKRQHFRPSDQ\
%HFDXVH VPDOO KRVW FRPSXWHUV DUH IDLUO\ LQH[SHQVLYH DQG NQRZOHGJH
of videotex no more common in large than in small companies, these deFLVLRQV KDG DW ÀUVW D KLJKO\ GHFHQWUDOL]LQJ HIIHFW 7HOHWHO became a vast
space of disorganized experimentation, a “free market” in on-line serviFHVPRUHQHDUO\DSSUR[LPDWLQJWKHOLEHUDOLGHDOWKDQPRVWFRPPXQLFDWLRQ
PDUNHWVLQFRQWHPSRUDU\FDSLWDOLVWVRFLHWLHV
This example of the success of the market has broad implications, but
not quite so broad as the advocates of deregulation imagine. The fact that
markets sometimes mediate popular demands for technical change does
not make them a universal panacea. All too often markets are manipulaWHGE\ODUJHFRUSRUDWLRQVWRVHOOZHOOHVWDEOLVKHGWHFKQRORJLHVDQGVWLÁH
the demands existing products cannot meet or rechannel those demands
LQWRGRPDLQVZKHUHEDVLFWHFKQLFDOFKDQJHQHHGQRWRFFXU1HYHUWKHOHVV
FRQVXPHUVGRRFFDVLRQDOO\UHRSHQWKHGHVLJQSURFHVVWKURXJKWKHPDUNHW
7KLVLVFHUWDLQO\DUHDVRQWRYLHZPDUNHWVDVDPELYDOHQWLQVWLWXWLRQVZLWKD
SRWHQWLDOO\G\QDPLFUROHWRSOD\LQWKHGHYHORSPHQWRIQHZWHFKQRORJ\
#OMMUNICATION
6XUSULVLQJO\ DOWKRXJK SKRQH VXEVFULEHUV ZHUH QRZ HTXLSSHG IRU
WKHLQIRUPDWLRQDJHWKH\PDGHUHODWLYHO\OLWWOHXVHRIWKHZHDOWKRIGDWD
DYDLODEOHRQ7HOHWHO7KH\FRQVXOWHGWKHHOHFWURQLFGLUHFWRU\UHJXODUO\EXW
QRWPXFKHOVH7KHQLQKDFNHUVWUDQVIRUPHGWKHWHFKQLFDOVXSSRUW
IDFLOLW\RIDQLQIRUPDWLRQVHUYLFHFDOOHGGretel LQWRDPHVVDJLQJV\VWHP17.
After putting up a feeble (perhaps feigned) resistance, the operators of
this service institutionalized the hackers’ invention and made a fortune.
2WKHU VHUYLFHV TXLFNO\ IROORZHG ZLWK QDPHV OLNH “Désiropolis,” “La Voix
1UOTED IN -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P 4HIERRY "RUHAT ¦ -ESSAGERIES %LECTRONIQUES 'RmTEL g 3TRASBOURG ET 4ELETEL g 6mLIZY § IN -ARIE -ARCHAND AND
#LAIRE !NCELIN EDS 4mLmMATIQUE 0ROMENADES DANS LES 5SAGES 0ARIS ,A $OCUMENTATION &RANCAISE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW du Parano,” “SM,” “Sextelµ´3LQNµPHVVDJLQJEHFDPHIDPRXVIRUVSLF\
SVHXGRQRQ\PRXV FRQYHUVDWLRQV LQ ZKLFK XVHUV VRXJKW OLNHPLQGHG DFquaintances for conversation or encounters.
2QFH PHVVDJLQJ WRRN RII RQ D QDWLRQDO VFDOH VPDOO WHOHPDWLF ÀUPV
UHZRUNHG 7HOHWHO LQWR D FRPPXQLFDWLRQ PHGLXP 7KH\ GHVLJQHG SURJUDPVWRPDQDJHODUJHQXPEHUVRIVLPXOWDQHRXVXVHUVHPLWWLQJDVZHOO
DVUHFHLYLQJLQIRUPDWLRQDQGWKH\LQYHQWHGDQHZW\SHRILQWHUIDFH2Q
HQWHULQJWKHVHV\VWHPVXVHUVDUHLPPHGLDWHO\DVNHGWRFKRRVHDSVHXGRQ\PDQGWRÀOORXWDEULHI&9FXUULFXOXPYLWDHRUcarte de visite7KH\
DUHWKHQLQYLWHGWRVXUYH\WKH&9·VRIWKRVHFXUUHQWO\RQOLQHWRLGHQWLI\
OLNHPLQGHGFRQYHUVDWLRQDOSDUWQHUV7KHSURJUDPVHPSOR\WKH0LQLWHO·V
JUDSKLFFDSDELOLWLHVWRVSOLWWKHVFUHHQDVVLJQLQJHDFKRIDVPDQ\DVDKDOI
GR]HQFRPPXQLFDWRUVDVHSDUDWHVSDFHIRUWKHLUPHVVDJHV7KLVLVZKHUH
WKHFUHDWLYHHQHUJLHVDZDNHQHGE\WHOHPDWLFVZHQWLQ)UDQFHDQGQRWLQWR
meeting obscure technical challenges dear to the hearts of government buUHDXFUDWVVXFKDVLQVXULQJ)UHQFKLQÁXHQFHRQWKHVKDSHRIWKHHPHUJLQJ
international market in data bases18.
The original plans for Teletel had not quite excluded human commuQLFDWLRQEXWWKH\FHUWDLQO\XQGHUHVWLPDWHGLWVLPSRUWDQFHUHODWLYHWRWKH
dissemination of data, on-line transactions, and even video games19. MesVDJLQJ LV KDUGO\ PHQWLRQHG LQ HDUO\ RIÀFLDO GRFXPHQWV RQ WHOHPDWLFV.
7KHÀUVWH[SHULPHQWZLWK7HOHWHODW9pOL]\UHYHDOHGDQXQH[SHFWHGHQWKXVLDVPIRUFRPPXQLFDWLRQ2ULJLQDOO\FRQFHLYHGDVDIHHGEDFNPHFKDQLVP
OLQNLQJXVHUVWRWKH9pOL]\SURMHFWWHDPWKHPHVVDJLQJV\VWHPZDVVRRQ
transformed into a general space for free discussion. Even after this exSHULHQFHQRRQHLPDJLQHGWKDWKXPDQFRPPXQLFDWLRQZRXOGSOD\DPDMRU
UROHLQDPDWXUHV\VWHP%XWWKDWLVSUHFLVHO\ZKDWKDSSHQHG
,QWKHVXPPHURIWKHYROXPHRIWUDIÀFRQ7UDQVSDFWKH)UHQFK
SDFNHWVZLWFKLQJQHWZRUNH[FHHGHGLWVFDSDFLWLHVDQGWKHV\VWHPFUDVKHG
7KHSURXGFKDPSLRQRI)UHQFKKLJKWHFKZDVEURXJKWWRLWVNQHHVDVEDQNV
DQG JRYHUQPHQW DJHQFLHV ZHUH EXPSHG RIIOLQH E\ KXQGUHGV RI WKRXsands of users skipping from one messaging service to another in search
RIDPXVHPHQW7KLVZDVWKHXOWLPDWHGHPRQVWUDWLRQRIWKHQHZWHOHPDWLF
3IMON .ORA AND !LAIN -INC ,´INFORMATISATION¨ OP CIT P -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P (ENRI 0IGEAT ET ALII $U 4mLmPHONE g LA 4mLmMATIQUE 0ARIS #OMMISSARIAT 'mNmRAL !U 0LAN *EAN-ARIE #HARON AND %DDY #HERKY ,E 6IDmOTEX 5N .OUVEAU -mDIA ,OCAL %NQUoTE SUR L´%XPERIMENTATION DE
6mLIZY 0ARIS #ENTRE D´%TUDE DES -OUVEMENTS 3OCIAUX P -ARIE -ARCHAND ,A 'RANDE !VENTURE¨
OP CIT P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX dispensation$OWKRXJKRQO\DPLQRULW\RIXVHUVZHUHLQYROYHGE\
RIWKHKRXUVRIGRPHVWLFWUDIÀFZHUHVSHQWRQPHVVDJLQJ.
´3LQNµPHVVDJLQJPD\VHHPDWULYLDOUHVXOWRIDJHQHUDWLRQRIVSHFXODtion on the information age, but the case can be made for a more positive
HYDOXDWLRQ0RVWLPSRUWDQWO\WKHVXFFHVVRIPHVVDJLQJFKDQJHGWKHJHQHUDOO\UHFHLYHGimaginaireRIWHOHPDWLFVDZD\IURPLQIRUPDWLRQWRZDUG
communication7KLVLQWXUQHQFRXUDJHGDQGSDLGIRUDZLGHYDULHW\
RIH[SHULPHQWVLQGRPDLQVVXFKDVHGXFDWLRQKHDOWKDQGQHZV+HUHDUH
VRPHH[DPSOHV
WHOHYLVLRQSURJUDPVRIIHUHGVHUYLFHVWKURXJKZKLFKYLHZHUVREWDLQHG
VXSSOHPHQWDU\LQIRUPDWLRQRUH[FKDQJHGRSLQLRQVDGGLQJDQLQWHUDFWLYH
HOHPHQWWRWKHRQHZD\EURDGFDVW
SROLWLFLDQVHQJDJHGLQGLDORJXHZLWKFRQVWLWXHQWVDQGSROLWLFDOPRYHPHQWVRSHQHGPHVVDJLQJVHUYLFHVWRFRPPXQLFDWHZLWKWKHLUPHPEHUV
* educational experiments brought students and teachers together for
electronic classes and tutoring, for example at a Paris Medical School;
D SV\FKRORJLFDO VHUYLFH RIIHUHG DQ RSSRUWXQLW\ WR GLVFXVV SHUVRQDO
SUREOHPVDQRQ\PRXVO\DQGVHHNDGYLFH
3HUKDSV WKH PRVW LQWHUHVWLQJ H[SHULPHQW RFFXUUHG LQ ZKHQ D
QDWLRQDOVWXGHQWVWULNHZDVFRRUGLQDWHGRQWKHPHVVDJLQJVHUYLFHRIWKH
QHZVSDSHU Libération. The service offered information about issues and
DFWLRQVRQOLQHGLVFXVVLRQJURXSVKRXUO\QHZVXSGDWHVDQGDJDPHPRFNLQJWKH0LQLVWHURI(GXFDWLRQ,WTXLFNO\UHFHLYHGPHVVDJHVIURPDOO
RYHUWKHFRXQWU\7KLVPXVWEHRQHRIWKHÀUVWLIQRWWKHÀUVWDSSOLFDWLRQ
RIHOHFWURQLFQHWZRUNLQJWRSXEOLFSURWHVW
These applications revealed the unsuspected potential of CMC for
FUHDWLQJ VXUSULVLQJ QHZ IRUPV RI VRFLDELOLW\ 5DWKHU WKDQ LPLWDWLQJ WKH
WHOHSKRQH RU ZULWLQJ WKH\ SOD\ RQ WKH XQLTXH FDSDFLW\ RI WHOHPDWLFV WR
PHGLDWHKLJKO\SHUVRQDODQGRIWHQDQRQ\PRXVFRPPXQLFDWLRQ7KHVHH[SHULPHQWVSUHÀJXUHGDYHU\GLIIHUHQWRUJDQL]DWLRQRISXEOLFDQGSULYDWH
OLIHLQDGYDQFHGVRFLHWLHVWKHIXOOH[WHQWRIZKLFKEHJLQVWREHYLVLEOHZLWK
:HE.
-ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P * , #HABROL AND 0 0ERIN 5SAGES ET 5SAGERS DU 6IDmOTEX ,ES 0RATIQUES $OMESTIQUES DU VIDmOTEX EN 0ARIS
$'4 P &OR THE CONCEPT OF IMAGINAIRE TECHNIQUE SEE 0ATRICE &LICHY 5NDERSTANDING 4ECHNOLOGICAL )NNOVATION ! 3OCIO
4ECHNICAL !PPROACH #AMBRIDGE -ASS -)4 0RESS -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT #ATHERINE "IDOU -ARC 'UILLAUME 6mRONIQUE 0RmVOST ,´/RDI
NAIRE DE LA 4mLmMATIQUE /FFRE ET USAGES DES SERVICES UTILITAIRES GRANDPUBLIC 0ARIS %DITIONS DE L´)RIS -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P !NDREW &EENBERG ±! 5SER´S 'UIDE TO THE 0RAGMATICS OF #OMPUTER -EDIATED #OMMUNICATION² IN 3EMIOTICA
P *OSIANE *OUpT 0ATRICE &LICHY AND 0AUL "EAUD EDS %UROPEAN 4ELEMATICS 4HE %MERGING
%CONOMY OF 7ORDS TRANS $AVID ,YTEL !MSTERDAM %LSEVIER 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW 4HE 3YSTEM
$OWKRXJKQRRQHSODQQHGDOOLWVHOHPHQWVLQDGYDQFHHYHQWXDOO\DFRKHUHQWV\VWHPHPHUJHGIURPWKHSOD\RIWKHVHYDULRXVIRUFHV&RPSRVHG
RIUDWKHURUGLQDU\HOHPHQWVLWIRUPHGDXQLTXHZKROHWKDWÀQDOO\EURNH
WKHEDUULHUVWRJHQHUDOSXEOLFDFFHSWDQFHRI&0&7KHV\VWHPZDVFKDUDFWHUL]HGE\ÀYHEDVLFSULQFLSOHV
1. Scale2QO\DJRYHUQPHQWRUDJLDQWFRUSRUDWLRQKDVWKHPHDQVWRLQLtiate an experiment such as Teletel on a large enough scale to insure a fair
WHVWRIWKHV\VWHP6PDOOHUSLORWSURMHFWVDOOIRXQGHUHGRQDFKLFNHQDQG
HJJGLOHPPDWREXLOGDPDUNHWLQVHUYLFHVRQHQHHGVXVHUVEXWXVHUVFDQQRWEHDWWUDFWHGZLWKRXWDPDUNHWLQVHUYLFHV7KHVROXWLRQGHPRQVWUDWHG
LQ)UDQFHZDVWRPDNHDKXJHLQLWLDOLQYHVWPHQWLQWUDQVPLVVLRQIDFLOLWLHV
DQGWHUPLQDOVLQRUGHUWRDWWUDFWHQRXJKXVHUVDWDQHDUO\VWDJHWRMXVWLI\
the existence of a critical mass of services.
Gratuity3HUKDSVWKHVLQJOHPRVWUHYROXWLRQDU\IHDWXUHRIWKHV\VWHP
ZDVWKHIUHHGLVWULEXWLRQRIWHUPLQDOV7KHSDFNHWVZLWFKLQJQHWZRUNDQG
WKHWHUPLQDOVZHUHWUHDWHGDVDVLQJOHZKROHLQFRQWUDGLVWLQFWLRQWRHYHU\
RWKHUQDWLRQDOFRPSXWHUQHWZRUN*UDWXLW\GLFWDWHGZLVHGHFLVLRQVDERXW
WHUPLQDOTXDOLW\7KHHPSKDVLVZDVRQGXUDELOLW\DQGVLPSOHJUDSKLFVDQG
LQWHUIDFH,WDOVRLQVXUHGVHUYLFHSURYLGHUVDODUJHEDVHWRZRUNIURPYHU\
HDUO\RQORQJEHIRUHWKHSXEOLFZRXOGKDYHSHUFHLYHGWKHLQWHUHVWRIWKH
XQIDPLOLDUV\VWHPDQGLQYHVWHGLQDFRVWO\WHUPLQDORUVXEVFULSWLRQ
3. Standardization7KHPRQRSRO\SRVLWLRQRIWKH)UHQFKWHOHSKRQHFRPSDQ\DQGWKHIUHHGLVWULEXWLRQRI0LQLWHO WHUPLQDOVLQVXUHGXQLIRUPLW\LQ
several vital areas. Equipment and sign-on procedures are standardized,
DQGDVLPSOHQDYLJDWLRQDOLQWHUIDFHUHVHPEOLQJDZHEEURZVHULVEXLOWLQWR
WKHWHUPLQDONH\ERDUG0RVWVHUYLFHLVRIIHUHGIURPDVLQJOHQDWLRQDOSKRQHQXPEHUDWDVLQJOHSULFHLQGHSHQGHQWRIORFDWLRQ7KHSKRQHFRPSDQ\
HPSOR\VLWVELOOLQJV\VWHPWRFROOHFWDOOFKDUJHVVKDULQJWKHLQFRPHZLWK
service providers.
Liberalism7KHGHFLVLRQWRPDNHLWHDV\WRKRRNXSKRVWFRPSXWHUVWR
WKHSDFNHWVZLWFKLQJQHWZRUNPXVWKDYHJRQHDJDLQVWWKHWHOHSKRQHFRPSDQ\·VLQJUDLQHGKDELWRIFRQWUROOLQJHYHU\DVSHFWRILWVWHFKQLFDOV\VWHP
+RZHYHURQFHWKLVGHFLVLRQZDVPDGHLWRSHQHGWKHGRRUVWRDUHPDUNDEOHÁRZHULQJRIVRFLDOFUHDWLYLW\$OWKRXJKWKH0LQLWHO ZDVGHVLJQHGSULPDULO\IRULQIRUPDWLRQUHWULHYDOLWFDQEHXVHGIRUPDQ\RWKHUSXUSRVHV
7KHVXFFHVVRIWKHV\VWHPRZHVDJUHDWGHDOWRWKHPDWLQJRIDIUHHPDUNHW
LQVHUYLFHVZLWKWKHÁH[LEOHWHUPLQDO
4HE ALTERNATIVE SOLUTION OF SLOW NATURAL GROWTH THAT BUILT THE )NTERNET REQUIRED FAR MORE POWERFUL COMPU
TERS THAN WERE AVAILABLE AT REASONABLE COST IN THE EARLY YEARS OF 4ELETEL
# DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX Identity7KHV\VWHPDFTXLUHGDSXEOLFLPDJHWKURXJKLWVLGHQWLÀFDWLRQZLWKDSURMHFWRIPRGHUQL]DWLRQDQGWKURXJKWKHPDVVLYHGLVWULEXWLRQ
RIGLVWLQFWLYHWHUPLQDOV$XQLTXHWHOHPDWLFLPDJHZDVDOVRVKDSHGE\WKH
VSHFLDOSKRQHGLUHFWRU\WKHJUDSKLFVW\OHDVVRFLDWHGZLWK7HOHWHO·VDOSKDmosaic standard, the adoption of videotex screen management instead of
VFUROOLQJGLVSOD\VDQGWKHVRFLDOSKHQRPHQRQRIWKH´SLQNµPHVVDJLQJ
4(% #/.&,)#4 /& #/$%3
This interpretation of Teletel contradicts the deterministic assumptions
DERXWWKHVRFLDOLPSDFWRIFRPSXWHUVWKDWLQVSLUHG1RUD0LQFDQGPDQ\
RWKHU WKHRULVWV RI SRVWLQGXVWULDOLVP 7KH ORJLF RI WHFKQRORJ\ VLPSO\ GLG
not dictate a neat solution to the problem of modernization; instead, a
YHU\PHVV\SURFHVVRIFRQÁLFWQHJRWLDWLRQDQGLQQRYDWLRQSURGXFHGDVRFLDOO\FRQWLQJHQWUHVXOW:KDWZHUHWKHVHVRFLDOIDFWRUVDQGKRZGLGWKH\
LQÁXHQFHWKHGHYHORSPHQWRI&0&LQ)UDQFH"
3OCIAL #ONSTRUCTIVISM
Teletel’s HYROXWLRQ FRQÀUPV WKH VRFLDO FRQVWUXFWLYLVW DSSURDFK LQWURduced in previous chapters of our book. Unlike determinism, social
FRQVWUXFWLYLVPGRHVQRWH[SODLQWKHVXFFHVVRIDQDUWLIDFWE\LWVWHFKQLFDO
FKDUDFWHULVWLFV$FFRUGLQJWRWKH´SULQFLSOHRIV\PPHWU\µWKHUHDUHDOZD\V
alternatives that might have been developed in the place of the successful
RQH:KDWVLQJOHVRXWDQDUWLIDFWLVQRWVRPHLQWULQVLFSURSHUW\VXFKDV´HIÀFLHQF\µRU´HIIHFWLYHQHVVµEXWLWVUHODWLRQVKLSWRWKHVRFLDOHQYLURQPHQW
$VZHKDYHVHHQLQWKHFDVHRIYLGHRWH[WKDWUHODWLRQVKLSLVQHJRWLDWHGDPRQJLQYHQWRUVFLYLOVHUYDQWVEXVLQHVVPHQFRQVXPHUVDQGPDQ\
RWKHUVRFLDOJURXSVLQDSURFHVVWKDWXOWLPDWHO\GHÀQHVDVSHFLÀFSURGXFW
DGDSWHGWRDVSHFLÀFPL[RIVRFLDOGHPDQGV7KLVSURFHVVLVFDOOHG´FORsure;” it produces a stable “black box,” an artifact that can be treated as a
ÀQLVKHGZKROH%HIRUHDQHZWHFKQRORJ\DFKLHYHVFORVXUHLWVVRFLDOFKDUDFWHULVHYLGHQWEXWRQFHLWLVZHOOHVWDEOLVKHGLWVGHYHORSPHQWDSSHDUV
SXUHO\ WHFKQLFDO HYHQ LQHYLWDEOH WR D QDLYH EDFNZDUG JODQFH 7\SLFDOO\
ODWHUREVHUYHUVIRUJHWWKHRULJLQDODPELJXLW\RIWKHVLWXDWLRQLQZKLFKWKH
´EODFNER[µZDVÀUVWFORVHG30.
3EE !NDREW &EENBERG "ETWEEN 2EASON AND %XPERIENCE %SSAY IN 4ECHNOLOGY AND -ODERNITY #AMBRIDGE -ASS
-)4 0RESS "RUNO ,ATOUR 3CIENCE IN !CTION #AMBRIDGE -ASS (ARVARD 5NIVERSITY 0RESS P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW 7KLVDSSURDFKKDVVHYHUDOLPSOLFDWLRQVIRUYLGHRWH[
)LUVWWKHGHVLJQRIDV\VWHPOLNH7HOHWHO LVQRWGHWHUPLQHGE\DXQLYHUVDOFULWHULRQRIHIÀFLHQF\EXWE\DVRFLDOSURFHVVWKDWMXGJHVWHFKQLFDO
DOWHUQDWLYHVDFFRUGLQJWRDYDULHW\RIFULWHULD
6HFRQGWKDWVRFLDOSURFHVVLVQRWDERXWWKHDSSOLFDWLRQRIDSUHGHÀQHG
YLGHRWH[WHFKQRORJ\EXWFRQFHUQVWKHYHU\GHÀQLWLRQRIYLGHRWH[DQGWKH
QDWXUHRIWKHSUREOHPVWRZKLFKLWLVDGGUHVVHG
7KLUGFRPSHWLQJGHÀQLWLRQVUHÁHFWFRQÁLFWLQJVRFLDOYLVLRQVRIPRGHUQVRFLHW\FRQFUHWL]HGLQGLIIHUHQWWHFKQLFDOFKRLFHV
)RXUWKQHZVRFLDOJURXSVDQGFDWHJRULHVHPHUJHDURXQGWKHDSSURSULDWLRQRIQHZWHFKQRORJ\RUUHVLVWDQFHWRLWVLPSDFWVOHDGLQJWRGHVLJQ
changes.
7KHVH IRXU SRLQWV LQGLFDWH WKH QHHG IRU D UHYROXWLRQ LQ WKH VWXG\ RI
WHFKQRORJ\7KHÀUVWSRLQWZLGHQVWKHUDQJHRIVRFLDOFRQÁLFWWRLQFOXGH
WHFKQLFDOLVVXHVZKLFKW\SLFDOO\KDYHEHHQWUHDWHGDVWKHREMHFWRIDSXUHO\´UDWLRQDOµFRQVHQVXV7KHQH[WWZRSRLQWVLPSO\WKDWPHDQLQJVHQWHU
KLVWRU\DVHIIHFWLYHIRUFHVQRWRQO\WKURXJKFXOWXUDOSURGXFWLRQDQGSRlitical action, but also in the technical sphere. Understanding the social
SHUFHSWLRQRUGHÀQLWLRQRIDWHFKQRORJ\UHTXLUHVDKHUPHQHXWLFRIWHFKQLFDOREMHFWV7KHODVWSRLQWLQWURGXFHVWKHFRFRQVWUXFWLRQRIVRFLHW\DQG
WHFKQRORJ\
7HFKQRORJLHVDUHPHDQLQJIXOREMHFWV)URPRXUHYHU\GD\FRPPRQVHQVHVWDQGSRLQWWZRW\SHVRIPHDQLQJVDWWDFKWRWKHP,QWKHÀUVWSODFHWKH\
KDYHDIXQFWLRQDQGIRUPRVWSXUSRVHVWKHLUPHDQLQJLVLGHQWLFDOZLWKWKDW
IXQFWLRQ+RZHYHUZHDOVRUHFRJQL]HDSHQXPEUDRI´FRQQRWDWLRQVµWKDW
DVVRFLDWHWHFKQLFDOREMHFWVZLWKRWKHUDVSHFWVRIVRFLDOOLIHLQGHSHQGHQWRI
function31 7KXV DXWRPRELOHV DUH PHDQV RI WUDQVSRUWDWLRQ EXW WKH\ DOVR
VLJQLI\WKHRZQHUDVPRUHRUOHVVUHVSHFWDEOHZHDOWK\VH[\HWF
,Q WKH FDVH RI ZHOO HVWDEOLVKHG WHFKQRORJLHV WKH GLVWLQFWLRQ EHWZHHQ
IXQFWLRQDQGFRQQRWDWLRQLVXVXDOO\FOHDU7KHUHLVDWHQGHQF\WRSURMHFW
WKLVFODULW\EDFNLQWRWKHSDVWDQGWRLPDJLQHWKDWWKHWHFKQLFDOIXQFWLRQ
preceded the object and called it into being. The social constructivist proJUDP DUJXHV RQ WKH FRQWUDU\ WKDW WHFKQLFDO IXQFWLRQV DUH QRW SUHJLYHQ
but are discovered in the course of the development and use of the object.
*UDGXDOO\ FHUWDLQ IXQFWLRQV DUH ORFNHG LQ E\ WKH HYROXWLRQ RI WKH VRFLDO
and technical environment. For example the transportation functions of
WKHDXWRPRELOHKDYHEHHQLQVWLWXWLRQDOL]HGLQORZGHQVLW\XUEDQGHVLJQV
WKDWFUHDWHWKHGHPDQGDXWRPRELOHVVDWLVI\&ORVXUHWKXVGHSHQGVLQSDUW
RQEXLOGLQJWLJKWFRQQHFWLRQVLQDODUJHUWHFKQLFDOQHWZRUNLH´V\VWHPLzations.”
*EAN "AUDRILLARD ,E 3YSTnME DES /BJETS 0ARIS 'ALLIMARD P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX ,Q WKH FDVH RI QHZ WHFKQRORJLHV WKHUH LV RIWHQ QR FOHDU GHÀQLWLRQ RI
IXQFWLRQ DW ÀUVW$V D UHVXOW WKHUH LV QR FOHDU GLVWLQFWLRQ EHWZHHQ GLIIHUHQWW\SHVRIPHDQLQJVDVVRFLDWHGZLWKWKHWHFKQRORJ\5HFDOO3LQFKDQG
%LMNHU·VH[DPSOHRIWKHELF\FOHGLVFXVVHGLQFKDSWHURQH&RQQRWDWLRQVRI
RQHGHVLJQPD\ EH IXQFWLRQV YLHZHG IURP WKH DQJOH RI WKH RWKHU 7KHVH
DPELJXLWLHVDUHQRWPHUHO\FRQFHSWXDOLIWKHGHYLFHLVQRW\HW´FORVHGµDQG
QRLQVWLWXWLRQDOORFNLQWLHVLWGHFLVLYHO\WRRQHRILWVVHYHUDOXVHV7KXVDPELJXLWLHVLQWKHGHÀQLWLRQRIDQHZWHFKQRORJ\PXVWEHUHVROYHGWKURXJK
WHFKQLFDO GHYHORSPHQW LWVHOI 'HVLJQHUV SXUFKDVHUV DQG XVHUV DOO SOD\ D
UROHLQWKHSURFHVVE\ZKLFKWKHPHDQLQJRIDQHZWHFKQRORJ\LVÀQDOO\
À[HG.
7HFKQRORJLFDO FORVXUH LV HYHQWXDOO\ FRQVROLGDWHG LQ D WHFKQLFDO FRGH
7HFKQLFDOFRGHVGHÀQHWKHREMHFWLQVWULFWO\WHFKQLFDOWHUPVLQDFFRUGDQFH
ZLWKWKHVRFLDOPHDQLQJVLWKDVDFTXLUHG)RUELF\FOHVWKLVZDVDFKLHYHG
LQWKHV$ELF\FOHVDIHIRUWUDQVSRUWDWLRQFRXOGRQO\EHSURGXFHGLQ
FRQIRUPLW\ ZLWK D FRGH GLFWDWLQJ D VHDW SRVLWLRQHG ZHOO EHKLQG D VPDOO
IURQWZKHHO:KHQFRQVXPHUVHQFRXQWHUHGDELF\FOHSURGXFHGDFFRUGLQJ
WRWKLVFRGHWKH\LPPHGLDWHO\UHFRJQL]HGLWIRUZKDWLWZDVD´VDIHW\µLQ
WKHWHUPLQRORJ\RIWKHGD\7KDWGHÀQLWLRQLQWXUQFRQQRWHGZRPHQDQG
ROGHUULGHUVWULSVWRWKHJURFHU\VWRUHDQGVRRQDQGQHJDWHGDVVRFLDWLRQV
ZLWK\RXQJVSRUWVPDQRXWIRUDWKULOO
7HFKQLFDOFRGHVDUHLQWHUSUHWHGZLWKWKHVDPHKHUPHQHXWLFSURFHGXUHV
XVHGWRLQWHUSUHWWH[WVZRUNVRIDUWDQGVRFLDODFWLRQV33. But the task gets
FRPSOLFDWHGZKHQFRGHVEHFRPHWKHVWDNHVLQVLJQLÀFDQWVRFLDOGLVSXWHV
7KHQLGHRORJLFDOYLVLRQVDUHVHGLPHQWHGLQGHVLJQ,WLVWKLVZKLFKH[SODLQV
WKH´LVRPRUSKLVPWKHIRUPDOFRQJUXHQFHEHWZHHQWKHWHFKQLFDOORJLFVRI
WKHDSSDUDWXVDQGWKHVRFLDOORJLFVZLWKLQZKLFKLWLVGLIIXVHGµ (Bidou, et
DO7KHVHSDWWHUQVRIFRQJUXHQFHH[SODLQWKHLPSDFWRIWKHODUJHU
socio-cultural environment on the mechanisms of closure. Videotex is a
VWULNLQJFDVHLQSRLQW,QZKDWIROORZVZHZLOOWUDFHWKHSDWWHUQIURPWKH
PDFUROHYHORIZRUOGYLHZVGRZQWRWKHGHWDLOVRIWHFKQLFDOGHVLJQ
! 4ECHNOCRATIC 5TOPIA
7KHLVVXHLQWKLVFDVHLVWKHYHU\QDWXUHRIDSRVWLQGXVWULDOVRFLHW\7KH
LQIRUPDWLRQDJHZDVRULJLQDOO\FRQFHLYHGDVDVFLHQWL]HGVRFLHW\DYLVLRQ
.ELLY /UDSHOORN AND 4REVOR 0INCH (OW 5SERS -ATTER THE COCONSTRUCTION OF USERS AND TECHNOLOGY #AMBRIDGE
-ASS -)4 0RESS 0AUL 2ICOEUR ±4HE -ODEL OF THE 4EXT -EANINGFUL !CTION #ONSIDERED AS A 4EXT² IN 0AUL 2ABINOW AND 7ILLIAM
- 3ULLIVAN EDS )NTERPRETIVE 3OCIAL 3CIENCE ! 2EADER "ERKELEY 5NIVERSITY OF #ALIFORNIA 0RESS #ATHERINE "IDOU -ARC 'UILLAUME 6mRONIQUE 0RmVOST ,´/RDINAIRE DE LA 4mLmMATIQUE¨ OP CIT P 4REVOR 0INCH AND 7IEBE "IJKER±4HE 3OCIAL #ONSTRUCTION OF &ACTS AND !RTEFACTS OR (OW THE 3OCIOLOGY OF 3CIEN
CE AND THE 3OCIOLOGY OF 4ECHNOLOGY MIGHT "ENE½T %ACH /THER² IN 3OCIAL 3TUDIES OF 3CIENCE P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW that legitimated the technocratic ambitions of governments and corporaWLRQV7KHUDWLRQDOLVWLFDVVXPSWLRQVDERXWKXPDQQDWXUHDQGVRFLHW\WKDW
XQGHUOLHWKLVIDQWDV\KDYHEHHQIDPLOLDUIRUDFHQWXU\RUPRUHDVDNLQGRI
positivist utopia.
,WV SULQFLSDO WUDLWV DUH IDPLOLDU 6FLHQWLÀFWHFKQLFDO WKLQNLQJ EHFRPHV
WKHORJLFRIWKHZKROHVRFLDOV\VWHP3ROLWLFVLVPHUHO\DJHQHUDOL]DWLRQRI
the consensual mechanisms of research and development. Individuals are
integrated to the social order not through repression but through prospeULW\7KHLUZHOOEHLQJLVDFKLHYHGWKURXJKWHFKQLFDOPDVWHU\RIWKHSHUVRQDODQGQDWXUDOHQYLURQPHQW3RZHUIUHHGRPDQGKDSSLQHVVDUHWKXVDOO
EDVHGRQNQRZOHGJH
This global vision supports the generalization of the codes and practiFHVDVVRFLDWHGZLWKHQJLQHHULQJDQGPDQDJHPHQW2QHQHHGQRWVKDUHDQ
explicit utopian faith to believe that the professional approaches of these
GLVFLSOLQHVDUHXVHIXORXWVLGHWKHRUJDQL]DWLRQDOFRQWH[WVLQZKLFKWKH\DUH
FXVWRPDULO\DSSOLHG7KHVSUHDGRILGHDVRIVRFLDOHQJLQHHULQJEDVHGRQ
V\VWHPVDQDO\VLVUDWLRQDOFKRLFHWKHRU\ULVNEHQHÀWDQDO\VLVDQGVRRQ
WHVWLÀHVWRWKLVDGYDQFHLQWKHUDWLRQDOL]DWLRQRIVRFLHW\6LPLODUDVVXPSWLRQVLQÁXHQFHGWKHVSRQVRUVRI7HOHWHOQRWVXUSULVLQJO\JLYHQWKHFXOWRI
HQJLQHHULQJLQWKH)UHQFKEXUHDXFUDF\
$W WKH PLFUROHYHO WKHVH DVVXPSWLRQV DUH DW ZRUN LQ WKH WUDGLWLRQDO
FRPSXWHULQWHUIDFHZLWKLWVQHDWPHQXKLHUDUFKLHVFRQVLVWLQJRIRQHZRUG
descriptors of “options.” A logical space consisting of such alternatives
FRUUHODWHVZLWKDQLQGLYLGXDO´XVHUµHQJDJHGLQDSHUVRQDOVWUDWHJ\RIRSWLPL]DWLRQ3URMHFWHGRQWRVRFLHW\DVDZKROHLQWKHIRUPRIDSXEOLFLQIRUPDWLRQVHUYLFHWKLVDSSURDFKLPSOLHVDFHUWDLQZRUOG
,QWKDWZRUOG´IUHHGRPµLVWKHPRUHRUOHVVLQIRUPHGFKRLFHDPRQJ
SUHVHOHFWHGRSWLRQVGHÀQHGE\DXQLYHUVDOLQVWDQFHVXFKDVDWHFKQRFUDWLF
DXWKRULW\7KDWLQVWDQFHFODLPVWREHDQHXWUDOPHGLXPDQGLWVSRZHULV
OHJLWLPDWHGSUHFLVHO\E\LWVWUDQVSDUHQF\WKHGDWDLVDFFXUDWHDQGORJLFDOO\
FODVVLÀHG%XWLWGRHVQRWFHDVHWREHDSRZHUIRUWKDWPDWWHU
,QGLYLGXDOV DUH FDXJKW XS LQ MXVW VXFK D V\VWHP DV WKLV LQ WKHLU LQWHUDFWLRQVZLWKFRUSRUDWHJRYHUQPHQWPHGLFDODQGVFKRODVWLFLQVWLWXWLRQV
Videotex streamlines this technocratic universe. In fact some of the most
successful utilitarian services on Teletel offer information on bureaucratic
UXOHVFDUHHUSODQQLQJRUH[DPLQDWLRQUHVXOWV7KHVHVHUYLFHVSOD\RQWKH
´DQ[LHW\HIIHFWµRIOLIHLQDUDWLRQDOVRFLHW\LQGLYLGXDOLW\DVDSUREOHPLQ
personal self-management%XWWKHUROHRIDQ[LHW\UHYHDOVWKHGDUNHUVLGH
RIWKLVXWRSLD7KHV\VWHPDSSHDUVWRHPERG\DKLJKHUOHYHORIVRFLDOUDWLRQDOLW\EXWLWLVDQLJKWPDUHRIFRQIXVLQJFRPSOH[LW\DQGDUELWUDULQHVV
#ATHERINE "IDOU -ARC 'UILLAUME 6mRONIQUE 0RmVOST ,´/RDINAIRE DE LA 4mLmMATIQUE¨ OP CIT P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX WRWKRVHZKRVHOLYHVLWVKDSHV7KLVLVWKH´&U\VWDO3DODFHµVRIHDUHGDQG
KDWHGLQ'RVWRLHYVN\·V´XQGHUJURXQGµRU*RGDUG·VAlphavilleZKHUHWKH
computer’s benign rule is the ultimate dehumanizing oppression.
4HE 3PECTRAL 3UBJECT
Teletel ZDV FDXJKW XS LQ D GLVSXWH RYHU ZKLFK VRUW RI SRVWLQGXVWULDO
H[SHULHQFHZRXOGEHSURMHFWHGWHFKQRORJLFDOO\WKURXJKGRPHVWLFFRPSXWLQJ$VZHKDYHVHHQWKHGHÀQLWLRQRILQWHUDFWLYLW\LQWHUPVRIDUDWLRQDOLVWLFWHFKQLFDOFRGHHQFRXQWHUHGLPPHGLDWHUHVLVWDQFHIURPXVHUVZKR
LJQRUHGWKHLQIRUPDWLRQDOSRWHQWLDORIWKHV\VWHPDQGLQVWHDGHPSOR\HGLW
IRUDQRQ\PRXVKXPDQFRPPXQLFDWLRQ
7KHVH XQH[SHFWHG DSSOLFDWLRQV UHYHDOHG DQRWKHU ZKROH GLPHQVLRQ RI
HYHU\GD\H[SHULHQFHLQSRVWLQGXVWULDOVRFLHWLHVPDVNHGE\WKHSRVLWLYLVW
XWRSLD$VWKHJDSEHWZHHQLQGLYLGXDOSHUVRQDQGVRFLDOUROHZLGHQVDQG
LQGLYLGXDOVDUHFDXJKWXSLQWKH´PDVVµVRFLDOOLIHLVLQFUHDVLQJO\UHRUJDQL]HGDURXQGLPSHUVRQDOLQWHUDFWLRQV7KHLQGLYLGXDOVOLSVHDVLO\EHWZHHQ
UROHVDQGLGHQWLÀHVIXOO\ZLWKQRQHRIWKHPIDOOVLQDQGRXWRIYDULRXV
PDVVHV GDLO\ DQG EHORQJV ZKROO\ WR QR FRPPXQLW\ 7KH VROLWXGH RI WKH
´ORQHO\FURZGµFRQVLVWVLQDPXOWLWXGHRIWULYLDODQGDPELJXRXVHQFRXQWHUV7KHVLPSOLÀHGFRGHVRILQWHUDFWLRQLQWKH´V\VWHPµRIIHUIHZSRVVLELOLWLHVRISHUVRQDOVHOIH[SUHVVLRQRUDWWDFKPHQWWRRWKHUV$QRQ\PLW\SOD\V
DFHQWUDOUROHLQWKLVQHZVRFLDOH[SHULHQFHDQGJLYHVULVHWRIDQWDVLHVRI
sex and violence that are represented in mass culture and, to a lesser extent, realized in the individuals’ lives.
-XVWDVYLGHRWH[SHUPLWVWKHLQGLYLGXDOWRSHUVRQDOL]HDQDQRQ\PRXV
TXHU\WRDFDUHHUSODQQLQJDJHQF\RUDJRYHUQPHQWEXUHDXFUDF\VRWKHKLWKHUWRLQDUWLFXODWHUHODWLRQVKLSWRHURWLFWH[WVFDQQRZDFKLHYHSHUVRQDOLW\
HYHQUHFLSURFLW\WKDQNVWRWKH0LQLWHO7KHSULYDF\RIWKHKRPHWDNHVRQ
IXQFWLRQVSUHYLRXVO\DVVLJQHGSXEOLFVSDFHVOLNHEDUVDQGFOXEVEXWZLWK
DQLPSRUWDQWWZLVWWKHEODQNVFUHHQQRWRQO\OLQNVWKHLQWHUORFXWRUVEXW
also shields their identities.
$VZLWKQHZVSDSHU´SHUVRQDOVµLQGLYLGXDOVKDYHWKHLPSUHVVLRQWKDW
the Minitel JLYHVWKHPIXOOFRPPDQGRIDOOWKHVLJQDOVWKH\HPLWXQOLNH
ULVN\IDFHWRIDFHHQFRXQWHUVZKHUHFRQWUROLVXQFHUWDLQDWEHVW(QKDQFHG
FRQWUROWKURXJKZULWWHQVHOISUHVHQWDWLRQPDNHVHODERUDWHLGHQWLW\JDPHV
SRVVLEOH ´,QVWHDG RI LGHQWLW\ KDYLQJ WKH VWDWXV RI DQ LQLWLDO JLYHQ ZLWK
ZKLFKWKHFRPPXQLFDWLRQXVXDOO\EHJLQVLWEHFRPHVDVWDNHDSURGXFW
of the communication”37.
#LAUDE "ALTZ ¦ 'RmTEL 5N .OUVEAU -mDIA DE #OMMUNICATION § IN -ARIE -ARCHAND AND #LAIRE !NCELIN EDS
4mLmMATIQUE 0ROMENADES DANS LES 5SAGES OP CIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW 7KHH[SHULHQFHRISVHXGRQRQ\PRXVFRPPXQLFDWLRQFDOOVWRPLQG(UYLQJ*RIIPDQ·VGRXEOHGHÀQLWLRQRIWKHVHOIDVDQ´LPDJHµRULGHQWLW\DQG
DVD´VDFUHGREMHFWµWRZKLFKFRQVLGHUDWLRQLVGXH´WKHVHOIDVDQLPDJH
SLHFHGWRJHWKHUIURPWKHH[SUHVVLYHLPSOLFDWLRQVRIWKHIXOOÁRZRIHYHQWV
LQDQXQGHUWDNLQJDQGWKHVHOIDVDNLQGRISOD\HULQDULWXDOJDPHZKRFRSHVKRQRUDEO\RUGLVKRQRUDEO\GLSORPDWLFDOO\RUXQGLSORPDWLFDOO\ZLWK
the judgmental contingencies of the situation”38%\LQFUHDVLQJFRQWURORI
LPDJHZKLOHGLPLQLVKLQJWKHULVNRIHPEDUUDVVPHQWPHVVDJLQJDOWHUVWKH
VRFLRORJLFDOUDWLRRIWKHWZRGLPHQVLRQVRIVHOIKRRGDQGRSHQVXSDQHZ
social space.
7KH UHODWLYH GHVDFUDOL]DWLRQ RI WKH VXEMHFW ZHDNHQV VRFLDO FRQWURO ,W
LV GLIÀFXOW WR EULQJ JURXS SUHVVXUH WR EHDU RQ VRPHRQH ZKR FDQQRW VHH
IURZQVRIGLVDSSURYDO&0&WKXVHQKDQFHVWKHVHQVHRISHUVRQDOIUHHGRP
DQGLQGLYLGXDOLVPE\UHGXFLQJWKH´H[LVWHQWLDOµHQJDJHPHQWRIWKHVHOILQ
its communications. “Flaming”--the expression of uncensored emotions
on-line--is a negative consequence of this feeling of liberation. But the alWHUHGVHQVHRIWKHUHDOLW\RIWKHRWKHUPD\DOVRHQKDQFHWKHHURWLFFKDUJH
of the communication39.
0DUF*XLOODXPHKDVLQWURGXFHGWKHFRQFHSWRI´VSHFWUDOLW\µWRGHVFULEH
WKHVHQHZIRUPVRILQWHUDFWLRQEHWZHHQLQGLYLGXDOVZKRDUHUHGXFHGWR
DQRQ\PLW\ LQ PRGHUQ VRFLDO OLIH DQG XVH WKDW DQRQ\PLW\ WR VKHOWHU DQG
assert their identities.
“Teletechnologies, considered as a cultural sphere, respond to a massiYHDQGXQFRQIHVVHGGHVLUHWRHVFDSHSDUWLDOO\DQGPRPHQWDULO\ERWKIURP
WKHV\PEROLFFRQVWUDLQWVZKLFKSHUVLVWLQPRGHUQVRFLHW\DQGIURPWRWDOLWDULDQIXQFWLRQDOLW\7RHVFDSHQRWLQWKHVWLOOULWXDOL]HGIRUPRIWKRVHEULHI
SHULRGVRIFHOHEUDWLRQRUGLVRUGHUSHUPLWWHGE\WUDGLWLRQDOVRFLHWLHVEXW
DWWKHFRQYHQLHQFHRIWKHVXEMHFWZKRSD\VIRUWKLVIUHHGRPE\DORVV+H
becomes a specterLQWKHWULSOHVHQVHRIWKHWHUPKHIDGHVDZD\LQRUGHU
WRZDQGHUIUHHO\OLNHDSKDQWRPLQDV\PEROLFRUGHUZKLFKKDVEHFRPH
transparent to him”.
Social advance appears here not as the spread of technocratic elements
WKURXJKRXWGDLO\OLIHEXWDVWKHJHQHUDOL]DWLRQRIWKHFRPPXWDWLYHORJLF
RIWKHWHOHSKRQHV\VWHP1DWLRQDOFRPSXWHUQHWZRUNVVXFKDV7HOHWHODUH
EDVHGRQWKH;VWDQGDUGZKLFKHQDEOHVKRVWFRPSXWHUVWRVHUYHGLVWDQW
´FOLHQWVµ WKURXJK WKH WHOHSKRQH OLQHV$OWKRXJK VXFK QHWZRUNV FDQ OLQN
DOOWKHLUKRVWVPXFKDVWKHWHOHSKRQHV\VWHPOLQNVDOOVXEVFULEHUVWKDWLV
QRWZKDWWKH\ZHUHRULJLQDOO\GHVLJQHGWRGR5DWKHUWKH\ZHUHVXSSRVHG
%RVING 'OFFMAN )NTERACTION 2ITUAL .EW 9ORK 0ANTHEON P #ATHERINE "IDOU -ARC 'UILLAUME 6mRONIQUE 0RmVOST ,´/RDINAIRE DE LA 4mLmMATIQUE¨ OP CIT P -ARC 'UILLAUME ±4mLmSPECTRES² IN 4RAVERSE P OUR TRANSLATION
# DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX to enable clusters of users to share time on specialized hosts. In the usual
FDVHWKHXVHUVDUHQRWLQFRPPXQLFDWLRQZLWKHDFKRWKHU
Teletel VWDUWHGRXWDVDQRUGLQDU\;QHWZRUNLQZKLFKWKHXVHULVD
SRLQW LQ D VWDU VKDSHG LQWHUDFWLRQ KLHUDUFKLFDOO\ VWUXFWXUHG IURP D FHQWHUWKHKRVWFRPSXWHU%XWLQWKHSUDFWLFHRIWKHV\VWHPWKHXVHUEHFDPH
an agent of general horizontal interconnection7KLVVKLIWV\PEROL]HVWKH
HPHUJHQFHRI´QHWZRUNLQJµDVDQDOWHUQDWLYHWRERWKIRUPDORUJDQL]DWLRQ
DQGWUDGLWLRQDOFRPPXQLW\7KHFRPSXWHUV\VWHPSURYLGHVDSDUWLFXODUO\
IDYRUDEOHHQYLURQPHQWLQZKLFKWRH[SHULPHQWZLWKWKLVQHZVRFLDOIRUP
,Q&0&WKHSUDJPDWLFVRISHUVRQDOHQFRXQWHUDUHUDGLFDOO\VLPSOLÀHG
UHGXFHGLQIDFWWRWKHSURWRFROVRIWHFKQLFDOFRQQHFWLRQ&RUUHVSRQGLQJO\
WKHHDVHRISDVVDJHIURPRQHVRFLDOFRQWDFWWRDQRWKHULVJUHDWO\LQFUHDVHG
DJDLQIROORZLQJWKHORJLFRIFRPPXWDWLRQ´3LQNµPHVVDJLQJLVPHUHO\D
V\PSWRPRIWKLVWUDQVIRUPDWLRQSXQFWXDWLQJDJUDGXDOSURFHVVRIFKDQJH
LQ VRFLHW\ DW ODUJH 7R IXOO\ XQGHUVWDQG WKLV DOWHUQDWLYH LW LV RQFH DJDLQ
useful to look at the technical metaphors that invade social discourse.
$ZKROHUKHWRULFRIOLEHUDWLRQDFFRPSDQLHVWKHJHQHUDOL]HGEUHDNGRZQ
of the last rituals blocking the individuals in the redoubt of the sacred
VHOI3HUVRQDOOLIHEHFRPHVDQDIIDLURIQHWZRUNPDQDJHPHQWDVIDPLO\DQG
RWKHUVWDEOHVWUXFWXUHVFROODSVH7KHQHZSRVWPRGHUQLQGLYLGXDOVDUHGHVcribed as supple, adaptable, capable of staging their personal performanFHVRQPDQ\DQGFKDQJLQJVFHQHVIURPRQHGD\WRWKHQH[W7KHQHWZRUN
PXOWLSOLHV WKH SRZHU RI LWV PHPEHUV E\ MRLQLQJ WKHP LQ WHPSRUDU\ VRFLDOFRQWUDFWVDORQJGLJLWDOSDWKZD\VRIPXWXDOFRQÀGHQFH7KHUHVXOWLV
DSRVWPRGHUQ´DWRPLVDWLRQRIVRFLHW\LQWRÁH[LEOHQHWZRUNVRIODQJXDJH
games”.
7HOHWHOSURIRXQGO\DOWHUHGWKHVSDWLRWHPSRUDOFRRUGLQDWHVRIGDLO\OLIH
DFFHOHUDWLQJ WKH LQGLYLGXDOV EH\RQG WKH VSHHG RI SDSHU ZKLFK ZDV VWLOO
WKH PD[LPXP YHORFLW\ DFKLHYHG E\ VKXIÁLQJ FRUSRUDWH DQG SROLWLFDO GLQRVDXUV8VHUVDFKLHYHGWKHUHE\DUHODWLYHOLEHUDWLRQLI\RXFDQQRWHVFDSH
WKHSRVWLQGXVWULDOQLJKWPDUHRIWRWDODGPLQLVWUDWLRQDWOHDVWPXOWLSO\WKH
number of connections and contacts so that their point of intersection beFRPHVDULFKDQGMXLF\ORFXVRIFKRLFH7REHLVWRFRQQHFW7KXVEHJLQVWKH
VWUXJJOHRYHUWKHGHÀQLWLRQRIWKHSRVWLQGXVWULDODJH
-ARC 'UILLAUME ,A #ONTAGION DES 0ASSIONS 0ARIS 0LON P *EAN&RANlOIS ,YOTARD ,A #ONDITION 0OSTMODERNE 0ARIS %DITIONS DE -INUIT P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW 4(% 3/#)!, #/.3425#4)/. /& 4(% -).)4%,
The peculiar compromise that made Teletel DVXFFHVVZDVWKHUHVXOWDQW
of these forces in tension. I have traced the terms of that compromise at
WKHPDFUROHYHORIWKHVRFLDOGHÀQLWLRQRIYLGHRWH[LQ)UDQFHEXWLWVLPSULQW
FDQDOVREHLGHQWLÀHGLQWKHWHFKQLFDOFRGHRIWKHV\VWHPLQWHUIDFH
7IRING THE "OURGEOIS )NTERIOR
7KH0LQLWHOLVDVHQVLWLYHLQGH[RIWKHVHWHQVLRQV7KRVHFKDUJHGZLWK
GHVLJQLQJ LW IHDUHG SXEOLF UHMHFWLRQ RI DQ\WKLQJ UHVHPEOLQJ D FRPSXWHU
W\SHZULWHURURWKHUSURIHVVLRQDODSSDUDWXVDQGZRUNHGWRÀWLWLQWRWKH
GRPHVWLFHQYLURQPHQW7KH\FDUHIXOO\FRQVLGHUHGWKH´VRFLDOIDFWRUVµDV
ZHOO DV WKH KXPDQ IDFWRUV LQYROYHG LQ SHUVXDGLQJ PLOOLRQV RI RUGLQDU\
people to admit a terminal into their home.
7KLVLVDGHVLJQSUREOHPZLWKDORQJDQGLQWHUHVWLQJKLVWRU\,WVSUHVXSSRVLWLRQLVWKHVHSDUDWLRQRISXEOLFDQGSULYDWHZRUNDQGKRPHZKLFK
EHJLQVDFFRUGLQJWR:DOWHU%HQMDPLQXQGHUWKH-XO\0RQDUFK\
´)RU WKH SULYDWH SHUVRQ OLYLQJ VSDFH EHFRPHV IRU WKH ÀUVW WLPH DQWLWKHWLFDOWRWKHSODFHRIZRUN7KHIRUPHULVFRQVWLWXWHGE\WKHLQWHULRU
WKHRIÀFHLVLWVFRPSOHPHQW7KHSULYDWHSHUVRQZKRVTXDUHVKLVDFFRXQWV
ZLWKUHDOLW\ LQKLV RIÀFH GHPDQGV WKDW WKH LQWHULRU EH PDLQWDLQHG LQ KLV
illusions”.
7KHKLVWRU\RIGHVLJQVKRZVWKHVHLQWLPDWHLOOXVLRQVJUDGXDOO\VKDSHG
E\LPDJHVGUDZQIURPWKHSXEOLFVSKHUHWKURXJKWKHVWHDG\LQYDVLRQRI
SULYDWH VSDFH E\ SXEOLF DFWLYLWLHV DQG DUWLIDFWV (YHU\WKLQJ IURP JDV OLghting to the use of chrome in furniture begins life in the public domain
DQGJUDGXDOO\SHQHWUDWHVWKHKRPH.The telephone and the electronic meGLDLQWHQVLI\WKHSHQHWUDWLRQE\GHFLVLYHO\VKLIWLQJWKHERXQGDULHVEHWZHHQ
the public and the private sphere.
7KHÀQDOGLVDSSHDUDQFHRIZKDW%HQMDPLQFDOOVWKH´ERXUJHRLVLQWHULRUµ
DZDLWVWKHJHQHUDOL]DWLRQRILQWHUDFWLYLW\7KHQHZFRPPXQLFDWLRQVWHFKnologies promise to attenuate and perhaps even to dissolve the distinction
EHWZHHQWKHGRPHVWLFDQGWKHSXEOLFVSKHUH7HOHZRUNDQGWHOHPDUNHWLQJ
DUHH[SHFWHGWRFROODSVHWKHWZRZRUOGVLQWRRQH´7KHKRPHFDQQRORQJHU
!NDREW &EENBERG ¦ 4HE 7RITTEN 7ORLD § IN !NTHONY +AYE AND 2OBIN -ASON EDS -INDWEAVE #OMMUNICA
TION #OMPUTERS AND $ISTANCE %DUCATION /XFORD 0ERGAMON 0RESS P 7ALTER "ENJAMIN±0ARIS #APITAL OF THE .INETEENTH #ENTURY² IN 2E¾ECTIONS TRANS %DMUND *EPHCOTT .EW 9ORK
(ARCOURT "RACE *OVANOVICH P 7OLFGANG 3CHIVELBUSCH $ISENCHANTED ,IGHT "ERKELEY 5NIVERSITY OF #ALIFORNIA 0RESS !DRIAN &ORTY /BJECTS
OF $ESIRE .EW 9ORK 0ANTHEON CHAP # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX pretend to remain the place of private life, privileging non-economic relaWLRQVDXWRQRPRXVZLWKUHVSHFWWRWKHFRPPHUFLDOZRUOGµ.
The Minitel is a tool for accomplishing this ultimate deterritorializaWLRQ,WVPRGHVWGHVLJQLVDFRPSURPLVHRQWKHZD\WRZDUGDUDGLFDOO\GLIIHUHQWW\SHRILQWHULRU(DUOLHUYLGHRWH[V\VWHPVKDGHPSOR\HGYHU\HODERrate and expensive dedicated terminals, television adapters, or computers
HTXLSSHGZLWKPRGHPV,QWKH86GRPHVWLF&0&ZDVFRPSXWHUEDVHG,WV
VSUHDGKDGWRDZDLWWKHJHQHUDOL]DWLRQRIFRPSXWHURZQHUVKLS8QWLOWKHQ
LWZDVODUJHO\FRQÀQHGWRDKREE\LVWVXEFXOWXUH1RGHVLJQSULQFLSOHVIRU
WKH0LQLWHOFRXOGEHOHDUQHGIURPWKHVHKREE\LVWVZKRZHUHQRWERWKHUHG
E\WKHLQFRQJUXRXVDSSHDUDQFHRIDODUJHSLHFHRIHOHFWURQLFHTXLSPHQW
RQWKHEHGURRPGUHVVHURUWKHGLQLQJURRPWDEOH)XQFWLRQDOO\WKH0LQLWHO
is not even a real computer. It is just a “dumb terminal,” that is, a video
VFUHHQ DQG NH\ERDUG ZLWK PLQLPDO PHPRU\ DQG SURFHVVLQJ FDSDELOLWLHV
and a built-in modem. Such devices had been around for decades, priPDULO\IRUXVHE\HQJLQHHUVWRRSHUDWHPDLQIUDPHFRPSXWHUV7KH\ZHUH
JHQHUDOO\ODUJHH[SHQVLYHDQGXJO\2EYLRXVO\WKRVHGHVLJQVZRXOGQRW
TXDOLI\DVDWWUDFWLYHLQWHULRUGHFRUDWLRQ
7KH0LQLWHO·VGHVLJQHUVEURNHZLWKDOOWKHVHSUHFHGHQWVDQGFRQQRWHG
LWDVDQHQKDQFHPHQWRIWKHWHOHSKRQHUDWKHUWKDQDVDFRPSXWHURUDQHZ
kind of television. Disguised as a “cute” telephonic device, the Minitel
ZDVDNLQGRI7URMDQKRUVHIRUUDWLRQDOLVWLFWHFKQLFDOFRGHV
,WLVVPDOOZLWKDNH\ERDUGWKDWFDQEHWLOWHGXSDQGORFNHGWRFRYHUWKH
VFUHHQ$WÀUVWLWZDVHTXLSSHGZLWKDQDOSKDEHWLFDONH\SDGWRGLVWLQJXLVK
LWIURPDW\SHZULWHU7KDWNH\SDGSOHDVHGQHLWKHUQRQW\SLVWVQRUW\SLVWV
DQG ZDV HYHQWXDOO\ UHSODFHG ZLWK D VWDQGDUG RQH KRZHYHU WKH RYHUDOO
look of the Minitel remained unbusinesslike. Most important, it has no
GLVNV DQG GLVN GULYHV WKH RQRII VZLWFK RQ LWV IURQW LV HDV\ WR ÀQG DQG
QRLQWLPLGDWLQJDQGXQVLJKWO\FDEOHVSURWUXGHIURPLWVEDFNEXWMXVWDQ
RUGLQDU\WHOHSKRQHFRUG
The domesticated Minitel terminal adopts a telephonic rather than a
computing approach to its users’ presumed technical capabilities. ComSXWHUSURJUDPVW\SLFDOO\RIIHUDQLPPHQVHDUUD\RIRSWLRQVWUDGLQJRII
HDVHRIXVHIRUSRZHU)XUWKHUPRUHXQWLOWKHVXFFHVVRI:LQGRZVPRVW
programs had such different interfaces that each one required a special
DSSUHQWLFHVKLS$Q\RQH ZKR KDV HYHU XVHG HDUO\ '26 FRPPXQLFDWLRQV
VRIWZDUHZLWKLWVRSHQLQJVFUHHQVIRUVHWWLQJDGR]HQREVFXUHSDUDPHWHUV
-ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P !LAIN 'IRAUD ¦ 5NE ,ENTE %MERGENCE § IN -ARIE -ARCHAND AND #LAIRE !NCELIN EDS 4mLmMATIQUE 0ROMENADES
DANS LES 5SAGES OP CIT P -ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P $ONALD .ORMAN 4HE 0SYCHOLOGY OF %VERYDAY 4HINGS .EW
9ORK "ASIC "OOKS P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW FDQ XQGHUVWDQG MXVW KRZ LQDSSURSULDWH LW ZRXOG EH IRU JHQHUDO GRPHVWLFXVH7KH0LQLWHOGHVLJQHUVNQHZWKHLUFXVWRPHUVZHOODQGRIIHUHGDQ
H[WUHPHO\VLPSOHFRQQHFWLRQSURFHGXUHGLDOXSWKHQXPEHURQWKHWHOHSKRQHOLVWHQIRUWKHFRQQHFWLRQSUHVVDVLQJOHNH\
7KHGHVLJQRIWKHIXQFWLRQNH\VDOVRFRQWULEXWHGWRHDVHRIXVH7KHVH
ZHUHLQWHQGHGWRRSHUDWHWKHHOHFWURQLFWHOHSKRQHGLUHFWRU\$WÀUVWWKHUH
ZDV VRPH GLVFXVVLRQ RI JLYLQJ WKH NH\V KLJKO\ VSHFLÀF QDPHV VXLWHG WR
WKDWSXUSRVHHJ´&LW\µ´6WUHHWµDQGVRRQ,WZDVZLVHO\GHFLGHGLQVWHDGWRDVVLJQWKHIXQFWLRQNH\VJHQHUDOQDPHVVXFKDV´*XLGHµ´1H[W
6FUHHQµ´%DFNµUDWKHUWKDQW\LQJWKHPWRDQ\RQHVHUYLFH. As a result,
WKH NH\ERDUG LPSRVHV D VWDQGDUG QDYLJDWLRQDO XVHU LQWHUIDFH QRW XQOLNH
WKH:RUOG:LGH:HEVRPHWKLQJDFKLHYHGLQWKHFRPSXWLQJZRUOGRQO\
PXFKODWHUZLWKPXFKPRUHHODERUDWHHTXLSPHQW
7KH0LQLWHOWHVWLÀHVWRWKHGHVLJQHUV·RULJLQDOVFHSWLFLVPZLWKUHJDUGWR
FRPPXQLFDWLRQDSSOLFDWLRQVRIWKHV\VWHPWKHIXQFWLRQNH\VDUHGHÀQHG
IRUVFUHHQRULHQWHGLQWHUURJDWLRQRIGDWDEDVHVDQGWKHNH\SDGZLWKLWV
XQVFXOSWXUHGFKLFOHWNH\VLVVRFOXPV\LWGHÀHVDWWHPSWVDWWRXFKW\SLQJ
+HUHWKH)UHQFKSDLGWKHSULFHRIUHO\LQJRQDWHOHSKRQLFPRGHOFDSWLYH
Telecom suppliers ignorant of consumer electronics markets, delivered
D WHOHSKRQHTXDOLW\ NH\SDG EHORZ LQWHUQDWLRQDO VWDQGDUGV IRU HYHQ WKH
FKHDSHVWSRUWDEOHW\SHZULWHU1HHGOHVVWRVD\H[SRUWRIVXFKDWHUPLQDO
ZDVQH[WWRLPSRVVLEOH
!MBIVALENT .ETWORKS
So designed, the Minitel is a paradoxical object. Its telephonic disguise,
WKRXJKWQHFHVVDU\WRLWVVXFFHVVLQWKHKRPHLQWURGXFHVDPELJXLWLHVLQWR
WKHGHÀQLWLRQRIWHOHPDWLFVDQGLQYLWHVFRPPXQLFDWLRQVDSSOLFDWLRQVQRW
DQWLFLSDWHGE\WKHGHVLJQHUV)RUWKHPWKH0LQLWHOZRXOGDOZD\VUHPDLQ
a computer terminal for gathering data, but the domestic telephone, to
ZKLFKWKH0LQLWHOLVDWWDFKHGLVDVRFLDOQRWDQLQIRUPDWLRQDOPHGLXP
7KHRIÀFLDOWHFKQLFDOGHÀQLWLRQRIWKHV\VWHPWKXVHQWHUVLQWRFRQWUDGLFWLRQZLWKWKHWHOHSKRQLFSUDFWLFHVWKDWLPPHGLDWHO\FRORQL]HLWRQFHLWLV
installed in the home.
To the extent that the Minitel did not rule out human communication
DOWRJHWKHUDVKDYHPDQ\YLGHRWH[V\VWHPVLWFRXOGEHVXEYHUWHGIURPLWV
intended purpose despite its limitations. For example, although the ori
-ARIE -ARCHAND ,A 'RANDE !VENTURE¨ OP CIT P #HRISTIAN 7ECKERLm $U 4mLmPHONE AU -INITEL !CTEURS ET FACTEURS LOCAUX DANS LA CONSTITUTION DES )MAGES ET
5SAGES 3OCIAUX DE LA 4mLmMATIQUE DEUX VOLUMES 0ARIS 'ROUPE DE 2ECHERCHE ET D´!NALYSE DU 3OCIAL ET DE LA
3OCIABILITm ) P )BIDEM P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX JLQDO IXQFWLRQ NH\V ZHUH QRW GHVLJQHG IRU PHVVDJLQJ DSSOLFDWLRQV WKH\
could be incorporated into messaging programs, and users adapted to the
SRRUNH\ERDUGE\W\SLQJLQDQRQOLQHVKRUWKDQGULFKLQQHZVODQJDQGLQventive abbreviations. The Minitel thus became a communication device.
7KH ZDOOV RI 3DULV ZHUH VRRQ FRYHUHG ZLWK SRVWHUV DGYHUWLVLQJ PHVVDJLQJVHUYLFHV$ZKROHQHZLFRQRJUDSK\RIWKHUHLQYHQWHG0LQLWHOUHSODFHGWKHVREHUPRGHUQLVPRIRIÀFLDO377SURSDJDQGD,QWKHVHSRVWHUV
WKHGHYLFHLVQRORQJHUDEDQDOFRPSXWHUWHUPLQDOEXWLVDVVRFLDWHGZLWK
EODWDQWVH[XDOSURYRFDWLRQ,QVRPHDGVWKH0LQLWHOZDONVLWWDONVLWEHFNRQVLWVNH\ERDUGZKLFKFDQÁDSXSDQGGRZQEHFRPHVDPRXWKWKH
screen becomes a face. The silence of utilitarian telematics is broken in a
EL]DUUHFDFRSKRQ\
,QZHDNHQLQJWKHERXQGDULHVRISULYDWHDQGSXEOLFWKH0LQLWHORSHQVD
WZRZD\VWUHHW,QRQHGLUHFWLRQKRXVHKROGVEHFRPHWKHVFHQHRIKLWKHUWR
public activities, such as consulting train schedules or bank accounts. But
in the other direction, telematics unleashes a veritable storm of private
IDQWDV\RQWKHXQVXVSHFWLQJSXEOLFZRUOG7KHLQGLYLGXDOVWLOOGHPDQGV
in Benjamin’s phrase, that the “interior be maintained in his illusions.” But
QRZWKRVHLOOXVLRQVWDNHRQDQDJJUHVVLYHO\HURWLFDVSHFWDQGDUHEURDGFDVWRYHUWKHQHWZRUN
7KH WHFKQLFDO FKDQJH LQ WKH 0LQLWHO LPSOLHG E\ WKLV VRFLDO FKDQJH LV
LQYLVLEOH EXW HVVHQWLDO ,W ZDV GHVLJQHG DV D FOLHQW QRGH OLQNHG WR KRVW
FRPSXWHUVDQGZDVQRWLQWHQGHGIRUXVHLQDXQLYHUVDOO\VZLWFKHGV\VWHP
ZKLFKOLNHWKHWHOHSKRQHQHWZRUNDOORZVGLUHFWFRQQHFWLRQRIDQ\VXEVFULEHU ZLWK DQ\ RWKHU$V LWV LPDJH FKDQJHG WKH 7HOHFRP UHVSRQGHG E\
FUHDWLQJDXQLYHUVDOHOHFWURQLFPDLOVHUYLFHFDOOHG0LQLFRPZKLFKRIIHUHG
DPDLOER[WRHYHU\RQHZLWKD0LQLWHO%XWXQIRUWXQDWHO\DQHZJURXSRI
EXUHDXFUDWVPDQDJLQJWKHV\VWHPODFNHGWKHLPDJLQDWLRQDQGGDULQJRILWV
RULJLQDWRUV0LQLFRPZDVKRXVHKROGEDVHG8QOHVVRQHOLYHGDORQHLWZDV
LPSRVVLEOHWRHQJDJHLQSULYDWHH[FKDQJHVRQWKLVVHUYLFH1HHGOHVVWRVD\
LWQHYHUHQMR\HGWKHVXFFHVVRIHPDLORQWKH,QWHUQHW
Despite the revenues earned from these communications applications,
WKH )UHQFK 7HOHFRP JUXPEOHG WKDW LWV V\VWHP ZDV EHLQJ PLVXVHG &XULRXVO\WKRVHZKRLQWURGXFHGWKHWHOHSKRQHDFHQWXU\DJRIRXJKWDVLPLODUEDWWOHZLWKXVHUVRYHULWVGHÀQLWLRQ7KHSDUDOOHOLVLQVWUXFWLYH$WÀUVW
WKHWHOHSKRQHZDV FRPSDUHG WR WKH WHOHJUDSK DQG DGYHUWLVHG SULPDULO\
DVDQDLGWRFRPPHUFH,QRSSRVLWLRQWRWKLV´PDVFXOLQHµLGHQWLÀFDWLRQRI
WKHWHOHSKRQHZRPHQJUDGXDOO\LQFRUSRUDWHGLWLQWRWKHLUGDLO\OLYHVDVD
social instrument7KHUHZDVZLGHVSUHDGFULWLFLVPRIVRFLDOXVHVRIWKH
#LAUDE &ISCHER±'ENDER AND THE 2ESIDENTIAL 4ELEPHONE 4ECHNOLOGIES OF 3OCIABILITY² IN 3OCIOLOGICAL
&ORUM P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD &%%."%2' !NDREW WHOHSKRQHDQGDQDWWHPSWZDVPDGHWRFRQÀQHLWWRDEXVLQHVVUROH. As
RQH WHOHSKRQH FRPSDQ\ RIÀFLDO FRPSODLQHG LQ µ7KH WHOHSKRQH LV
JRLQJEH\RQGLWVRULJLQDOGHVLJQDQGLWLVDSRVLWLYHIDFWWKDWDODUJHSHUFHQWDJHRIWHOHSKRQHVLQXVHWRGD\RQDÁDWUHQWDOEDVLVDUHXVHGPRUHLQ
entertainment, diversion, social intercourse and accommodation to others
WKDQLQDFWXDOFDVHVRIEXVLQHVVRUKRXVHKROGQHFHVVLW\µ.
,Q)UDQFHHURWLFFRQQRWDWLRQVFOXVWHUHGDURXQGWKHVHHDUO\VRFLDOXVHV
RI WKH WHOHSKRQH ,W ZDV ZRUULVRPH WKDW RXWVLGHUV FRXOG LQWUXGH RQ WKH
KRPHZKLOHWKHKXVEDQGDQGIDWKHUZHUHDZD\DWZRUN´,QWKHLPDJLQDtion of the French of the Belle EpoqueWKHWHOHSKRQHZDVDQLQVWUXPHQWRI
VHGXFWLRQµ%HUWKR6RFRQFHUQHGZDVWKHSKRQHFRPSDQ\IRU
WKHYLUWXHRILWVIHPDOHRSHUDWRUVWKDWLWUHSODFHGWKHPDWQLJKWZLWKPDOHV
SUHVXPDEO\SURRIDJDLQVWWHPSWDWLRQ.
'HVSLWHWKHVHGLIÀFXOWEHJLQQLQJVE\WKHVVRFLDELOLW\KDGEHFRPH
an undeniable referent of the telephone in the United States. (In France
WKHFKDQJHWRRNORQJHU7KXVWKHWHOHSKRQHLVDWHFKQRORJ\ZKLFKOLNHYLGHRWH[ZDVLQWURGXFHGZLWKDQRIÀFLDOGHÀQLWLRQUHMHFWHGE\PDQ\XVHUV
$QG OLNH WKH WHOHSKRQH WKH 0LQLWHO WRR DFTXLUHG QHZ DQG XQH[SHFWHG
functions as it became a privileged instrument of personal encounter. In
ERWKFDVHVWKHPDJLFSOD\RISUHVHQFHDQGDEVHQFHRIGLVHPERGLHGYRLFH
RUWH[WJHQHUDWHVXQH[SHFWHGVRFLDOSRVVLELOLWLHVLQKHUHQWLQWKHYHU\QDture of mediated communication.
&2/- 4%,%4%, 4/ 4(% ).4%2.%4
,QLWVÀQDOFRQÀJXUDWLRQ7HOHWHO ZDVODUJHO\VKDSHGE\WKHXVHUV·SUHferences. The picture that emerges is quite different from initial expecWDWLRQV:KDWDUHWKHOHVVRQVRIWKLVRXWFRPH"7KHUDWLRQDOLVWLFLPDJHRI
SRVWLQGXVWULDOVRFLHW\GLGQRWVXUYLYHWKHWHVWRIH[SHULHQFHXQFKDQJHG
Teletel is not just an information marketplace. Alongside the expected apSOLFDWLRQVXVHUVLQYHQWHGDQHZIRUPRIKXPDQFRPPXQLFDWLRQWRVXLWWKH
QHHGIRUVRFLDOSOD\DQGHQFRXQWHULQDQLPSHUVRQDOEXUHDXFUDWLFVRFLHW\
,QVRGRLQJRUGLQDU\SHRSOHRYHUURGHWKHLQWHQWLRQVRISODQQHUVDQGGH-
#LAUDE &ISCHER ¦4OUCH 3OMEONE 4HE 4ELEPHONE )NDUSTRY $ISCOVERS 3OCIABILITY² IN 4ECHNOLOGY AND #ULTURE *ACQUES !TTALI AND 9VES 3TOURDZE±4HE "IRTH OF THE 4ELEPHONE AND %CONOMIC #RISIS THE SLOW DEATH
OF THE MONOLOGUE IN &RENCH SOCIETY² IN 4HE 3OCIAL )MPACT OF THE 4ELEPHONE )THIEL DE 3OLA 0OOL ED #AMBRIDGE
-ASS -)4 0RESS 1UOTED IN #LAUDE &ISCHER ¦4OUCH 3OMEONE 4HE 4ELEPHONE )NDUSTRY $ISCOVERS 3OCIABILITY² LOC CIT P #ATHERINE "ERTHO 4mLmGRAPHES ET 4mLmPHONES DE 6ALMY AU -ICROPROCESSEUR 0ARIS ,IVRE DE 0OCHE P *EAN-ARIE #HARON ¦ 4mLmTEL DE L´INTERACTIVITm HOMMEMACHINE¨ § LOC CIT P # DE 2%#)43 "EFORE THE )NTERNET 4HE &RENCH %XPERIENCE WITH 6IDEOTEX signers and converted an informational resource into a postmodern social
environment.
7KHPHDQLQJRIYLGHRWH[WHFKQRORJ\ZDVLUUHYHUVLEO\FKDQJHGE\WKLV
H[SHULHQFH:KHQWKH,QWHUQHWZDVRSHQHGWRWKHSXEOLFVLPLODUXVHULQLWLDWLYHVUHVXOWHGLQWKHSUROLIHUDWLRQRIQHZVRFLDOIRUPVRQDV\VWHPRULJLQDOO\GHVLJQHGIRUWLPHVKDULQJRQPDLQIUDPHFRPSXWHUV
,IWKH,QWHUQHWZDVXOWLPDWHO\PRUHVXFFHVVIXOWKLVLVGXHWRLWVXQXVXDO
WHFKQLFDOGHVLJQ8QOLNHWKH;QHWZRUNVFUHDWHGE\QDWLRQDO7HOHFRPV
WKH ,QWHUQHW HQDEOHG HDFK FRPSXWHU FRQQHFWHG WR WKH V\VWHP WR PDQDJH
LWV RZQ GDWD 7KH V\VWHP VSUHDG ZKHUHYHU SHUVRQDO FRPSXWHUV ZHUH LQ
XVHZLWKRXWUHJDUGIRUORFDOVWDQGDUGVRIWKHVRUWLPSRVHGE\WKH)UHQFK
and other national Telecoms. The result has been the emergence of a global
FRPPXQLFDWLRQV\VWHPVXSSRUWLQJDQXQSUHFHGHQWHGYDULHW\RIDFWLYLWLHV
%XWEH\RQGWKHVHSDUWLFXODUVDODUJHUSLFWXUHORRPV,QHYHU\FDVHWKH
KXPDQGLPHQVLRQRIFRPPXQLFDWLRQWHFKQRORJ\RQO\HPHUJHVJUDGXDOO\
LQ RSSRVLWLRQ WR WKH FXOWXUDO DVVXPSWLRQV RI WKRVH ZKR RULJLQDWH LW DQG
ÀUVWVLJQLI\LWSXEOLFO\WKURXJKUDWLRQDOLVWLFFRGHV7KLVSURFHVVUHYHDOVWKH
OLPLWVRISRVWLQGXVWULDOLGHRORJ\
!CKNOWLEDGEMENTS
,ZRXOGOLNHWRWDNHWKLVRSSRUWXQLW\WRWKDQNP\ÀUVWJXLGHVWKURXJKWKHWHOHPDWLFODE\ULQWK
&DWKHULQH%HUWKR-HDQ0DULH&KDURQ0DUF*XLOODXPHDQG0DULH0DUFKDQG
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS ,E SOCIALISME g LA DmCOUPE
2ETOUR SUR LE DmCOUPAGE TERRITORIAL
DES CIRCONSCRIPTIONS mLECTORALES LmGISLATIVES
AU PARTI SOCIALISTE DEPUIS 'REGORY (}
"LAISE -AGNIN
4HOMAS -ARTY
D
ANS LA PLUPART DES DOCUMENTS AUTOBIOGRAPHIQUES d’élus socialistes disponibles depuis le début du XXe siècle, la remémoration
des trajectoires électorales tend à maximiser l’importance de la
connaissance locale. D’hier à aujourd’hui, quand il s’agit en effet de décrire
les réalités économiques et sociales qui sont les raisons explicatives de la
représentation électorale, leur localisation prime. L’élu socialiste, comme
incarnation d’un territoire qui correspond à une circonscription adminisWUDWLYHHWRXpOHFWRUDOHSDUDvWGRQFXQHÀJXUHODUJHPHQWUHoXHHWFRQQXH
Par ailleurs, la documentation électorale (professions de foi, réunions et
meetings) tend à laisser penser qu’un candidat socialiste à la députation
ne diffère en rien des candidats d’autres marques idéologiques dans sa
PDQLqUHGHODLVVHUDFFURLUHTX·LOLQFDUQHMXVWHPHQWXQWHUULWRLUHVSpFLÀTXH
tout autant, si ce n’est plus, qu’une idéologie aux contours arrêtés.
Un modeste candidat, épris de théorie socialiste dans sa façon de
V·DGUHVVHU j © VHV ª pOHFWHXUV DIÀUPH DLQVL HQ ORUV G·XQH UpXQLRQ
pOHFWRUDOH GDQV OD WURLVLqPH FLUFRQVFULSWLRQ GH 1DQF\ © YRXV rWHV GDQV
FHWWHFLUFRQVFULSWLRQpOHFWHXUVRXYULHUVVXU6LYRXVVDYLH]
tout ce que je sais et que je n’ose pas dire, vous voteriez tous pour moi
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS socialiste[s]1ª&HWDSSHOjGHVFRQVLGpUDWLRQVORFDOHVQHFRQVWLWXHHQULHQ
XQUHJLVWUHPLOLWDQWVSpFLÀTXHDXGpEXWGXXXe siècle mais semble avoir toujours constitué un des argumentaires du socialisme électoral notamment
GDQVODIDoRQGRQWOHVFDQGLGDWVFKHUFKHQWjV·LGHQWLÀHUj©OHXUªSHXSOH
Quelques décennies après, quand le journaliste Claude Estier, compagnon
GHURXWHGH)UDQoRLV0LWWHUUDQGDXPRPHQWGXFRQJUqVG·eSLQD\pYRTXH
son parachutage dans le 18eDUURQGLVVHPHQWGH3DULVHQWUHHW
il invoque un terroir socialiste qui semble fonctionnellement équivalent
à celui du début du XXeVLqFOH©(QGL[DQVMHPHVXLVODUJHPHQWLGHQWLÀp
jFHWDUURQGLVVHPHQWRXQVRQGDJH62)5(6P·DDSSULVUpFHPPHQWTXH
j’avais l’une des meilleurs “cotes de popularité” des élus parisiens dans
OHXUVFLUFRQVFULSWLRQV«1RXVVRPPHVELHQORLQLFLGHVJUDQGVGpEDWV
idéologiques… mais la vie des Français, ce sont d’abord des problèmes
très concrets et le rôle d’un élu, d’un élu socialiste en particulier, est de les
aider à les résoudre.ª
­O·RSSRVpGHFHVSURFHVVXVTXHO·RQSRXUUDLWTXDOLÀHUGHFHQWULIXJHVOH
parti a développé – et il présente en cela une particularité dans la constance
et l’ampleur de ses propositions – une expertise sur l’élargissement nécessaire de toutes les circonscriptions électorales existantes, que celui-ci passe
par la départementalisation, la régionalisation ou la nationalisation des
frontières du vote3. Comment saisir dès lors les inscriptions spatiales dans
lesquelles se projettent les candidats eux-mêmes et à travers lesquelles ils
entraînent leurs électorats ? À la lumière de ces quelques mises en perspective, on se rend aisément compte que l’approche juridique et politique classique des découpages électoraux, c’est-à-dire la réponse à la question « à
TXHOVLQWpUrWVFRUUHVSRQGWHOOHRXWHOOHIURQWLqUHGHFLUFRQVFULSWLRQ"ªHVW
relativement illusoire. En effet, chaque parti, et le parti socialiste en particulier de par sa longévité, est animé de mouvements et de représentations
contradictoires selon l’échelle spatiale invoquée à tel ou tel stade de la compétition politique, à tel ou tel moment de son histoire électorale.
!RCHIVES DmPARTEMENTALES -EURTHEET-OSELLE - RAPPORT DU COMMISSAIRE DE POLICE DE .ANCY AU PRm
FET AVRIL #LAUDE %STIER ,A PLUME AU POING 0ARIS 3TOCK P #ETTE TENDANCE g L´mLARGISSEMENT ¦ RmGIONAL § JOUE ENCORE DANS LES REPRmSENTATIONS ENTRETENUES PAR LE PARTI
SOCIALISTE COMME LE PROUVE PAR EXEMPLE L´IDmE DE CIRCONSCRIPTIONS g CHEVAL SUR DEUX DmPARTEMENTS IMAGINmE
PAR LE DmPUTm DE 0ARIS #HRISTOPHE #ARESCHE DANS LE DmBAT SUR LE DmCOUPAGE mLECTORAL DE *OURNAL
/F½CIEL !SSEMBLmE NATIONALE #OMPTE RENDU INTmGRAL DE SmANCE DU JEUDI NOVEMBRE VENDREDI NO
VEMBRE N€ P 0OUR UNE VUE D´ENSEMBLE DE CETTE HYPOTHnSE cf 4HOMAS -ARTY ¦ ,ES MODES DE SCRUTIN § DANS !NTONIN #O
HEN "ERNARD ,ACROIX ET 0HILIPPE 2IUTORT DIR .OUVEAU MANUEL DE SCIENCE POLITIQUE 0ARIS ,A $mCOUVERTE P # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS 3/#)!,)3-% %4 $)342)"54)/. 30!4)!,%
$%3 #!.$)$!452%3 !58 ,b')3,!4)6%3 /HVRFLDOLVPHVHFRQVWUXLWjO·RULJLQHFRPPHXQHG\QDPLTXHSROLWLTXH
ancrée dans des terroirs. Il existe donc à l’état naissant dans une forme
de division géographique qui est largement contrainte par le cadre légal
lui-même du scrutin uninominal d’arrondissement à deux tours. Sous la
IIIe République, il ne se produit aucun découpage préélectoral massif mais,
paradoxalement, le régime est traversé par de très grandes controverses
sur la réforme électorale, notamment du point de vue de l’organisation des
candidatures aux élections législatives (introduction de la représentation
proportionnelle). En tant que parti naissant, cherchant donc le meilleur
mode de régulation interne de ses pratiques électorales, le parti socialiste
participe pleinement, jusque dans les années 1930 au moins, à cet important effort qui impliquera en 1919 un élargissement de la circonscription
électorale de l’arrondissement au niveau du département, puis une rétracWDWLRQGHFHPRXYHPHQWGqVODORLpOHFWRUDOHGH
,A PRODUCTION PARTISANE DES FRONTInRES CIRCONSCRIPTIONNELLES
$YDQW OD 3UHPLqUH *XHUUH PRQGLDOH OD FRQVWUXFWLRQ GH OpJLWLPLWpV
proprement socialistes au sein des circonscriptions d’arrondissement infra-départementales tient essentiellement aux liens entre l’organisation
interne en fédérations départementales (articulées autour de sections et
comités) et l’organisation externe qui vise à répandre dans toutes les parties d’un département une présence électorale. Les élections cantonales,
les élections d’arrondissement et bien entendu les élections législatives (elles-mêmes se déroulant au niveau de l’arrondissement) offrent une série
d’échelons géographiques intermédiaires que le militantisme interne n’a
pas prévu ou n’a pas su réguler – et paradoxalement, il en est de même à
l’échelle municipale, qui est pourtant le cadre privilégié de l’implantation
des sections socialistes7. Très vite, ces circonscriptions administratives,
HWRXpOHFWRUDOHVSHUPHWWHQWGHFRQTXpULUXQHIpGpUDWLRQHQFRQWRXUQDQW
'ILLES #ANDAR ET #HRISTOPHE 0ROCHASSON ¦ ,E SOCIALISME g LA CONQUoTE DES TERROIRS § DANS ,E MOUVEMENT
SOCIAL JUILLETSEPTEMBRE P )L S´AGIT DE LA MOTION DmFENDUE PAR -ARCEL #ACHIN AU CONGRnS DE #HhLONS EN #´EST AINSI QUE 2mMI ,EFEBVRE A PU MONTRER L´EMPRISE HISTORIQUE DE L´INSTITUTION MUNICIPALE SUR LES SECTIONS
QUI mTAIENT CENSmES LA CONTRxLER 0RIS PAR LEUR RxLE LES MAIRES SOCIALISTES APPARAsTRONT DnS L´ENTREDEUXGUERRES
COMME LES mLUS NOTABILISmS D´UN TERRITOIRE PLUTxT QUE D´UN PARTI ,ES RESSOURCES PUBLIQUES ET PARAPUBLIQUES
QU´ILS CONTRxLENT LEUR PERMETTENT DE S´AUTONOMISER DE L´APPAREIL PARTISAN TOUT EN S´EN ASSURANT LA MAsTRISE
%N RETOUR LE PARTI S´INSTITUTIONNALISE JUSQU´g APPARAsTRE COMME UNE ANNEXE CLIENTmLISmE ET UNE COURROIE DE
TRANSMISSION DE LA MAIRIE 6OIR 2mMI ,EFEBVRE ¦ ,E SOCIALISME FRANlAIS SOLUBLE DANS L´INSTITUTION MUNICIPALE &ORME PARTISANE ET EMPRISE INSTITUTIONNELLE 2OUBAIX § DANS 2EVUE FRANlAISE DE SCIENCE POLITIQUE
P 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS le maillage délicat des sections locales, du moins en lui servant de point
d’appui. Toutes les techniques d’occupation de l’espace électoral (du candidat le plus indigène au plus parachuté) paraissent ainsi mues par des
objectifs primaires ou secondaires de création, de contrôle ou de prise de
contrôle, des fédérations socialistes départementales. Il s’ensuit une forme
GH VXUHQFKqUH SDUWLVDQH GDQV OD PDQLqUH GH V·LGHQWLÀHU DX[ FDGUHV JpRJUDSKLTXHV HW GpPRJUDSKLTXHV GH O·DUURQGLVVHPHQW FHWWH ÀFWLRQ DGPLQLVWUDWLYHSRXYDQWGpVRUPDLVVHUYLUjMXVWLÀHUO·RULHQWDWLRQVRFLDOLVWHGHV
programmes politiques proposés aux électeurs.
Immédiatement après la réunion des chapelles du socialisme (guesdisWHMDXUpVLVWHHWYDLOODQWLVWHQRWDPPHQWGDQVOHFDGUHGHOD6),2SDUWLXQLÀpHQXQPRGHVWHMRXUQDOLVWHVRFLDOLVWHGX3DVGH&DODLVV·LQWHUURJH
DLQVL©&RPELHQGHWHPSpUDPHQWVSROLWLTXHVGLIIpUHQWVV·pFKHORQQHQWGHpuis la banlieue de Douai qui jouxte Arras jusqu’au littoral maritime de la
Manche ? Comment établir pour chacune des quatre grandes catégories de
l’opinion réactionnaire, républicaine, radicale et socialiste, actuellement
représentées dans la députation du Pas-de-Calais, une base d’opération
VXIÀVDQWH GDQV FKDTXH UpJLRQ /HV VRFLDOLVWHV « IRUWLÀpV GDQV OH SD\V
minier (…) trouveront-ils un concours dans les arrondissements d’Arras,
GH6DLQW3RO0RQWUHXLOHW6DLQW2PHU"8ª/DG\QDPLTXHGHODUHSUpVHQtation électorale génère dès lors au sein des élus, des candidats ou même
des simples militants du parti socialiste en général, des visions assez parcellisées. Ces dernières sont d’ailleurs renforcées par la relative stabilité,
MXVTX·DX[pOHFWLRQVGHDXPRLQVGHO·DUURQGLVVHPHQWFRPPHFDGUH
de la députation. Si comme on l’observera plus tard, le redécoupage au niveau départemental existe à l’époque comme alternative (car débattue au
parlement par exemple), il faut toutefois considérer la nécessité de « faire
DYHFªTXLLPSRVHDX[VRFLDOLVWHVGHOD%HOOHeSRTXHGHFDQGLGDWHUjXQ
niveau infra-départemental. Le découpage des circonscriptions adopté en
GHPHXUHHQHIIHWTXDVLLQWDFWMXVTX·HQPrPHVLFKDTXHYHLOOH
G·pOHFWLRQVOpJLVODWLYHVHVWPDUTXpHVDXIHQSDUODPRGLÀFDWLRQPDUginale de quelques circonscriptions9.
,O HVW GLIÀFLOH HQ GHKRUV G·XQ GpQRPEUHPHQW SOXV V\VWpPDWLTXH GH
mesurer l’étendue exacte de la vision localiste de l’acte de candidature
lui-même. Toutefois, sa seule existence comme instrument de conquête
GH IpGpUDWLRQV VRFLDOLVWHV VXIÀW j HQ VRXOLJQHU O·LPSRUWDQFH 6XUWRXW HOOH
envahit largement le discours électoral lui-même tel qu’il est adressé aux
électeurs quelle que soit la légitimité de la candidature en question. En
,E "OULONNAIS *OURNAL DU 0ASDE#ALAIS OCCIDENTAL ;"IBLIOTHnQUE .ATIONALE DE &RANCE */ DmCEMBRE
=
"ERNARD 'AUDILLnRE !TLAS HISTORIQUE DES CIRCONSCRIPTIONS mLECTORALES FRANlAISES 0ARIS $ROZ P # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS 6HLQHHW2LVH SDU H[HPSOH WRXMRXUV DX[ pOHFWLRQV GH OH FDQGLGDW
/RXLV'XEUHXLOKVHFUpWDLUHJpQpUDOGXSDUWLVRFLDOLVWHGHjSRVsède toute la légitimité nationale (en tant que principal animateur du parti
XQLÀpSRXUUpGLJHUXQHSURIHVVLRQGHIRLTXLGHIDLWV·DUWLFXOHDXWRXUGH
UHYHQGLFDWLRQV G·RUGUH JpQpUDO HW QDWLRQDO 7RXWHIRLV OD ÀQ GH VRQ WH[WH
FRPSRUWHXQSDUDJUDSKHLQWLWXOp©3RXUODUpJLRQªTXLLQGLTXHTXHO·HQsemble du discours programmatique n’a d’autre fonction que de servir à la
SpQpWUDWLRQGXVRFLDOLVPHDXVHLQPrPHGHODFLUFRQVFULSWLRQ©7UDYDLOOHU
au développement des voies de communication (…) et toutes les mesures
qui contribueront à accroître l’activité économique, par suite le bien-être
des salariés, cultivateurs, petits commerçants de la circonscription10ª2Q
DXUDLWWRUWDORUVGHUpGXLUHFHWWHYLVLRQ©HQGHGDQVªjXQHUKpWRULTXHGHOD
proximité, tant elle vise au contraire à élargir l’assise économique locale du
VRFLDOLVPHpOHFWRUDO'DQVOD+DXWH6DYRLHXQFDQGLGDWVRFLDOLVWHSUpWHQG
ainsi que sa propre biographie le rend mieux à même d’être le représentant
GHODFLUFRQVFULSWLRQGDQVODTXHOOHLOVHSUpVHQWH©/HVFRPLWpVVRFLDOLVWHV
GHO·DUURQGLVVHPHQWG·$QQHF\RQWSHQVpTXHSRXUUHSUpVHQWHUXQDUURQdissement dont le corps électoral est formé en grande majorité de petits
FRPPHUoDQWVGHSD\VDQVHWGHVDODULpVLOQHIDOODLWSOXVIDLUHDSSHOjGHV
représentants de la bourgeoisie qui ne connaît les peines et misères des PeWLWVTXHSRXUHQDYRLUHQWHQGXSDUOHURXSRXUHQDYRLUSURÀWpPDLVTX·DX
contraire il était nécessaire qu’un travailleur salarié fût le porte-parole des
travailleurs républicains11ª&HVRQWELHQOjWUqVH[SOLFLWHPHQWOHVDSSUphensions des hiérarchies sociales de l’arrondissement, telles qu’elles sont
perçues par les structures militantes internes à une fraction de la fédération
GH+DXWH6DYRLHTXLIRQGHQWODORFDOLVDWLRQGXVRFLDOLVPHpOHFWRUDO
Ce n’est ni plus ni moins que le concept même de circonscription électorale qui semble ici s’imposer aux militants socialistes. Pris dans l’étau
du comité et du département, deux variables internes, la mobilisation militante innerve en fait un double échelon intermédiaire qui n’avait pas été
SODQLÀp FRPPH LQVWUXPHQW GH GpYHORSSHPHQW GX VRFLDOLVPH O·pOHFWLRQ
FRPPH PR\HQ FRQVWDQW GH PLOLWHU OD FLUFRQVFULSWLRQ G·DUURQGLVVHPHQW
FRPPH FDGUH SULYLOpJLp SRXU OH IDLUH HW \ LQFDUQHU DX VHQV SUHPLHU GX
terme, les idées socialistes.
!RCHIVES DmPARTEMENTALES DES 9VELINES 3EINEET/ISE - mLECTIONS LmGISLATIVES DE E CIRCONSCRIP
TION DE #ORBEIL PROFESSION DE FOI DE ,OUIS $UBREUILH 0RmCISONS QUE , $UBREUILH INFATIGABLE CHEVILLE OUVRInRE
DU PARTI ENTRE ET NE PARVIENDRA JAMAIS g SE FAIRE mLIRE DmPUTm MALGRm PLUSIEURS ¦ PARACHUTAGES §
SUCCESSIFS
!RCHIVES DmPARTEMENTALES DE (AUTE3AVOIE - mLECTIONS LmGISLATIVES DE PROFESSION DE FOI DE ¦ 'A
STON "RUN #OMPTABLE TRmSORIER DE LA BOURSE DU TRAVAIL CONSEIL MUNICIPAL D´!NNECY §
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS ,E SOCIALISME DmCOUPm L´EXPmRIENCE DE Le scrutin uninominal d’arrondissement est donc une réalité acceptée
DXVHLQPrPHGXSDUWLGqVDYDQWOD3UHPLqUH*XHUUHPRQGLDOHFHTXLUHODWLYLVHO·HIIHWGHUXSWXUHLQGXLWVXUFHSRLQWSDUO·DGKpVLRQGHOD6),2GH
*X\ 0ROOHW HQ DX UpWDEOLVVHPHQW GH FH PRGH GH VFUXWLQ HW GH VRQ
corollaire en termes de découpage des circonscriptions. Par-delà les jeux
d’alliances et de positionnements du parti socialiste vis-à-vis des institutions et du pouvoir majoritaire entre le début du XXe siècle et l’élection
de François Mitterrand, l’accord pratique qui lie le socialisme local aux
circonscriptions électorales existantes suit une tendance liée très naturellement à la rationalisation de l’ensemble des opérations afférentes aux
campagnes électorales législatives. Dans le cadre du scrutin uninominal
G·DUURQGLVVHPHQWDYDQWOHVRFLDOLVPHQ·DXUDjDIIURQWHUTX·XQVHXO
JUDQGGpFRXSDJHpOHFWRUDO&HOXLFLDOLHXHQORUVGXUpWDEOLVVHPHQW
de ce mode de scrutin uninominal (qui avait été remplacé aux élections
GHHWSDUXQVFUXWLQGpSDUWHPHQWDOPL[WHF·HVWjGLUHjODIRLV
majoritaire et proportionnel). Il consiste principalement en une adaptaWLRQGHVFLUFRQVFULSWLRQVGHO·DYDQWJXHUUHDXUHJDUGGHGHX[SURFHVVXV
O·DSSDULWLRQ GX SDUWL FRPPXQLVWH GHSXLV HW OD UpIRUPH DGPLQLVWUDWLYH GH TXL SRXU GHV UDLVRQV pFRQRPLTXHV D VXSSULPp XQ FHUWDLQ
nombre d’arrondissements et donc de sous-préfectures. Le résultat obtenu
par le gouvernement radical en termes de redécoupage tient compte de
FHWDQFUDJHORFDOJUDQGLVVDQWGHOD6),2,OHVWPrPHSRVVLEOHGHPHVXrer assez exactement pour un certain nombre de départements le chemin
parcouru en comparant les résultats d’un projet de découpage inabouti en
1907 (dans le cadre de la refonte du mode de scrutin lui-même) avec celui,
HIIHFWLIGHDSSOLTXpDX[pOHFWLRQVGH
0ROJET INABOUTI DE DmCOUPAGE $mCOUPAGE EFFECTIF EN (AUTE-ARNE
(AUTE3AVOIE
#REUSE
-EUSE
-ARNE
,OIRE
3EINEET/ISE
'IRONDE
-OYENNE
4ABLEAU ) 0OURCENTAGE DES VOIX SOCIALISTES DmPLACmES
PAR RAPPORT g L´ENSEMBLE DES VOIX SOCIALISTES EN ET # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS 0ROJET INABOUTI DE DmCOUPAGE $mCOUPAGE EFFECTIF EN (AUTE-ARNE
(AUTE3AVOIE
#REUSE
-EUSE
-ARNE
,OIRE
3EINEET/ISE
'IRONDE
-OYENNE
4ABLEAU )) 0OURCENTAGE DES VOIX SOCIALISTES DmPLACmES
PAR RAPPORT g L´ENSEMBLE DES SUFFRAGES EXPRIMmS
3OURCES ARCHIVES DmPARTEMENTALES DE LA #REUSE - 'IRONDE - ¯ ,OIRE - -ARNE - (AUTE-ARNE - -EUSE - (AUTE3AVOIE - 3EINEET/ISE 9VELINES - 0OUR LE DmCOUPAGE
DE LES DONNmES SONT COMPLmTmES PAR L´OUVRAGE DE 'EORGES ,ACHAPELLE bLECTIONS LmGISLATIVES AVRIL RmSULTATS OF½CIELS 0ARIS ' 2OUSTAN ,E NIVEAU DES SUFFRAGES EXPRIMmS RETENU EST ANTmRIEUR POUR LE PROJET DE
SOIT LES mLECTIONS LmGISLATIVES DE MAIS POSTmRIEUR POUR SOIT LES mLECTIONS LmGISLATIVES DE 0OUR LA MmTHODOLOGIE ET DES RmSULTATS PLUS COMPLETS ON SE PERMET DE RENVOYER g 4HOMAS -ARTY ¦ $E L´ESPACE
mLECTORAL g SON ±DmCOUPAGE² DIFFmRENCIATION ET CATmGORISATION DES CIRCONSCRIPTIONS LmGISLATIVES EN &RANCE AU Dm
BUT DU 88E SInCLE § DANS %SPACE 0OPULATION 3OCImTmS ¯ g PARAsTRE
3OURCES VOIR LA NOTE PRmCmDENTE
3ULQFLSHGHOHFWXUH les voix socialistes déplacées par le projet de déFRXSDJHGHUHSUpVHQWHQWGHVVXIIUDJHVH[SULPpVHQ+DXWH6DYRLHDX[pOHFWLRQVOpJLVODWLYHVGH
&HVQHXIVGpSDUWHPHQWVVXIÀVHQWjUHSUpVHQWHUXQFHUWDLQQRPEUHGH
W\SHG·LPSODQWDWLRQVVRFLDOLVWHV réussies tant sur le plan des fédérations
elles-mêmes que des scores électoraux correspondants, soit en milieu rural (en Creuse par exemple13), soit en milieu plus industriel (dans la SeineHW2LVH2QREVHUYHTXHOHWUDYDLOGHUHGpFRXSDJHGHVFLUFRQVFULSWLRQV
réalisé par les préfets et les équipes ministérielles radicales (mais à vingt
DQVG·LQWHUYDOOHHVWV\VWpPDWLTXHPHQWPRLQVLPSRUWDQWHQTX·LOQH
l’était en 1907, même si les objectifs d’après-guerre n’ont plus rien à voir
DYHF FHX[ G·DYDQW (Q HIIHW DXWDQW OH PRXYHPHQW GH YLVDLW j
transformer radicalement le mode de scrutin (avec des circonscriptions déSDUWHPHQWDOHVYRLUHUpJLRQDOHVDXWDQWFHOXLGHQHYLVDLWÀQDOHPHQW
TX·jXQUHWRXUjODQRUPDOHF·HVWjGLUHXQUHÁX[YHUVOHPRGHGHVFUXWLQ
XQLQRPLQDOGHVDQQpHV6LOHSURMHWGHGpFRXSDJHGHWRX
*ACQUES 'IRAUT et alii DIR ,´IMPLANTATION DU SOCIALISME EN &RANCE AU 88E SInCLE PARTIS RmSEAUX MOBILISATION
0ARIS 0UBLICATIONS DE LA 3ORBONNE 'EORGES $AUGER !UX ORIGINES DU &RONT POPULAIRE DANS LA #REUSE #ONTRIBUTION g UNE ETHNOHISTOIRE DES COMPOR
TEMENTS POLITIQUES 'UmRET 3OCImTmS DES SCIENCES NATURELLES ET ARCHmOLOGIQUES DE LA #REUSE 6OIR PAR EXEMPLE !NNIE &OURCAUT "OBIGNY BANLIEUE ROUGE 0ARIS 0RESSES DE LA &.30 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS FKHHQPR\HQQHSUqVGHGHO·HQVHPEOHGHVVXIIUDJHVVRFLDOLVWHVGHV
GpSDUWHPHQWV FRQFHUQpV FH VHXLO HVW LQIpULHXU GH SRLQWV HQ /HV
ORFDOLVDWLRQV GX VRFLDOLVPH DSSDUDLVVHQW DLQVL SOXV LPPXDEOHV O·RPQLprésence des candidats socialistes, ainsi que l’existence de quelques « basWLRQVªLQWHUGLVHQWGpVRUPDLVWRXWGpFRXSDJHG·XQHFHUWDLQHDPSOHXUTXL
YLVHUDLWHWLVROHUDLWODVHXOH6),2/DPLVHHQWUHSDUHQWKqVHVGHODFDUWHGHV
FLUFRQVFULSWLRQVG·DUURQGLVVHPHQWVHQWUHHWSXLVTX·XQPRGHGH
VFUXWLQGpSDUWHPHQWDOHVWLQWURGXLWSRXUOHVpOHFWLRQVGHHWIDLW
GRQFTXHOD6),2Q·HVWSUpVHQWHVXUO·LQWpJUDOLWpGHVFLUFRQVFULSWLRQVTXH
très tardivement. D’ailleurs, malgré sa modestie d’ensemble, le redécouSDJHGHDIIHFWHHQUpDOLWpXQHPDVVHpOHFWRUDOHSOXVLPSRUWDQWHGX
SRLQWGHYXHGHVYRL[VRFLDOLVWHVWUDQVIpUpHVTXLUHSUpVHQWHQWGH
l’ensemble des suffrages exprimés parmi les huit départements étudiés en
FRQWUHHQ
,A CONCESSION D´UNE EXPERTISE DU ¦ DmCOUPAGE § PAR LE HAUT
Ce paradoxe d’un découpage initialement de moins grande ampleur
PDLVDX[HIIHWVÀQDX[SOXVDFFHQWXpVWLHQWHVVHQWLHOOHPHQWjODGpSDUWHmentalisation et à la nationalisation de la vie électorale socialiste1RQ
seulement la progression en termes de résultats crée des interdépendanFHVOHGpVLVWHPHQWG·XQUDGLFDORXG·XQFRPPXQLVWHHVWPRQQD\pSDUHX[
contre une action inverse), mais encore l’évolution du cadre légal lui-même induit une telle évolution des représentations spatiales, par l’introduction en 1919 d’un scrutin mixte (majoritaire et proportionnel) impliquant
l’adoption d’un scrutin de liste départemental.
La rationalisation des entreprises locales de conquête des voix aux législatives se fait en interne et peut être suivie à travers la mobilisation
électorale elle-même (et les paradiscours qu’elle suscite). Le mouvement
d’élargissement géographique et démographique des frontières de sollicitation des votes apparaît alors non pas comme l’image inverse de cette rationalisation localiste, mais comme son excroissance et son prolongement
chez des militants plus en délicatesse avec la réussite électorale (que ce soit
conjoncturellement ou plus durablement)17. Il trouve d’ailleurs son origi
,ES MOYENNES mVOQUmES NE SONT PAS PONDmRmES DmMOGRAPHIQUEMENT
3UR CES PROCESSUS VOIR -ICHEL /FFERLm ¦ ,E NOMBRE DE VOIX bLECTEURS PARTIS ET mLECTORAT SOCIALISTES g LA ½N DU
8)8E SInCLE EN &RANCE § DANS !CTES DE LA 2ECHERCHE EN 3CIENCES 3OCIALES P 3UR L´IN¾UENCE DES DmFAITES RmCURRENTES DE CANDIDATS INVESTIS PAR AILLEURS DANS LE COMMENTAIRE mLECTORAL ON
SE PERMET DE RENVOYER g 4HOMAS -ARTY ET !NTOINE 3CHWARTZ ¦ ª BONNE DISTANCE !CTIVITmS INTELLECTUELLES
EXPmRIENCES POLITIQUES ET ½GURES DE L´±mLECTEUR PROFANE² ½N 8)8E DmBUT 88E SInCLE § DANS 3TmPHANIE 7OJCIK ET
4HOMAS &ROMENTIN DIR ,E PROFANE EN POLITIQUE COMPmTENCES ET ENGAGEMENT DU CITOYEN 0ARIS ,´(ARMATTAN
COLL ¦ ,OGIQUES POLITIQUES § P # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS QHGDQVODPrPHYRORQWpGHFXPXOHUEpQpÀFHPLOLWDQWHWSURÀWpOHFWRUDO
3RXUMXVWLÀHUO·LQWURGXFWLRQG·XQPRGHGHVFUXWLQSURSRUWLRQQHOTXLSDVVH
nécessairement par l’organisation de candidatures de listes départementalisées, le grand militant du socialisme agrarien Adéodat Compère-Morel
LQGLTXHDLQVLGqV©«4XDQGGDQVXQHFLUFRQVFULSWLRQGRQQpHOD
victoire semble devoir être le fruit d’un travail de longue haleine et précédé de toute une besogne d’organisation et de propagande persévérante,
on ne pense pas plus à cette circonscription que si elle n’était pas de ce
PRQGH«1RXVYRXOLRQVGLUHSDUOjTX·XQHFDPSDJQHpOHFWRUDOHYDODLW
autant – si ce n’est davantage – par l’éducation socialiste qu’elle nous donnait la possibilité de faire et par le recrutement que cette éducation nous
assurait, que par les succès qu’elle nous permettait d’espérer18ª
(QUpDOLWpOD6),2GpYHORSSHGXUDQWFHWWHSpULRGHGHIRUPDWLRQGHVRQ
action électorale un point de vue très précis quant au niveau géographique
qu’il serait pertinent d’adopter comme cadre des circonscriptions électorales législatives. Jean Jaurès développe en particulier le concept d’utilisation
interdépartementale des restes19 dans le cadre d’un scrutin proportionnel,
c’est-à-dire la réunion (pour répartition) d’une partie des voix au niveau
territorial et donc démographique du regroupement des vingt-sept cours
d’appel. Le parti socialiste tentait en fait, plus généralement, d’en venir
à un échelon régional pour monter d’un cran dans la mobilisation électorale. Au sein même du parti, Jaurès est contesté sur ce point qui revient à
acter l’existence de très grandes circonscriptions venant s’ajouter à l’échelon départemental. Ainsi, son camarade de la fédération de la Seine, ArWKXU*URXVVLHUOHJUDQGVSpFLDOLVWHSDUOHPHQWDLUHGHODTXHVWLRQGXPRGH
de scrutin législatif, formule dans un débat au sein de la Commission du
VXIIUDJHXQLYHUVHOOHVUHPDUTXHVVXLYDQWHV©«LOIDXWVHERUQHUjGHV
FLUFRQVFULSWLRQVUpJLRQDOHVUHVWUHLQWHVHWpFDUWHUOHV\VWqPHGHO·XWLOLVDWLRQ
nationale des restes (…) si l’on adoptait l’utilisation régionale des restes,
LOGHPHXUHUDLWHQWHQGXTXHODTXHVWLRQGHODÀ[DWLRQGHVUpJLRQVG·RUGUH
essentiellement politique, serait-examinée ultérieurementª
!DmODAT #OMPnRE-OREL ¦ *E VOTE LA 20 § DANS ,´(UMANITm OCTOBRE #HAQUE MODE DE SCRUTIN PROPORTIONNEL GmNnRE EN EFFET UNE PARTIE DE VOIX NON UTILISmES EN PREMInRE INTEN
TION APPELmE LES RESTES mLECTORAUX ET RmPARTIE SOIT DANS LE CADRE D´UN NOUVEAU CALCUL SOIT DANS LE CADRE D´UN
SECOND TOUR
)L EXISTAIT DONC EN VINGTSEPT COURS D´APPEL UN NIVEAU PLUS AGRmGm QU´ACTUELLEMENT DONC /N NOTERA mGA
LEMENT QU´g PARTIR DE LA RmFORME DE LA CARTE JUDICIAIRE A PRmCmDm CELLE DE LA CARTE mLECTORALE LmGISLATIVE
PUIS TERRITORIALE
!RCHIVES NATIONALES #OMMISSION DU SUFFRAGE UNIVERSEL LmGISLATURE # JANVIER 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS !02È3 ,! $b4%.4)/. $% &)%&3 b,%#4/2!58
#/--% b,!2')33%-%.4 $%3 2%33/52#%3 30!4)!,%3 ,A DmPARTEMENTALISATION mLECTORALE AU PARTI SOCIALISTE
D´HIER g AUJOURD´HUI
2QSHXWGLUHTXHOHVUHIXVUpSpWpVGHVJRXYHUQHPHQWVUDGLFDX[G·DSpliquer toute proportionnelle vont condamner, ainsi que l’expérience raWpHGHWRXWHRUJDQLVDWLRQGXUDEOHG·XQVFUXWLQGHOLVWHGpSDUWHPHQWDOPDMRULWDLUHHWRXSURSRUWLRQQHO0DLVFHWWHUpDOLWpLQWHUSDUWLVDQH
et transhistorique ne préjuge pas de la réalité partisane et située, des faoRQVGHPHQHUFDPSDJQH$LQVLjOD6),2ODYLVLRQG·XQHSUDWLTXH©VXSUDFLUFRQVFULSWLRQQHOOHªYDV·LQVFULUHFRPPHUHJLVWUHFRPSOpPHQWDLUHGH
FHOXLHQJHQGUpSDUODSUDWLTXH©LQIUDPDQGDWDLUHª&HWWHÀJXUHLQDXJXUpH
DYDQWOD3UHPLqUH*XHUUHPRQGLDOHYDWURXYHUjVHGpYHORSSHUDXJUpGHV
FRQMRQFWXUHVpOHFWRUDOHVHWLQVWLWXWLRQQHOOHVMXVTX·HQ/HVFRQGLWLRQV
de transformation des espaces départementaux, notamment la réunion
des espaces industriels dispersés dans différents arrondissements, ont
ODUJHPHQW LQÁXHQFp TXHOTXHVXQV GHV VXFFqV GXUDEOHV GX VRFLDOLVPH DX
XXe VLqFOH/HVGHX[SDUHQWKqVHVGHHWGHOD,9e République, instaurant des votes pleinement départementaux, permettent par exemple à
OD6D{QHHW/RLUHGHEDVFXOHUGXUDGLFDOLVPHTXLEpQpÀFLHGHVDUURQGLVsements séparés en différentes circonscriptions électorales) au socialisme
TXLEpQpÀFLHTXDQWjOXLGHO·pFKHORQGpSDUWHPHQWDOHWGHO·DVVHPEODJH
GHVGLIIpUHQWHVFRQFHQWUDWLRQVLQGXVWULHOOHVGX&UHXVRWGH%ODQ]\RXGH
Charolles. Le cas de la Saône-et-Loire montre même un certain effet d’emboîtement entre ces phases de départementalisation (qui impliquent un
VHFRQGEDVFXOHPHQWYHUVOHFRPPXQLVPHDSUqVHWODG\QDPLTXHSROLWLTXHPrPHGX)URQWSRSXODLUHTXLPDOJUpXQ©UHWRXUªGXVFUXWLQXQLnominal d’arrondissement permet « un élargissement de l’espace électoral
socialiste aux régions ruralesª.
Il est délicat de considérer que le socialisme électoral s’est développé
dans cet entre-deux, entre les deux règnes du scrutin uninominal d’arronGLVVHPHQWO·DYDQWHWO·DSUqVSDUODJUkFHGHO·HIIHWGHGpSDUWHPHQWDOLVDWLRQGHODYLHpOHFWRUDOH2QSHXWWRXWHIRLVVXSSRVHUTX·LOV·HVWDJL
là d’un effet de levier, touchant à la fois les résultats tendanciels (jusqu’aux
VFRUHVLPSRVDQWVGHO·pOHFWLRQGHFRPPHOHVWUDMHFWRLUHVLQGLYLGXHOles. Roland Dumas, jeune avocat limousin en quête de politique, choisit
ainsi – après hésitation – la bannière socialiste (en l’occurrence celle de
!NNIE "LETON2UGET ¦ #OMPORTEMENTS ET ESPACES mLECTORAUX L´EXEMPLE DU DmPARTEMENT DE 3AxNEET,OIRE
§ DANS 4ERRITOIRES CONTEMPORAINS ¯ #AHIERS DE L´)(# P # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS O·8'65GH)UDQoRLV0LWWHUUDQGHWSURÀWHG·XQHSUHPLqUHFDPSDJQHPHQpHVXUWRXWOHGpSDUWHPHQWGHOD+DXWH9LHQQHHQSRXUO·HPSRUWHU
HWGHYHQLUGpSXWp/HGRXEOH©KDVDUGªGHOLHXHWGHFRQMRQFWXUHGHYLHQW
un élément plus structurant d’un rapport au territoire électoral quand, en
5'XPDVUHIXVHGHVHUHSUpVHQWHUGDQVOHFDGUHGXUHWRXUDXVFUXWLQ
XQLQRPLQDOLQIUDGpSDUWHPHQWDO©HQSOXVOHVFUXWLQG·DUURQGLVVHPHQW
à deux tours ne facilitait pas la tâche des députés de fraîche dateª&HW
exemple prouve la force des représentations associées aux espaces imaginaires (le département comme centre de force des alliances) une fois la
réalité infra-départementale redevenue la norme légale de candidature.
$X[PDUJHVGHOD6),2jO·8'65DX36$ODFULWLTXHGHO·RPQLSRWHQFH
des candidatures parcellisées du scrutin uninominal est un discours larJHPHQWUHoX/DVXUYLHGHOD6),2HOOHPrPHHVWOLpHjVRQDGKpVLRQjOD
FRQVWLWXWLRQPDLVDXVVLjO·RUGRQQDQFHGXRFWREUHTXLUpWDEOLWOH
VFUXWLQXQLQRPLQDOGpEDSWLVp©G·DUURQGLVVHPHQWª*X\0ROOHWPHPEUH
GXJRXYHUQHPHQWGXJpQpUDOGH*DXOOHDGRXEHFHQRXYHDXGpFRXSDJH
des circonscriptions électorales législatives qui, pour n’être plus enserré
dans l’étau de la division administrative de l’arrondissement, n’en demeure pas moins marqué par un certain nombre d’inégalités démographiques.
Le Conseil d’État note à son propos qu’aucune consultation partisane ne
l’a précédé puisqu’il a été entièrement tracé par les préfets et le gouverQHPHQWGH*DXOOH. Il reste toutefois que le parti socialiste a en quelque
sorte introduit un échelon localiste supplémentaire, celui du département,
venant s’ajouter – au moins dans les représentations – à l’arrondissement,
alors qu’il prétendait faire de ce changement d’échelle un élargissement
de l’horizon électoral. Il se pourrait bien que cette situation de fait corresponde aussi à l’existence d’une représentation élargie au plan national,
portée par exemple par le parti communiste qui est favorable, notamment
DXWRXU GH j XQH SURSRUWLRQQHOOH LQWpJUDOH F·HVWjGLUH VHORQ
une seule circonscription nationale.
/DUHIRQGDWLRQGXSDUWLVRFLDOLVWHORUVGXFRQJUqVG·eSLQD\GHIXW
présentée comme une rupture avec les pratiques les plus électoralistes de
OD6),2FRPPHXQUHQRXYHOOHPHQWGHVRQSHUVRQQHOGLULJHDQWQRWDELOLVp
2OLAND $UMAS ,E ½L ET LA PELOTE -mMOIRES 0ARIS 0LON P 3ELON LES INDICATIONS DONNmES PAR "ERNARD 'AUDILLnRE !TLAS¨ OP CIT P ¦ !VIS DU #ONSEIL D´bTAT DU OCTOBRE § #OMMISSION DES ARCHIVES CONSTITUTIONNELLES DE LA 6E 2mPUBLIQUE
!RCHIVES CONSTITUTIONNELLES DE LA 6E 2mPUBLIQUE 6OLUME OCTOBRE ¯ NOVEMBRE 0ARIS ,A $OCU
MENTATION &RANlAISE /N TROUVERA UN BON CONDENSm DES CRITIQUES COMMUNISTES CONTRE L´ADHmSION SOCIALISTE g LA LOGIQUE MAJORITAIRE
Y COMPRIS DANS LA PERSPECTIVE DU SCRUTIN PROPORTIONNEL DmPARTEMENTAL DE DANS L´OUVRAGE DE DEUX
JOURNALISTES COMMUNISTES *EAN0AUL *OUARY ET !RNAUD 3PIRE ,E COUP D´bTAT CONTINUE -ITTERRAND ET LES INSTITU
TIONS 0ARIS -ESSIDORbDITIONS SOCIALES ,´OUVRAGE EST CONTEMPORAIN DE L´ADOPTION DE LA LOI mLECTORALE DE
MARS QUI RmTABLIT LE DmPARTEMENT COMME CIRCONSCRIPTION mLECTORALE POUR LES LmGISLATIVES MAIS AUSSI POUR
LES TOUTES NOUVELLES mLECTIONS RmGIONALES
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS et fut accompagnée par une forte idéologisation de l’offre politique socialiste ainsi que par une effervescence militante certaine (création d’un
grand nombre de sections et de groupes socialistes d’entreprises, liens renoués avec différentes fractions du mouvement social). Pourtant, dès les
élections municipales de 1977, très favorables au PS, semblent réapparaître
les structures partisanes telles qu’elles se sont constituées historiquement
– lesquelles consacrent l’autonomie de grands élus contrôlant leur fédération et les postes électifs dans leur département. Dans le même temps, ce
mouvement de conquête du pouvoir favorisa un renouvellement des élites partisanes qui, au niveau national, comme au niveau local, se recrutèrent désormais davantage parmi les experts politico-administratifs (hauts
fonctionnaires et collaborateurs d’élus notamment) que dans les réseaux
PLOLWDQWVDVVRFLDWLIVRXV\QGLFDX[6LELHQTX·jWRXVOHVpFKHORQVGXSDUWL
les dirigeants et responsables socialistes semblent tout entiers tournés vers
une conquête professionnalisée de positions électives. De ce fait, leurs
rapports aux circonscriptions qui délimitent les territoires et agrègent les
populations qu’ils représentent semblent surdéterminés, d’une part, par
la structure et l’histoire de l’appareil partisan, et d’autre part, par les exigences de la compétition électorale. Lesquelles se jouent essentiellement
au niveau fédéral (et donc départemental) – où se décident les investitures
pour tous les scrutins, comme le contrôle du parti.
$mTENTION D´UNE CIRCONSCRIPTION LmGISLATIVE ET CONSTRUCTION
D´UN LEADERSHIP POLITIQUE SOUS LA 6E 2mPUBLIQUE
La détention d’un mandat de député permet à son titulaire de construiUHHWRXG·pWHQGUHVRQUpVHDXGHÀGpOLWpVDXVHLQHWHQGHKRUVGHVRQSDUWL
Les ressources liées au mandat de député offrent à celui-ci l’occasion de
se poser en interlocuteur indispensable à tous les élus de sa circonscripWLRQ$LQVLFHWDQFLHQGpSXWppOXGXUDQWDQVV·HVWFRQVWUXLWFHUWDLQHV
OR\DXWpVDXSUqVGHVpOXVGHVDFLUFRQVFULSWLRQHQGLVWULEXDQWOHVELHQVjVD
GLVSRVLWLRQUpVHUYHSDUOHPHQWDLUHHWHQRULHQWDQWO·DFWLRQSXEOLTXH©,O
existe un domaine qui s’appelle les réserves parlementaires et où on peut
donner un coup de main à telle ou telle commune et j’en ai donné plus à
des communes de droite qu’à des communes de gauche ! Et puis à certains
moments, il faut aider, pour maintenir telle ou telle structure administraWLYHXQWULEXQDORXXQFROOqJHRXQ·LPSRUWHTXRL2QHVWWRXVGHUULqUH
(mLnNE (ATZFELD ¦ 5NE RmVOLUTION CULTURELLE DU PARTI SOCIALISTE DANS LES ANNmES § DANS 6INGTInME SInCLE
2EVUE D´HISTOIRE P 6OIR 2mMI ,EFEBVRE &RmDmRIC 3AWICKI ,A SOCImTm DES SOCIALISTES ,E 03 AUJOURD´HUI bDITIONS DU #ROQUANT "ELLE
COMBEEN"AUGES # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS là !ª/·RFFXSDWLRQGHFHWWHSRVLWLRQLQVWLWXWLRQQHOOHLQFLWHDORUVQRPEUH
G·pOXVORFDX[jVHUDSSURFKHUGXGpSXWpYRLUHGHVRQSDUWLDÀQGHEpQpÀFLHU GH VHV VXEVLGHV RX GH VRQ VRXWLHQ GDQV OD FRQGXLWH GH O·DFWLRQ
publique. Sur la circonscription du littoral dunkerquois, Albert Denvers,
GpSXWpVRFLDOLVWHGHjSRXYDLWDJUpJHUDXWRXUGHVDSHUVRQQH
la grande majorité des maires des communes divers-droite de sa circonsFULSWLRQ©'RQFTXHOTXHVYLOOHVVRFLDOLVWHVSDVQRPEUHXVHVHWXQHQYLronnement de maires semi-ruraux, semi-urbains, puisque l’agglomération
dunkerquoise est constituée d’un tissu urbain dense, semi-urbain et rural.
'RQFVXUO·DLUHR$OEHUW'HQYHUVUD\RQQDLWF·pWDLHQWGHVPXQLFLSDOLWpV
“Denversistes”, modérées divers-droites qui avait tendance à voter pour
la droite lors des présidentielles, sauf Albert Denvers qui passait toujours
KDXWODPDLQORUVGHVOpJLVODWLYHVRXFDQWRQDOHV6DXIHQjO·pSRTXHGX
grand chambardement, il a gagné de peu contre un candidat député qui
n’était pas du secteur30ª
Le niveau de concurrence politique diminue, accroissant d’autant la
domination politique du député sur sa circonscription et, dans un second
temps, de l’entreprise partisane dont il est membre. Dans cette même circonscription, une vingtaine d’années après, on constate que le parti sociaOLVWH D HPSRUWp OD JUDQGH PDMRULWp GHV PXQLFLSDOLWpV © /D SDUWLFXODULWp
c’est que quand Albert Denvers a commencé sa croisade pour mettre en
SODFHOHVRFLDOLVPHVXUFHWHUULWRLUHF·HVWTX·LOQ·\DYDLWTXH*UDYHOLQHVTXL
pWDLWYUDLPHQWVRFLDOLVWHHWSXLVDXVVL&RXGHNHUTXH%UDQFKH<DYDLW6DLQW
Pol qui était rouge, communiste. Et tout le reste, c’était la droite et puis des
PRGpUpVGLYHUVGURLWHdDF·HVWG·DFFRUG"'HQYHUVHVWDUULYpHWSXLV
DFRQVWLWXpXQHSROLWLTXHHQWDQWTXHGpSXWp>@$YDQW'HQYHUVLO\DYDLW
rien de rose. Denvers a réussi à nous mettre en piste et tout est devenu
rose31. »$XPR\HQGHO·HQWUHSULVHSDUWLVDQHLOSHXWDORUVVXVFLWHUIDYRULVHU
voire entraver certaines candidatures aux élections municipales ou cantonales sur sa circonscription qui devient ainsi cet échelon intermédiaire de
la mobilisation militante et partisane envisagée dès le début du XXe siècle.
$LQVLFHSUpWHQGDQWjODIRQFWLRQPD\RUDOHDXVHLQGHVDFRPPXQHFKHI
lieu de canton, se doit de rechercher le soutien du député socialiste pour la
SURFKDLQHFRPSpWLWLRQpOHFWRUDOH©,PDJLQRQVGDQVVL[RXGDQVVHSWDQV
je me présente. Il est hors de question que je laisse le PC [être tête de liste].
0DLV0LFKHO>SUpQRPPRGLÀ[email protected]
%NTRETIEN AVEC UN ANCIEN DmPUTm SOCIALISTE DU .ORD ET ER SEPTEMBRE 0ARFOIS LES
IDENTITmS DES PERSONNALITmS POLITIQUES AVEC LESQUELLES DES ENTRETIENS ONT mTm EFFECTUmS NE SERONT PAS PRmCI
SmES DANS CE TEXTE QUE CE SOIT g LEUR DEMANDE ETOU POUR DES RAISONS DE NARRATION DE TRAJECTOIRES QUI PEUVENT
LA PLUPART DU TEMPS SE RmSUMER AUX PROPRImTmS GmNmRALES ¯ NON PRIVATIVES ¯ DES INDIVIDUS CONCERNmS
%NTRETIEN AVEC UN CONSEILLER GmNmRAL SOCIALISTE FmVRIER %NTRETIEN AVEC UN CONSEILLER GmNmRAL SOCIALISTE FmVRIER 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS HQPHGLVDQW´LOIDXWDEVROXPHQWTXH;>FRPPXQHGHKDELWDQWVFKHI
lieu de canton] soit PC pour le bien de l’ensemble”. Alors bien évidemment, je serai obligé de tenir compte de l’ensembleª2EWHQLUO·DFFRUGGX
député, c’est donc augmenter ses chances d’une part d’avoir l’investiture
du PS et d’autre part de gagner la compétition électorale à venir. Ainsi,
outre qu’il est en mesure d’agréger la grande majorité des élus locaux de
VDFLUFRQVFULSWLRQDXWRXUGHVDSHUVRQQHHWRXGHVRQSDUWLOHGpSXWpDSparaît également comme un élément incontournable pour la carrière politique d’un nouvel entrant sur la scène politique locale.
2UOHUHGpFRXSDJHHQGpSRVVpGDQWOHGpSXWpGHFHUWDLQHVFRPPXQHV
voire de certains cantons, vient remettre en cause la domination politique
de ce dernier sur la circonscription. Le député perd certains de ses soutiens
WDQGLVTXHGDQVOHPrPHWHPSVLOVHYRLWDGMRLQGUHGHVpOXVORFDX[SHXÀdélisés et dont par ailleurs les carrières politiques lui ont jusqu’alors échapSp/DSRVVLELOLWpG·XQFRQÁLWHQWUHOHGpSXWpHWFHVQRXYHDX[pOXVORFDX[
devient d’autant plus grand et accroît le risque d’une défaite électorale du
député sortant33$ÀQGHSDUHUjODSHUWHGHVDFLUFRQVFULSWLRQOHGpSXWp
en vient à politiser l’élection en mettant en avant son étiquette partisane.
De même, une fois l’élection passée, le député sortant battu attribue cette
défaite au seul redécoupage. Ainsi, cette ancienne députée recherche les
causes de son échec lors des législatives de 1988 dans le découpage réalisé
SDU&KDUOHV3DVTXDHQ©3DVTXDDYDLWUpLQVWDXUpOHVFUXWLQGHOLVWH
HW O·DGYHUVDLUH TXH M·DYDLV YDLQFX 0 ' VXU ; >FRPPXQH GH KDELWDQWVPpWURSROH [email protected] D UHJDJQp OHV pOHFWLRQV SDUFH TX·HQWUHWHPSV
Pasqua avait remodelé la circonscription et avait rajouté tout le centre de
Lille sur la circonscription. C’était une petite circonscription, je dois le reconnaître, donc c’était logique de l’étendre, mais comme par hasard c’était
sur le centre de Lille qu’on l’a étendue. Donc là j’ai été battueª3RXUWDQW
ce redécoupage Pasqua n’a pas empêché les victoires ultérieures d’un canGLGDWVRFLDOLVWHHQHWDXVHLQGHFHWWHPrPHFLUFRQVFULSWLRQ
%NTRETIEN AVEC UN SECRmTAIRE DE SECTION COMMUNE DE HABITANTSCHEFLIEU DE CANTON JUIN #´EST CE QUE VEUT SIGNI½ER CE DmPUTm COMMUNISTE LORSQU´IL EXPLIQUE ¦ 3I EN ON N´AVAIT PAS CHARCUTm MA
88)))E CIRCONSCRIPTION JE PENSE QUE L´ON AURAIT GARDm LE SInGE *´AI ANS DE VIE MILITANTE DANS L´AUTRE 88)))E ET
ICI QUELQUES MOIS %T CE QUI M´A LE PLUS BLESSm C´EST QUE CE DmCOUPAGE S´EST FAIT g LA ½N D´UN MANDAT *´AI VmCU
lA TRnS MAL ET JE DIRAIS QUE DANS CETTE CIRCONSCRIPTION JE ME SENS MOINS g L´AISE QUE DANS LA VRAIE 88)))E §.
¦ *EAN *AROSZ N´EST PAS CANDIDAT § ,A 3AMBRe AVRIL ,´ENQUoTmE FAIT ICI UNE ERREUR FACTUELLE PUISQUE #HARLES 0ASQUA A RmINSTAURm LE SCRUTIN UNINOMINAL
%NTRETIEN AVEC UNE ANCIENNE DmPUTmE NOVEMBRE # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS 5NE CENTRALISATION DE L´EXPERTISE PAR LES GRANDS mLUS
L’appel à une expertise propre du découpage des circonscriptions reOqYH GRQF HQ SDUWLH GH O·LQVWLWXWLRQQDOLVDWLRQ GDQV O·DSUqV GH O·HQsemble des présupposés territoriaux induits par les périodes antérieures.
La sociologie du personnel militant socialiste appelé à gérer les questions
pOHFWRUDOHV DX VHLQ GH FHUWDLQHV IpGpUDWLRQV SDU H[HPSOH OH 1RUG 3DULV
et le Bas-Rhin) traduit cette ambivalence de ressources à la fois générales
(une proximité avec les appareils décisionnels et l’expertise publique) et
particulières (car plus ou moins liées à un investissement dans le jeu local). Les différents secrétaires fédéraux en charge des élections qui se sont
VXFFpGpDXVHLQGHODIpGpUDWLRQGX1RUGGHFRQJUqVGH%RXUJHQ
%UHVVHjFRQJUqVGH5HLPVVHFDUDFWpULVHQWjODIRLVSDUOHW\SHGH
ressources politiques qu’ils détiennent, partisanes et peu territorialisées,
par leur position de sujétion à l’égard d’un grand élu, et par leur profession d’universitaire qui les incline à une interprétation experte de la carte
pOHFWRUDOH'HjOHVHFUpWDLUHIpGpUDODX[pOHFWLRQVHVW%HUQDUG
)ULPDW 1p HQ VD FDUULqUH SROLWLTXH GpEXWH j 9LOOHQHXYHG·$VFT HQ
tant qu’adjoint au maire, mandat qu’il exerce de 1977 à 1989. Il est élu en
DXFRQVHLOUpJLRQDOGRQWLORFFXSHODYLFHSUpVLGHQFHMXVTX·HQ
En 1989, des tensions au sein de la section de Villeneuve-d’Ascq à propos
de la constitution de la liste des municipales vont le contraindre à quitter
FHWWHVHFWLRQ/DIpGpUDWLRQGX3DUWLVRFLDOLVWHGX1RUGOXLSURSRVHDORUV
d’être la tête de liste à Valenciennes. Un élu du secteur revient sur ce paUDFKXWDJHTXLDOLHXSHXDYDQWOHVPXQLFLSDOHVGH©0DLVVDYLOOHVD
véritable ville, c’est Marcq-en-Barœul. Il est arrivé dans le valenciennois
SDUFHTX·LOpWDLWpOXDYDQWj9LOOHQHXYHG·$VFTHWTX·LO\DHXXQSUREOqPH
à Villeneuve-d’Ascq, et donc ils l’ont mis à Valenciennes37. »1pDQPRLQV
EDWWXHQHWHQHWGRQFFRQVHLOOHUPXQLFLSDOG·RSSRVLWLRQj9DOHQFLHQQHVLOGpFLGHGHGpPLVVLRQQHUGHVRQPDQGDWHQ2XWUHFHV
mandats locaux, il dispose également de mandats nationaux puisqu’il est
GpSXWpHXURSpHQGHjHWVpQDWHXUGHSXLV3DUDOOqOHPHQWj
FHVDFWLYLWpVSROLWLTXHVGHjGDWHGHVDUHWUDLWHLOHVWPDvWUHGH
conférences au sein de différentes universités lilloises. Lui succède Marc
'ROH]VHFUpWDLUHIpGpUDODX[pOHFWLRQVGHj1pHQLOGpEXWH
en politique en 1978, lorsqu’il devient l’assistant parlementaire de Bernard
'HURVLHUO·DFWXHOSUpVLGHQWGXFRQVHLOJpQpUDOGX1RUGHWGHSXLV
,A SOCIOGRAPHIE DES SECRmTAIRES FmDmRAUX CHARGmS DES mLECTIONS AU SEIN DES &mDmRATIONS DU .ORD DE 0ARIS ET
DU "AS2HIN A mTm RmALISmE g PARTIR D´ENTRETIENS ET DU TRAITEMENT D´ARCHIVES NON CLASSmES DISPONIBLES AU SInGE
DE CES TROIS FmDmRATIONS
%NTRETIEN AVEC UN ADJOINT AU MAIRE D´UNE COMMUNE DE HABITANTS ET SECRmTAIRE DE SECTION ER JUILLET
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS 1998) et député de l’agglomération lilloise (depuis 1978). Battu en 1983,
HWDX[pOHFWLRQVPXQLFLSDOHVj'RXDLLOHVWGpVLJQpFRPPH
FDQGLGDWHQSXLVpOXGHjFRQVHLOOHUUpJLRQDOGX1RUG3DV
GH&DODLV (Q LO VH SUpVHQWH GDQV OD ;9,,e circonscription (Douai).
Élu en 1988, battu en 1993, il est réélu député dans cette même circonsFULSWLRQHQHW(QRXWUHDSUqVDYRLUpWpVHFUpWDLUHIpGpUDO
chargé des élections, il accède en 1997 au poste de Premier secrétaire fédéUDOIRQFWLRQTX·LOFRQVHUYHMXVTX·HQ2XWUHVHVDFWLYLWpVSROLWLTXHVLO
fut, tout comme Bernard Frimat, maître de conférences, mais à l’université
d’Artois. Pour succéder à Marc Dolez en 1997, la fédération désigne MarWLQH)LOOHXOQpHHQTXLHVWUHFRQGXLWHjFHWWHIRQFWLRQMXVTX·HQ
Présente sur la liste des municipales à Lille en 1989 en position non éligiEOHHOOHDFFqGHSDUODVXLWHDXFRQVHLOPXQLFLSDOG·DERUGHQFRPPH
FRQVHLOOqUHPXQLFLSDOHSXLVHQHWFRPPHDGMRLQWHDXPDLUH(Q
HOOHHVWpOXHFRQVHLOOqUHUpJLRQDOHGX1RUG3DVGH&DODLVFHTXLOXL
SHUPHW G·DFFpGHU j OD YLFHSUpVLGHQFH GH FHWWH LQVWLWXWLRQ (Q pOXH
sur le canton du Vieux-Lille, elle démissionne du conseil régional et deYLHQWYLFHSUpVLGHQWHGXFRQVHLOJpQpUDOGX1RUG­O·RULJLQHLQJpQLHXUGH
UHFKHUFKHDX&156HOOHHVWDFWXHOOHPHQWHQVHLJQDQWHHWFKHUFKHXVHHQVRciologie à l’École d’architecture de Lille. Le successeur de Martine Filleul
DXVHFUpWDULDWIpGpUDOFKDUJpGHVpOHFWLRQVHVW3DWULFN.DQQHU&HOXLFLIXW
successivement secrétaire de la section de Lille-centre (dont Pierre MauUR\HVWO·XQGHVPHPEUHVHPEOpPDWLTXHVHWGHSXLVVHFUpWDLUHGX
FRPLWpGHYLOOHTXLUpXQLWOHVGL[VHFWLRQVOLOORLVHVUHJURXSDQWHQYLURQ
GHVHIIHFWLIVGHODIpGpUDWLRQGX1RUGeOXDXFRQVHLOPXQLFLSDOGH/LOOH
en 1989, il occupe depuis cette date la fonction d’adjoint au maire. Depuis
1998, il est élu conseiller général dans le canton de Lille-sud-ouest et deYLHQWYLFHSUpVLGHQWGXFRQVHLOJpQpUDO(QÀQDGPLQLVWUDWHXUWHUULWRULDOj
la mairie de Lille dans les années 1980-1990, il est actuellement chargé de
cours à l’université de Lille 3. Les trajectoires de ces différents secrétaires
fédéraux chargés des élections nous renseignent doublement. D’une part,
on constate que leurs ressources politiques sont moins attachées à un territoire qu’à une entreprise partisane. Ainsi, leurs premiers ou principaux
mandats électifs ont été obtenus à la faveur de leur placement en position éligible sur une liste (régionale, européenne, sénatoriale, municipale),
dans lequel les instances partisanes jouent un rôle déterminant. Dès lors,
pris dans des logiques partisanes structurant leurs carrières politiques,
leurs prises de position apparaissent d’autant plus liées à celles de la fédération, dominée par les élus de l’agglomération lilloise38 et notamment par
,ES SECTIONS DE L´AGGLOMmRATION LILLOISE REPRmSENTENT ENTRE ET ENTRE ET DES EFFECTIFS MILI
TANTS DE LA FmDmRATION
# DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS OHSUHPLHUG·HQWUHHX[OHPDLUHHWSUpVLGHQWGHOD&RPPXQDXWpXUEDLQH
GH /LOOH 3LHUUH 0DXUR\ SXLV 0DUWLQH$XEU\ '·DXWUH SDUW RQ FRQVWDWH
pJDOHPHQWTXHWRXVRFFXSHQWXQHIRQFWLRQDXVHLQGHO·XQLYHUVLWpPDvWUH
de conférences, chargé de cours, etc. Ces dispositions universitaires favorisent alors l’expression d’une expertise c’est-à-dire un rapport aux enjeux
électoraux à la fois emprunt de distance et de professionnalisme.
(QFRPSDUDLVRQDYHFODIpGpUDWLRQGX1RUGOHVHFUpWDLUHIpGpUDOFKDUJp
des élections au sein de la fédération de Paris n’existe que depuis peu de
WHPSV (Q HIIHW GH j RQ QH FRPSWH DXFXQ VHFUpWDLUH IpGpUDO
chargé des élections à la fédération de Paris. Le premier à occuper ce poste
GHjHVW-pU{PH&RXPHW1pHQLOIXWGHODÀQGHVDQQpHV
j O·XQ GHV GHX[ SHUPDQHQWV GH OD IpGpUDWLRQ DX PRPHQW R
-HDQ0DULH/H*XHQHQpWDLWOH3UHPLHUVHFUpWDLUH'HjLOHVW
élu conseiller de Paris et premier adjoint au maire du 13e arrondissement,
DYDQWG·HQGHYHQLUHQOHPDLUH/He arrondissement correspond
grosso modo aux limites de la circonscription législative de Jean-Marie
/H*XHQ(QRXWUHFHGHUQLHUHVWOHOHDGHUGHO·XQHGHVGHX[VHFWLRQVGX
13e arrondissement (la plus importante en nombre d’adhérents) ce qui lui
SHUPHWGHWHQLUOHVLQYHVWLWXUHVDXVHLQGHO·DUURQGLVVHPHQW©6L'HODQRs
GLW´OHFLHOHVWEOHXµHWTXHPRLMHGLV´OHFLHOHVWJULVµHWTXHTXHOTXHV
PpODQFKRQLVWHVGLVHQW´OHFLHOHVWMDXQHµPDVHFWLRQQHGLUDFHUWDLQHPHQW
SDV´OHFLHOHVWMDXQHµQL´OHFLHOHVWEOHXµQL´EOHXJULVµPDLVHOOHGLUD
“gris tout court”. Si après, par contre, j’accepte un peu de bleu alors, oui,
ma section pourra accepter un peu de bleu39ª&RQWU{ODQWOHVLQYHVWLWXUHV-HDQ0DULH/H*XHQDSSDUDvWHQPHVXUHG·LPSRVHU-pU{PH&RXPHWDX
sein de sa section et de la fédération. L’accès de ce dernier au secrétariat
fédéral chargé des élections résulte alors moins de la force de son implantation territoriale au sein d’un arrondissement que d’une proximité entreWHQXHDYHFXQpOXGRQWLOHVWIXWO·DX[LOLDLUH3DUDLOOHXUV-pU{PH&RXPHW
présente la caractéristique d’avoir été l’un des deux permanents de la fédération de Paris ; or, de par les tâches qui lui incombent, le permanent
accède aux coulisses de la vie politique parisienne. Disposant d’une vue
SOXVJOREDOHGHVUDSSRUWVLQWHUHWLQWUDSDUWLVDQVVRQDQDO\VHGHODFDUWH
électorale se fait alors plus professionnelle.
Au sein de la fédération du Bas-Rhin, nous n’avons pas été en mesure
de retrouver l’ensemble des noms des secrétaires fédéraux chargés des
élections de 1983 à nos jours du fait de l’absence d’une politique d’archiYDJHSDUODIpGpUDWLRQ1pDQPRLQVSDUPLOHVGRFXPHQWVUHWURXYpVGHX[
QRPVDSSDUDLVVHQW/HSUHPLHU-HDQ2HKOHUIXWVHFUpWDLUHFKDUJpGHVpOHFWLRQVGHj²WRXWDXPRLQV1pHQHWVHUUXULHUGHSURIHVVLRQ
%NTRETIEN AVEC *EAN-ARIE ,E 'UEN JUIN 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD (Ò 'REGORY -!'.). "LAISE -!249 4HOMAS LOFRPPHQFHSDUPLOLWHUGDQVOHVDQQpHVDXVHLQGXV\QGLFDW&)7&
puis CFDT, ainsi qu’à l’Action catholique ouvrière. En 1971, il entre au
parti socialiste et se retrouve sur la liste lors des élections municipales de
1971 et 1977. En 1983, il prend la tête de la liste socialiste à Strasbourg.
Battu, il devient conseiller municipal d’opposition. Quelques temps auparavant, en 1979, il est élu conseiller général de Strasbourg, puis, la même
DQQpHGpSXWpHXURSpHQ(QLOPHWÀQjSUqVGHWUHQWHDQVG·DEVHQFH
de représentation socialiste bas-rhinoise au sein de l’Assemblée nationale
HQ UHPSRUWDQW OD GHX[LqPH FLUFRQVFULSWLRQ GX %DV5KLQ 5ppOX HQ avec Catherine Trautmann, il est de nouveau en 1988 le seul député soFLDOLVWHGXGpSDUWHPHQW3XLVGHjLOHVWpOXDGMRLQWVRFLDOLVWHj
ODPDLULHGH6WUDVERXUJ,OÀJXUHSDUPLOHVUHIRQGDWHXUVGHODIpGpUDWLRQ
EDVUKLQRLVH TX·LO GLULJH G·DLOOHXUV GH j $\DQW FRQQX OD IRUWH
emprise des partis de droite au sein de ce département, il se montre très
DWWDFKpDX©WUDYDLOGHWHUUDLQª©0RLM·DLSOXW{WD[pOHWUDYDLOVXUla présence sur le terrainÈWUHSUpVHQWGDQVOHVFDQWRQVDYHFGHVJHQVTXLIRQW
du travail sur leur lieu de vie et de construire le parti socialiste à partir de
la présence sur le terrain. Le rêve est formidable… le rêve est formidable.
Les jeunes, ils aiment bien le débat mais l’engagement sur le terrain…
$SUqV RQ SHXW SHXW rWUH XQ SHX SURÀWHU TXDQG RQ HVW XQ SHX SUpVHQW
SURÀWHUGHO·LPSODQWDWLRQVXUOHWHUUDLQSDUFHTXHHQIDFHLO\DTXHOTXH
chose. […] Mais c’est pas la façon dont on se chamaille encore aujourd’hui
TX·RQYDJDJQHU1HSDVRXEOLHUOHWUDYDLOGHWHUUDLQª'HSDUVRQQLYHDX
de diplôme, les modalités de son accès à l’arène politique et son rapport
à la compétition électorale, il apparaît alors moins comme un expert que
doté de savoirs appris dans et par la pratique militante. Un de ces succesVHXUVjFHSRVWHHVW2OLYLHU%LW]QpHQHWHQFKDUJHGHFHVHFUpWDULDW
IpGpUDOGHSXLV8QHIRLVVHVpWXGHVWHUPLQpHVLOHQWUHDXVHUYLFHGH
GLIIpUHQWVpOXVDVVLVWDQWGXJURXSH36DXFRQVHLOUpJLRQDOG·$OVDFHG·$Umand Jung, député du Bas-Rhin, membre du cabinet de Jean-Marie Bockel
j0XOKRXVHDVVLVWDQWGH5RODQG5LHVVpQDWHXUGX%DV5KLQ(QLO
est élu adjoint au maire de Strasbourg et remporte l’un des cantons strasbourgeois. Très investi dans le parti, il fut secrétaire de différentes sections
strasbourgeoises (dont celle de Roland Ries) et l’un des animateurs du
FRXUDQW1RXYHDXSDUWLVRFLDOLVWHHQWUHHW(QÀQWLWXODLUHG·XQ
DEA, il a commencé une thèse en droit qu’il n’a jamais terminée. Sa trajectoire met en évidence le caractère très prononcé de sa professionnalisation
SROLWLTXH'·DLOOHXUVOXLPrPHFRQVWDWDLW©,OQHW·DSDVpFKDSSpTXHFH
qui a été un engagement personnel et militant est devenu depuis cinq ou
3OULIGNm PAR NOUS
%NTRETIEN AVEC *EAN /EHLER JUIN # DE 2%#)43 $mCOUPAGE DES CIRCONSCRIPTIONS AU PARTI SOCIALISTE DEPUIS six ans mon métier. Quand tu es collaborateur politique à tes débuts, ce
n’est plus seulement ton engagement militant perso, c’est les déjeuners,
c’est le matin on fait de la politique, le midi on fait de la politique et le soir
RQIDLWHQFRUHGHODSROLWLTXHjWLWUHPLOLWDQW,OQ·\DSOXVGHIURQWLqUHGH
césure tellement entre militantisme et activité professionnelle. Moi-même
parfois je ne sais plus quelle casquette j’ai sur la tête. Tu vois ce que je veux
dire (rires). La casquette professionnelle, pour moi ça va au-delà, de par
mon job, ça va au-delà du simple militantisme et de l’engagement professionnelª$LQVLRQSHXWFRQVWDWHUOHVHIIHWVGHVDSRVLWLRQG·DX[LOLDLUHGH
différents élus socialistes sur son rapport au parti, au militantisme, mais
aussi aux territoires politiques qu’il envisage sous un angle professionnel.
En outre, assistant et secrétaire de la section de Roland Ries durant quatre
ans, il est d’autant plus disposé à défendre les intérêts de celui qui est deSXLVPDLUHGH6WUDVERXUJ
L’étude des différents secrétaires fédéraux chargés des élections au sein
GHV IpGpUDWLRQV GX %DV5KLQ GH 3DULV HW GX 1RUG QRXV UHQVHLJQHQW VXU
la professionnalisation des carrières des cadres des instances partisanes,
H[FHSWLRQIDLWHGH-HDQ2HKOHU&HWWHSURIHVVLRQQDOLVDWLRQLQGXLWDORUVXQ
rapport d’expertise à la carte électorale, d’autant plus marqué au sein de
ODIpGpUDWLRQGX1RUGTXHVHVVHFUpWDLUHVIpGpUDX[VRQWpJDOHPHQWGHVXQLversitaires. Par ailleurs, la professionnalisation de leurs carrières accroît
l’emprise des élus d’agglomération de grande taille (donc en mesure de
professionnaliser nombre de militants) sur ces cadres fédéraux qui sont ou
qui ont été leurs assistants. Ces derniers sont alors d’autant plus enclins
jGpIHQGUHOHVSRVLWLRQVGHVJUDQGVpOXV$XÀQDOHWPDOJUpO·RSSRVLWLRQ
entre le regard assez indifférencié du début du XXe siècle et le souci du local
actuel, on remarquera qu’une convergence est possible au niveau de la
départementalisation des ressources électorales. Si celle-ci se faisait hier
depuis l’échelon interne fédéral, générant de fait une faible attention aux
circonscriptions infra-départementales, elle devient aujourd’hui plus un
enjeu d’élus, articulé autour d’un souci constant de l’équilibre desdites circonscriptions. Il va de soi que la technique même du découpage électoral
devient moins un enjeu de lutte idéologique qu’un instrument de négociation interpartisan. L’attitude du parti socialiste au cours du processus de
GpFRXSDJHDPRUFpSDUODFRPPLVVLRQ*XpQDHQHWFO{WSDUOHVGpEDWV
SDUOHPHQWDLUHVGHO·DXWRPQHKLYHUODLVVHDLQVLjSHQVHUTXHOHV
présupposés territoriaux (départementalisation des ressources électorales,
articulation des circonscriptions…) acquis au cours d’un siècle d’histoire
partisane sont désormais routiniers parce que standardisés, standardisés
parce que routiniers.
%NTRETIEN AVEC /LIVIER "ITZ MARS 5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,ISTE DES AUTEURS ,ISTE DES AUTEURS
bTIENNE $ELAIRE
Docteur en histoire des techniques, Centre François-Viète, faculté des
VFLHQFHVHWGHVWHFKQLTXHVXQLYHUVLWpGH1DQWHV
!NTOINE $EROUET
'RFWRUDQW &HQWUH 0DXULFH+DOEZDFKV &156(+(66(16 eTXLSH
3URIHVVLRQV5pVHDX[2UJDQLVDWLRQV
-ARIE0IERRE %SCUDIm
'RFWRUDQWH*5(3+,(3GH/\RQ672,&$,16$GH/\RQ
!NDREW &EENBERG
&DQDGD5HVHDUFK&KDLULQ3KLORVRSK\RI7HFKQRORJ\6FKRRORI&RPPXQLFDWLRQ6LPRQ)UDVHU8QLYHUVLW\
!NTONY &IANT
Maître de conférences en études cinématographiques à l’université RenQHV²+DXWH%UHWDJQH
,AURENT 'ARREAU
5HVSRQVDEOHGXIRQGVDXGLRYLVXHOGX6&(5(1&1'3
'REGORY (}
*URXSHGHVRFLRORJLHSROLWLTXHHXURSpHQQH&156805XQLYHUVLWp
de Strasbourg), ATER en science politique à l’université de Strasbourg.
9VES#LAUDE ,EQUIN
Agrégé d’histoire, Université de technologie de Belfort-Montbéliard
(UTBM).
"LAISE -AGNIN
*URXSHG·DQDO\VHSROLWLTXH8QLYHUVLWp3DULV2XHVW$7(5HQVFLHQFHSROLWLTXHjO·8QLYHUVLWpGH3DULV2XHVW
4HOMAS -ARTY
*URXSHG·DQDO\VHSROLWLTXHHW*URXSHGHVRFLRORJLHSROLWLTXHHXURSpHQQH
chargé de cours en science politique à l’université de Strasbourg et à l’université de Franche-Comté.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD ,ISTE DES AUTEURS 2OBERT %DGARD .DONG
Docteur en histoire – Laboratoire de recherche historique Rhône-Alpes
/$5+5$
8058QLYHUVLWp/XPLqUH/\RQ
!NNA 0ELLEGRINO
Chercheur à contrat auprès du Département d’histoire de l’université de
Padoue (Italie), chercheur associé auprès du Centre d’histoire des techniTXHVHWGHO·HQYLURQQHPHQWGX&1$0
&RANCIS 0mROZ
3URIHVVHXUDXO\FpH&RXUEHWGH%HOIRUWFKHUFKHXUDVVRFLpDXODERUDWRLUH
RÉCITS.
4ANGUI 0ERRON
Chargé du patrimoine audiovisuel et de l’action culturelle à Périphérie,
centre de création documentaire (soutenu par le département de la SeineSaint-Denis et la région Île-de-France).
0ASCAL 2OBERT
Professeur à l’École nationale supérieure maritime, chercheur associé au
&HQWUH)UDQoRLV9LqWH²($²XQLYHUVLWpGH1DQWHV
,UC 2OJAS
Docteur en histoire des techniques, ingénieur de recherche et chargé de
cours, Université Jean-Monnet, Saint-Étienne.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS 2mSUMmS
!NNA 0ELLEGRINO
2mSUMm
Dans la seconde moitié du XIXe siècle, les expositions internationales représentent un des moments clé de la promotion et de la valorisation d’idées et de conceptions liées au monde de l’industrie et du travail. Elles réalisent, selon des études
récentes, un network de relations et de communications d’une importance fondaPHQWDOHVXUOHSODQVFLHQWLÀTXHWHFKQRORJLTXHHWLQGXVWULHODLQVLTXHVXUOHSODQ
SROLWLTXHHWVRFLDO2QDORQJWHPSVSHQVpTXHOHVSURWDJRQLVWHVHWGHVWLQDWDLUHVGH
FHPHVVDJHpWDLHQWOHVFODVVHVERXUJHRLVHVOHVFODVVHVPR\HQQHVLQYLWpHVFRPPH
VSHFWDWULFHVGHVQRXYHDX[V\PEROHVGHODUHOLJLRQGXSURJUqVPDLVUpFHPPHQW
O·KLVWRULRJUDSKLHDSRVpOHSUREOqPHGHVGLIIpUHQWVW\SHVG·©DSSURSULDWLRQªHWGH
©UpFHSWLRQªGXSKpQRPqQHSDUOHVGLIIpUHQWHVFODVVHVVRFLDOHVGHVFODVVHVGLULgeantes qui organisent d’un point de vue bureaucratique, administratif et juridique chaque événement, aux producteurs qui exposent, jusqu’aux fractions numéULTXHPHQWVLJQLÀFDWLYHVGHFODVVHVODERULHXVHVLQYLWpHVj\SUHQGUHSDUWFKRLVLHV
et sélectionnées par des commissions spécialement constituées à cet effet. Cette
participation produisait des documents qui sont parvenus jusqu’à nous. La phase
préparatoire de l’excursion impliquait en effet sur une période de temps assez
longue non seulement les institutions promotrices mais aussi les ouvriers eux-mêPHV1RXVDQDO\VHURQVGDQVFHWDUWLFOHODGRFXPHQWDWLRQUHODWLYHjRXYULHUV
ÁRUHQWLQVLQYLWpVjO·H[SRVLWLRQ,QWHUQDWLRQDOHGH0LODQHQHWFHOOHUHODWLYHj
WUDYDLOOHXUVORPEDUGVLQYLWpVjO·H[SRVLWLRQGH3DULVGH/·DQDO\VHVHUD
centrée tout d’abord sur le degré d’instruction générale et professionnelle de ces
deux groupes, à travers la source des demandes que les ouvriers présentaient aux
comités organisateurs pour être choisis ; nous présenterons ensuite certains matériaux relatifs aux deux corpus documentaires (les comptes rendus des ouvriers),
DÀQ GH IDLUH UHVVRUWLU GHV DIÀQLWpV HW GHV GLYHUJHQFHV VLJQLÀFDWLYHV QRWDPPHQW
par rapport au tissu organisationnel et associatif du milieu ouvrier local.
!BSTRACT
In the second part of the nineteenth century international exhibitions are key moments
in the promotion and furtherance of the ideas and conceptions of the world of industry and
ZRUN7KHSURWDJRQLVWVDQGUHFLSLHQWVRIWKHPHVVDJHKDYHORQJEHHQLGHQWLÀHGZLWKWKH
bourgeoisie, the middle classes being the spectators of the new symbols of this religion of
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS progress. However, recently, historiography has raised the problem of the varied types of
‘appropriation’ and ‘fruition’ of the phenomenon by the different social classes: the ruling
classes that organize each event from a bureaucratic, administrative and legal point of
YLHZWKHSURGXFHUVZKRH[KLELWGRZQWRDVLJQLÀFDQWQXPEHURIZRUNLQJFODVVSHRSOH
invited to participate by appropriate selecting committees. Such participation entailed the
production of documents that are available to us. Indeed the preparatory phase of the trip
involved, for a relatively long time, not only the various organizing institutions, but also
the workers themselves. In this paper I examine the documentation concerning 133 Florentine workers sent to the International Exhibition in Milan in 1906, and the one concerning
154 Lombard workers sent to the Universal Exhibition in Paris in 1889. My analysis will
IRFXVÀUVWRQWKHGHJUHHRIJHQHUDODQGSURIHVVLRQDOHGXFDWLRQRIWKRVHWZRJURXSVWKH
source examined will be the applications the workers had sent to the committees in order to
be selected. Then I study the two documentary corpora (the workers’ reports), so as to point
RXW DIÀQLWLHV DQG UHOHYDQW GLIIHUHQFHV LQ WKH GRPDLQ RI WKHLU WHFKQLFDO DQG SURIHVVLRQDO
culture and in the context of the local workers’ organizations.
-OTSCLmS
ouvrier, exposition universelle, technique, progrès, métier, identité, travail, cultures
+EYWORDS
worker, International exhibition, technology, progress, craft, identity, work, cultures
# DE 2%#)43 2mSUMmS !NTOINE $EROUET
2mSUMm
Durant le XXeVLqFOHGLIIpUHQWVFRXUDQWVGHSHQVpHVD\DQWWUDYHUVpODSURIHVVLRQ
d’ingénieur ont proposé leur interprétation de ce que devaient être les enseignements non techniques dans la formation du praticien. À travers les années le sens
FRQIpUpjFHWWHIRUPDWLRQDYDULpPDLVO·DUJXPHQWGHOD©QpFHVVLWpG·LQWURGXLUHª
des enseignements correspondants s’est maintenu tout en se parant du cachet de
la nouveauté permanente. Derrière ces différentes visions, le projet sans cesse renouvelé de former l’ingénieur total, à qui la légitimité technique donnerait une
SRVLWLRQVRFLDOHTX·LOIDXGUDLWMXVWLÀHUSDUOHVDFWHVHWTXLV·pPDQFLSHUDLWDLQVLGH
la seule activité technique. Le siècle dernier a été tout particulièrement propice à
O·pWDEOLVVHPHQWG·XQWHOGpEDWTXLDUpLQWHUSUpWpOHVOLPLWHVGHVVHXOHV+XPDQLWpV
SUpVHQWHVGqVO·RULJLQHDXVHLQGH*UDQGHVeFROHVWHQGDQWjIRUPHUOHVpOLWHV/H
dépassement de l’identité classique de l’ingénieur a produit un cadre permettant
de penser progressivement ces enseignements non techniques. L’approche sociologique proposée ici tente de mettre en perspective cette grille de lecture avec
une actualité qui voit les formations d’ingénieurs questionnées de nouveau sur ce
point, et dans des termes sensiblement identiques, bien que modernisés.
!BSTRACT
During the 20th century, there were several schools of thought in the engineering
profession, each with its own interpretation of the required non-technical part in the training of an engineer. The absolute ‘necessity’ of ‘providing this training’ appears to be remarkably constant throughout years although the meanings given to this training varied
greatly and were always presented as novelties. Behind these various visions, there is the
same ever-renewed project of training the perfect engineer, who would gain a social position thanks to a technical legitimacy which he would have to prove with acts. The profession would thus transcend purely technical expertise. During the past century there was
considerable debate on that subject. The scope of the Humanities – taught from the very
EHJLQQLQJLQWKHpOLWHWUDLQLQJ¶*UDQGHVeFROHV·²ZDVUHGHÀQHGDQGH[SDQGHG7KLVZLGHU
GHÀQLWLRQRIWKHHQJLQHHUFUHDWHGDQHZIUDPHZRUNLQZKLFKQHZFRQFHSWLRQVRIWKHQRQ
technical training appeared. The sociological approach proposed here, aims to consider this
framework in the perspective of the current debate on the training of engineers, in which
the same terms – although modernized – are being used.
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS -OTSCLmS
ingénieur, enseignement supérieur, élites, idéologie, profession, cadres, humanités
+EYWORDS
engineers, higher education, élites, ideology, profession, executive, the humanities
# DE 2%#)43 2mSUMmS -ARIE 0IERRE %SCUDIm
2mSUMm
&HWDUWLFOHVHSURSRVHG·pWXGLHUODSHQVpHGH*DVWRQ%HUJHUHWVRQDFWLRQHQ
WDQWTXH'LUHFWHXUJpQpUDOGHO·(QVHLJQHPHQWVXSpULHXU,OLQWHUURJHOD
promotion des sciences humaines et sociales par notre penseur, dans un contexte
de changement politique profond dans le domaine de l’enseignement supérieur
et de la recherche. En expliquant les points principaux de la pensée prospective
GH*DVWRQ%HUJHUDLQVLTXHVDFRQFHSWLRQGHODWHFKQLTXHQRXVIRUPXORQVFRPPH
K\SRWKqVHODQpFHVVLWpGHFUpHUO·,QVWLWXW1DWLRQDOGHV6FLHQFHV$SSOLTXpHVj/\RQ
HQDÀQGHIRUPHUXQ©OLHXªDGpTXDWDXGpYHORSSHPHQWGHVVFLHQFHVKXmaines et sociales en relation avec la technique. Du point de vue politique, cette
action se caractérise par une volonté de réorganisation de la société, inscrite dans
ODWUDGLWLRQUpIRUPLVWHHWKXPDQLVWHG·XQH©SROLWLTXHGHO·HVSULWª
!BSTRACT
This paper studies the thoughts and actions of Gaston Berger, as Director General
for Higher Education (1953-1960). It questions his promoting the humanities and social
VFLHQFHV DWDWLPHZKHQWKHÀHOGRIKLJKHUHGXFDWLRQDQGUHVHDUFKXQGHUZHQWSURIRXQG
policy changes.
By explaining the key points of Gaston Berger’s prospective thoughts, as well as his
conception of technique, we put forward the hypothesis that the creation of INSA (National Institute of Applied Science) in Lyons in 1957 was a necessity in order to create
an appropriate ‘venue’ where the relations between the humanities, social sciences and
technology might develop. From a political point of view, this action is characterized by
the will to reorganize society which is part of the reformist and humanist tradition of a
‘politics of spirit’.
-OTSCLmS
*DVWRQ%HUJHUVFLHQFHVKXPDLQHVHWVRFLDOHVSURVSHFWLYHDFWLRQpGXFDWLRQ,16$KXPDQLVPHSROLWLTXHGHO·HVSULW
+EYWORDS
Gaston Berger (1896-1960), the humanities and social sciences, prospective, action, education, INSA, humanism, politics of spirit
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS ,UC 2OJAS
2mSUMm
/HVFRQÁLWVDUPpVVRQWELHQVRXYHQWO·RFFDVLRQGHVWLPXOHUODSURGXFWLRQGH
FHUWDLQVEDVVLQVLQGXVWULHOV/D3UHPLqUH*XHUUHPRQGLDOHSULYHOD)UDQFHGHO·DSSRUWGX1RUG3DVGH&DODLVGDQVO·HIIRUWGHJXHUUH/HFRQÁLWHQTXHVWLRQREOLJH
les autorités françaises à doper les autres centres de production d’armement encore disponibles. Le département de la Loire demeure l’un des lieux de production les plus actifs durant la période, toutes les industries locales sont mises à
contribution. Le charbon de terre est encore le pain de l’industrie, élément central
de l’activité métallurgique et de la production d’armes, les houillères ligériennes
doivent donc fortement augmenter leur production. Ces entreprises se trouvent
FRQIURQWpHVjXQSUREOqPHGHWDLOOHFRPPHQWDXJPHQWHUGHPDQLqUHVLJQLÀFDtive, l’extraction sans mettre en péril l’avenir du gisement et de l’entreprise ? Deux
UpSRQVHVVHGHVVLQHQWDXÀOGHVDQQpHVGHJXHUUHODPLVHHQSODFHG·XQQRXYHO
aménagement du territoire minier et l’innovation technique.
!BSTRACT
4XLWHRIWHQDUPHGFRQÁLFWVDUHRSSRUWXQLWLHVWRERRVWSURGXFWLRQLQVRPHLQGXVWULDO
basins. During the First World War France’s war effort lacks the contribution of the North
3DVGH&DODLVDUHD7KHFRQÁLFWFDXVHV)UHQFKDXWKRULWLHVWRJLYHDERRVWWRWKHRWKHUDUmament production centres still available. The Loire département remains one of the most
active production places during the period; all the local industries are put to contribution.
Once again coal is a central element of the metalworking activity and the production of
weapons. Therefore, Ligerian coal companies have to increase their output considerably.
7KHVHÀUPVDUHIDFHGZLWKDQLPSRUWDQWSUREOHPKRZWRLQFUHDVHH[WUDFWLRQVLJQLÀFDQWO\
ZLWKRXWHQGDQJHULQJWKHIXWXUHRIWKHGHSRVLWDQGRIWKHÀUP"7KURXJKRXWZDU\HDUVWZR
answers gradually become obvious: setting up a new development policy for coal mining
and technical innovation.
-OTSCLmS
bassin houiller, XIXeVLqFOH3UHPLqUH*XHUUHPRQGLDOHDPpQDJHPHQWGXWHUULWRLUH
minier, innovation technique, Saint-Étienne
+EYWORDS
FRDOÀHOGth century, First world War, mining regional development, technical innovation, Saint-Étienne
# DE 2%#)43 2mSUMmS 2OBERT %DGARD .DONG
2mSUMm
/D&RPSDJQLHGHV0LQHVG·8UDQLXPGH)UDQFHYLOOH&208)QHQDvWSDVex
nihilo. Elle est la conséquence première de la découverte du gisement économiTXHPHQW YLDEOH GH 0RXQDQD *DERQ HQ SDU OH &($ 6D QDLVVDQFH LQWHUYHQXHHQHVWUHQGXHSRVVLEOHSDUOHPDULDJHGHVLQWpUrWVGX&($DYHFFHX[
de plusieurs groupes privés bancaires, chimiques et industriels français. Jugée
UHQWDEOHSDUVRQFRQVHLOG·DGPLQLVWUDWLRQOD&208)GpPDUUHRIÀFLHOOHPHQWVRQ
DFWLYLWpHQ8QHDFWLYLWpTX·HOOHHVWORLQGHFRQWU{OHUHQWLqUHPHQW(IIHFWXpH
DX*DERQO·DFWLYLWpLQGXVWULHOOHHVWHIIHFWLYHPHQWJpUpHSDUOD&208)HOOHPrPH
/·DFWLYLWpFRPPHUFLDOHTXDQWjHOOHOXLpFKDSSH(OOHHVWO·DIIDLUHG·DXWUHVHQWLWpV
le CEA, à qui les ventes sont prioritairement destinées, et les autorités françaises.
$XIRQGO·H[SORLWDWLRQGHO·XUDQLXPpFKDSSHDX*DERQSURSULpWDLUHOpJDOGXVRO
et du sous-sol.
!BSTRACT
The &RPSDJQLHGHV0LQHVG·8UDQLXPGH)UDQFHYLOOH&208), a uranium mining company, was not created ex nihilo. It resulted from the discovery of the cost-effective
deposit in Mounana (Gabon), in 1956 by the CEA. Its creation in 1958 was made possible
by the joint interests of CEA, several private banking groups and French chemical indusWULHV&RQVLGHUHGSURÀWDEOHE\LWVERDUGRIGLUHFWRUV&208)RIÀFLDOO\VWDUWHGLWVEXVLQHVV
in 1961, but it was far from controlling its operations. Its industrial activity in Gabon was
effectively managed by &208) itself. Commercial activity was out of its hands being
managed by the other entities: the CEA, who handled sales, and the French authorities.
Basically, Gabon, legal owner of the soil and subsoil, did not control the mining of its
uranium.
-OTSCLmS
&($XUDQLXP&208)0RXQDQDH[SORLWDWLRQFRPPHUFLDOLVDWLRQ*DERQ)UDQFH
+EYWORDS
CEA, uranium, COMUF, Mounana, operations, marketing, Gabon, France
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS 0ASCAL 2OBERT
2mSUMm
Cet article expose les choix industriels, la circulation des idées, le transfert de
technologies liées à la conception et à la réalisation d’un navire exceptionnel. Il
UHWUDFH OH ORQJ SURFHVVXV GH GpFLVLRQ TXL DIÀQH SHX j SHX FH SURMHW JUDQGLRVH
IDLWpWDWGHVLQWHUURJDWLRQVGHVLQJpQLHXUVHWGHVGLULJHDQWVHWLOOXVWUHODGLIÀFXOWp
d’innovation dans un milieu convaincu par le poids de l’expérience. Cependant,
les hommes conduisant ce projet savent, à la lumière des informations qu’ils collectent, faire preuve d’audace en extrapolant jusqu’à des limites jamais atteintes
un ensemble de technologies novatrices. C’est ainsi que le paquebot Normandie,
GHYLHQWXQHV\QWKqVHGHVWHFKQLTXHVDXVRPPHWGHOHXUDUWHWOHIDLWHQWUHUPDOJUp
une courte carrière, dans le cercle très restreint des paquebots de légende.
!BSTRACT
This article outlines the industrial choices, the movement of ideas and the transfer
of technologies related to the design and construction of an exceptional ship. It describes
WKHORQJGHFLVLRQSURFHVVWKDWJUDGXDOO\ÀQHWXQHVWKLVJUDQGLRVHSURMHFWLWPHQWLRQVWKH
TXHVWLRQVHQJLQHHUVDQGPDQDJHPHQWKDGWRDGGUHVVDQGLWLOOXVWUDWHVKRZGLIÀFXOWLWZDV
to innovate in a milieu with deep-seated convictions rooted in experience. However, the
men leading this project are quite able, in the light of the information they collect, to act
boldly and to push a set of innovative technologies to henceforth unheard of limits. Therefore, the liner 1RUPDQGLH, comes to be a synthesis of state-of-the-art techniques and thus,
despite its short career, ranks among the very few legendary passenger ships.
-OTSCLmS
NormandieSDTXHERWSURSXOVLRQpOHFWULTXHWUDQVDWODQWLTXH$OVWRP3HQKRsW
+EYWORDS
1RUPDQGLH, liner, electric, drive, transatlantic, Alstom, 3HQKRsW
# DE 2%#)43 2mSUMmS bTIENNE $ELAIRE
2mSUMm
L’innovation, introduction aboutie sur un marché d’un objet ou d’un service
QRXYHDXFRQGXLWjGHVFKDQJHPHQWVGHV\VWqPHWHFKQLTXH&HWDUWLFOHSURSRVH
d’envisager la circulation des idées techniques et des hommes, concernant en parWLFXOLHUOHVLQVWDOODWLRQVIULJRULÀTXHVGDQVODÀOLqUHGHODSrFKHDXWKRQFRPPH
un préalable aux transferts et aux adaptations technologiques des entreprises,
agissant comme déclencheur de l’adaptation des conserveurs à leur nouvel environnement. Cette circulation d’idées, condition nécessaire et préalable au déYHORSSHPHQW LQGXVWULHO HQWUDvQH FRPSWHV UHQGXV GH YR\DJHV HW UDSSRUWV ULFKH
source d’inspiration pour les entrepreneurs, et permet d’établir de fructueux liens
GHSDUWHQDULDWWHFKQLTXHHWÀQDQFLHUV
!BSTRACT
Innovation – the successful introduction of a new object or service onto a market - results in changing technical systems. This paper suggests that the movement of people and
WHFKQLFDOLGHDVLQWKHSDUWLFXODUÀHOGRIUHIULJHUDWLRQV\VWHPVLQWKHWXQDÀVKLQJVHFWRULV
a prerequisite for technology transfer and adaptation and causes canners to adapt to their
new environment.
This movement of ideas, which is a necessary and preliminary condition for industrial
growth, generates journey accounts and reports, which are a rich source of inspiration
IRUHQWUHSUHQHXUVDOORZLQJWKHPWRFUHDWHIUXLWIXOÀQDQFLDODQGWHFKQLFDOOLQNVDQGSDUtnerships.
-OTSCLmS
histoire du froid, pêche au thon, tuna-clipper
+EYWORDS
KLVWRU\RIUHIULJHUDWLRQWXQDÀVKLQJWXQDFOLSSHU
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS ,AURENT 'ARREAU
2mSUMm
/HÀOPLe Sel de la Terre est remarquable à plus d’un titre. D’une part, par son
mode de production puisqu’il s’agit d’une œuvre collective écrite et réalisée par
SOXVLHXUVEODFNOLVWpVWRXUQpHHQPDUJHHWjO·LQVXG·+ROO\ZRRGHWFRQWUHWRXWHV
OHVPLVHVHQJDUGH(QVXLWHSDUVDGLVWULEXWLRQSXLVTXHOHÀOPHVWLQWHUSUpWpPDMRritairement par des acteurs non professionnels, de vrais mineurs pour la plupart.
(QÀQ SDU VRQ GLVFRXUV VRFLDOHPHQW HQJDJp ² O·XQ GHV UDUHV GX VHSWLqPH DUW j
DWWHLQGUHXQHWHOOHLQWHQVLWpTXLSOXVHVWHQSOHLQHSpULRGHPDFFDUWK\VWH²GRXEOp
G·XQ SURSRV DQWLUDFLVWH HW IpPLQLVWH 3RXU O·KLVWRULHQ -RKQ + /DZVRQ TXL IXW
DXVVL O·XQ GHV © GL[ GH +ROO\ZRRG ª FH ÀOP Q·HVW ULHQ PRLQV TXH © OH SUHPLHU
ÀOPDPpULFDLQLPSRUWDQWjWUDLWHUKRQQrWHPHQWODOXWWHGHVFODVVHVHWOHSUHPLHUj
SUpVHQWHUXQHPLQRULWpDYHFGLJQLWpHWFRPSUpKHQVLRQª8QÀOPUDUHHWFXOWHHQ
VRPPHTXLSDUFHTX·LOV·HVWYXWD[pGH©ÀOPGHSURSDJDQGHFRPPXQLVWHªVHUD
ER\FRWWp SDU OD PDMRULWp GHV VDOOHV DX[ (WDWV8QLV PDLV FRQQDvWUD WRXWHIRLV XQH
ODUJHGLIIXVLRQHQ(XURSHDX0H[LTXHRXHQ&KLQHRLOI€WGRXEOpHQGLDOHFWHV
différents.
!BSTRACT
Herbert Biberman’s Salt of the Earth FDQ EH ORRNHG DW DV DQ RXWVWDQGLQJ ÀOP IRU
several reasons.
First of all, because of the issues that led to its production, it is a sort of teamwork
ZLWKH[FHSWLRQDOFKDUDFWHULVWLFV7KHVFUHHQSOD\DQGVKRRWLQJRIWKHÀOPUHVXOWIURPWKH
collaboration between blacklisted victims of the Red Scare, who decided to produce Salt of
the EarthRXWVLGH+ROO\ZRRG·VFDQRQVDQGDJDLQVWDOOWKHZDUQLQJVIURPWKHÀOPLQGXVWU\
and political authorities.
Another peculiar point of this production is that most of the members of the cast were
not professional actors, but real miners for the most part.
Lastly, the discourse of Salt of the Earth is socially committed (rare among the works
in the history of the cinema and at a time when McCarthyism was in full sway) containing
DQWLUDFLVWDQGIHPLQLVWWKHPHV$VDPDWWHURIIDFWLWLVRQHRIWKHÀUVWDWWHPSWVWRGHOLYHUD
political, strongly nonconformist message in the history of the cinematographic art.
According to John H. Lawson, one of the ‘Hollywood Ten’, Salt of the Earth is noWKLQJOHVVWKDQ¶WKHÀUVWLPSRUWDQW$PHULFDQÀOPWRDSSURDFKVXEWOHWRSLFVVXFKDVWKH
class struggle and to represent a social minority with dignity and benevolence’.
,W LV D FXOW ÀOP ZKLFK EHFDXVH LW ZDV EODFNOLVWHG ZDV ER\FRWWHG E\ WKH PDMRULW\ RI
movie theatres but also travelled around the world, across Europe and Mexico as well as
China, where it was dubbed in fourteen different dialects.
# DE 2%#)43 2mSUMmS -OTSCLmS
+ROO\ZRRGFHQVXUHFKDVVHDX[VRUFLqUHVOXWWHGHVFODVVHVIpPLQLVPHFRPPXnisme, liste noire, prolétariat
+EYWORD
Hollywood, censorship, Red Scare, class struggle, feminism, communism, blacklist, working class
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS !NTONY &IANT
2mSUMm
L’article entend explorer les diverses représentations du monde ouvrier et de
ODÀJXUHGHO·RXYULHUGDQVOHÀOPGXFLQpDVWHFKLQRLV-LD=KDQJNH24 City ÀOP TXL D OD SDUWLFXODULWp GH WHQWHU XQH IXVLRQ HQWUH GRFXPHQWDLUH HW ÀFWLRQ HQ
Q·DIÀFKDQWDXFXQHGLVWLQFWLRQHQWUHWpPRLJQDJHVYpULGLTXHVUHFRQVWLWXpVRXLQYHQWpV3RXUFHODQRXVDQDO\VRQVGDQVXQSUHPLHUWHPSVOHVGLIIpUHQWVGLVSRVLWLIV
testimoniaux élaborés par le cinéaste dans une singulière proposition dramaturgique à partir de choix scénographiques, de mise en scène et de montage bien précis. Puis nous mettons en évidence le discours sur l’évolution du monde ouvrier
FKLQRLVYpKLFXOpSDUFHÀOPHQWUHQRVWDOJLHGHVSOXVkJpVGHVWpPRLQVHWHVSRLU
G·pPDQFLSDWLRQ GHV SOXV MHXQHV (QÀQ QRXV pWXGLRQV O·DUW GHV WUDQVLWLRQV HQWUH
les différents témoignages dont fait preuve le cinéaste en saisissant les traces d’un
PRQGHÀQLVVDQW
!BSTRACT
This paper aims to examine the various representations of the working-class world
DQGRIWKHZRUNHUÀJXUHLQ&LW\E\&KLQHVHÀOPPDNHU-LD=KDQJ7KLVÀOP
KDVDSDUWLFXODULW\LWLVDQDWWHPSWWREHDWWKHVDPHWLPHDÀFWLRQDQGDGRFXPHQWDU\
REOLWHUDWLQJDOOGLVWLQFWLRQVEHWZHHQYHULÀDEOHWHVWLPRQLHVDQGUHFRQVWUXFWHGRUPDGHXS
ones. First we analyse the several testimony devices present in the author’s unusual draPDWLFRIIHULQKLVVSHFLÀFVFHQRJUDSK\GLUHFWLRQHGLWLQJ7KHQZHKLJKOLJKWWKHGLVFRXUVH
FRQYH\HGLQWKHÀOPRQWKHHYROXWLRQRIWKH&KLQHVHZRUNLQJFODVVZRUOGZRUGVLPEXHG
with nostalgia among the older witnesses, with expectations of emancipation among the
\RXQJHU )LQDOO\ ZH VWXG\ WKH VNLOIXO WUDQVLWLRQV WKH DUWLVW ÀQGV WR OLQN DOO WKH GLYHUVH
WHVWLPRQLHVZKLOHÀOPLQJWKHWUDFHVRIDG\LQJZRUOG
-OTSCLmS
GRFXPHQWDLUH ÀFWLRQ WpPRLJQDJH SROLWLTXH FRPPXQLVPH OLEpUDOLVPH SDUROH
ouvrière
+EYWORDS
GRFXPHQWDU\ÀFWLRQWHVWLPRQ\SROLF\FRPPXQLVPOLEHUDOLVPZRUNLQJFODVVGLVFRXUVH
# DE 2%#)43 2mSUMmS &RANCIS 0mROZ
2mSUMm
/·HQWUHSULVH*LURGQ·HVWDXGpEXWGXXXe siècle qu’une modeste émaillerie familiale installée à Morez sur les hauteurs du Jura. Elle est alors spécialisée dans la décoration des cadrans d’horloges et dans la confection des petites plaques émaillées.
$SUqVOD6HFRQGH*XHUUHPRQGLDOHO·HQWUHSULVHDVXVDLVLUO·RSSRUWXQLWpRIIHUWHSDU
le développement de la signalisation routière. Aujourd’hui implantée à Bellefontaine, à quelques kilomètres de Morez, et dirigée par la cinquième génération de
ODIDPLOOH*LURGO·HQWUHSULVHV·DSSHOOHGpVRUPDLV6LJQDX[*LURG(OOHHVWFRWpHjOD
%RXUVHGH/\RQHWHOOHDGLYHUVLÀpVHVDFWLYLWpVHQGpYHORSSDQWXQSDQHOG·DFWLYLWpV
OLpHV j O·DPpQDJHPHQW XUEDLQ VLJQDOLVDWLRQ KRUL]RQWDOH VLJQDOLVDWLRQ YHUWLFDOH
VLJQDOLVDWLRQOXPLQHXVHPRELOLHUXUEDLQDPpQDJHPHQWGHVFDUUHIRXUVÁHXULVVHPHQWGHVYLOOHV$YHFXQHYLQJWDLQHGHÀOLDOHVHQ)UDQFHHWGHVÀOLDOHVHQ(XURSH
HWDX&DQDGDO·HQWUHSULVH6LJQDX[*LURGHVWO·XQGHVOHDGHUVPRQGLDX[GDQVVRQ
domaine. Elle montre que le développement d’une entreprise n’est pas nécessairement lié à une situation géographique proche des grands axes de circulation.
!BSTRACT
At the beginning of the 20th FHQWXU\ WKH *LURG ÀUP ZDV RQO\ D VPDOOVL]HG IDPLO\
enamel factory in Morez in the Jura hills and it specialized in clock dial decoration and
LQ WKH PDNLQJ RI VPDOO HQDPHOOHG VLJQV $IWHU WKH 6HFRQG :RUOG :DU WKH ÀUP VHL]HG
WKHRSSRUWXQLWLHVRIIHUHGGXHWRWKHGHYHORSPHQWRIURDGVLJQV7RGD\WKHÀUPLVFDOOHG
6LJQDX[*LURG; it is located in Bellefontaine, a few kilometres away from Morez, and it
LVUXQE\WKHÀIWKJHQHUDWLRQRIWKH*LURGIDPLO\/LVWHGRQ/\RQV6WRFN([FKDQJHLWKDV
GLYHUVLÀHGE\GHYHORSLQJDUDQJHRIDFWLYLWLHVOLQNHGWRXUEDQGHYHORSPHQWURDGPDUNLQJV
URDGVLJQVOLJKWVLJQDOVVWUHHWIXUQLWXUHFURVVURDGVOD\RXWFLW\ÁRZHULQJ:LWKDERXW
twenty subsidiaries in France, Europe and Canada, 6LJQDX[*LURG is one of the leading
FRPSDQLHVLQWKLVÀHOG,WVKRZVWKDWWKHJURZWKRIDÀUPLVQRWQHFHVVDULO\OLQNHGWRLWV
being located near major trunk roads.
-OTSCLmS
Jura, Morez, Bellefontaine, émaillerie, signalisation routière, aménagement urbain
+EYWORDS
Jura, Morez, Bellefontaine, enamel factory, road signs, urban development
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS 9VES#LAUDE ,EQUIN
2mSUMm
2Q SHXW DVVRFLHU KLVWRLUH HW FRQFHSWLRQ LQGXVWULHOOH &RPPH WRXV OHV REMHWV
OHVFRXYHUWVVRQWPXOWLIDFHWWHVSURGXLWVLQGXVWULHOVRXYHUWVjGHVXVDJHVSDUIRLV
LPSUpYXVPDUFKDQGLVHVEDQDOHVRXOX[XHXVHVREMHWVSRUWHXUVG·XQHV\PEROLTXH
souvent riche…
Issus de gestes correspondant à des besoins humains fondamentaux, ils sont
IRUWDQFLHQVTXRLTXHG·kJHLQpJDOVLO·pFXHOOHHWO·LQVWUXPHQWFRXSDQWRQWSOXsieurs millénaires, bon nombre de nos couverts datent de la Renaissance. Avec
l’industrialisation ils sont produits en série et se présentent sous une forme abouWLH TX·RQ SHQVH JpQpUDOHPHQW ÀQLH FH TXL Q·HPSrFKH SDV TX·RQ OHV UHFRQoRLYH
encore aujourd’hui, demain…
!BSTRACT
History and industrial design can be linked together. As any other objects, crockery
and cutlery have many facets: manufactured products with sometimes unexpected uses,
everyday or luxury goods, objects with a rich symbolic value...
Developed from the gestures accompanying basic human needs, they are quite old but
they do not all have the same age: thousands of years for bowls and cutting devices whereas
many others date back to the Renaissance. After the industrial revolution they are massproduced and they now seem accomplished and apparently cannot evolve any longer, and
yet they are constantly being redesigned..
-OTSCLmS
couverts de table, histoire des objets, objets techniques, quatre approches, design
+EYWORDS
cutlery, crockery, history of objects, technical objects, four approaches, design
# DE 2%#)43 2mSUMmS !NDREW &EENBERG
2mSUMm
/D WKpRULH VRFLRORJLTXH GH © O·kJH GH O·LQIRUPDWLRQ ª SURPHWWDLW XQ VXFFqV
SUpFRFHDXGpYHORSSHPHQWGHVV\VWqPHVSXEOLFVGHW\SHYLGpRWH[7RXWHIRLVOD
plupart des expériences de vidéotex ont échoué en dépit des prédictions enthouVLDVWHV6HXOOHV\VWqPHIUDQoDLV7pOpWHODUHQFRQWUpXQVXFFqVjJUDQGHpFKHOOHHW
s’est même développé de façon inattendue. Ce résultat est le fruit des décisions
des concepteurs qui ont ouvert un espace où les utilisateurs avaient la possibilité
GHGpWRXUQHUOHV\VWqPHGHVHVIRQFWLRQVGHGLVWULEXWLRQGHO·LQIRUPDWLRQSRXUHQ
faire un outil de communication entre individus. Ce n’est donc pas un hasard si la
VHXOH©VXFFHVVVWRU\ªGXYLGpRWH[DODUJHPHQWGpYLpGHODYRLHWUDFpHSDUOHVWKpRries de l’âge de l’information qui ont donné jusqu’à présent au vidéotex sa raison
d’être. Il est temps de se pencher plus attentivement sur l’expérience française qui
révèle les biais de la conception dominante de la société postindustrielle.
!BSTRACT
The sociological theory of the ‘information age’ promised early success in the development of public videotex systems. In fact, most videotex experiments failed despite the
glowing predictions. Only the French Teletel system has achieved large scale success, and
it has grown into something quite unexpected. This outcome is due to design decisions that
opened a space within which users were able to redirect the system away from the distribution of information toward human communication. It is thus no accident that the only
videotex success story deviates so sharply from the information age theories which have up
to now given videotex its raison d’être. It is time to take a closer look at the French experience as an indication of the bias of the dominant conception of postindustrial society.
-OTSCLmS
vidéotex, minitel, Télétel, communication online, société postindustrielle
+EYWORDS
videotex, minitel, Teletel, online communication, postindustrial society
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 2mSUMmS 'REGORY (} "LAISE -AGNIN 4HOMAS -ARTY
2mSUMm
L’objectif de cet article est de s’interroger sur le rapport du parti socialiste à ses
WHUULWRLUHVpOHFWRUDX[WRXWDXORQJGX;;e siècle dans une perspective d’histoire
G·XQHSUDWLTXHSROLWLTXH1RXVYRXGULRQVHQIDLWPHWWUHDXMRXUOHWUDYDLOG·H[SHUWLVHTXRWLGLHQHWRXVDYDQWSURGXLWjSURSRVGHVFLUFRQVFULSWLRQVpOHFWRUDles législatives. D’hier à aujourd’hui, la transformation des espaces économiques,
industriels, démographiques ou sociaux par les militants et les élites partisanes
HQDXWDQWGHWHUULWRLUHVSROLWLTXHVQHYDSDVGHVRL'qVHWO·XQLÀFDWLRQGX
socialisme, une conquête des circonscriptions législatives se met en place par la
construction d’un militantisme de fédérations issu d’implantations locales spéFLÀTXHV HW GLIIpUHQFLpHV /HV IpGpUDWLRQV VH GpYHORSSDQW G·DLOOHXUV j O·pFKHORQ
départemental, le hiatus est persistant avec le niveau de mobilisation électorale
législative, infra-départemental, c’est-à-dire dans le vocable de l’époque se faisant
SDU©DUURQGLVVHPHQWª&HSHQGDQWjSDUWLUGHHWSOXVHQFRUHGXGpEXWGHV
DQQpHVLO\DDYHFO·DUULYpHG·XQHpOLWHSDUWLVDQHSOXVSURIHVVLRQQHOOHXQH
tentative de rationaliser l’entreprise électorale socialiste au niveau départemental ;
G·RXQWUDYDLOSOXVV\VWpPDWLTXHGHSUpSDUDWLRQHWGHSUpVHQWDWLRQGHFDQGLGDWV
dans chaque circonscription.
!BSTRACT
This article aims to study how the socialist party dealt with its electoral territories throughout the 20th century from the perspective of a history of political practice. We would like
to highlight work resulting from daily expertise and that of scholarly investigation as they
relate to constituencies. Yesterday as well as today, turning economic, industrial, demographic or social spaces into political territories is not so straightforward. As early as 1905, folORZLQJWKHXQLÀFDWLRQRIWKHVRFLDOLVWPRYHPHQWVWKHDLPZDVWRZLQRYHUFRQVWLWXHQFLHVE\
GHYHORSLQJLQHDFKIHGHUDWLRQDSROLWLFDODFWLYLVPURRWHGLQWKHYDULHGVSHFLÀFFKDUDFWHULVWLFV
of the area. As federations also developed at the level of ‘départements’ there was a persistent gap in electoral campaigning between this level and a sublevel, referred to at the time as
‘arrondissement’. However, as of 1971, and more markedly from the early 1980s, there was
an attempt to rationalise socialist electoral campaigning at the ‘département’ level, hence a
more systematic training and presentation of candidates in each constituency.
-OTSCLmS
circonscriptions législatives, découpage électoral, modes de scrutin, parti sociaOLVWH6),2
+EYWORDS
constituency, division into constituencies, electoral system, socialist party SFIO
# DE 2%#)43 4ABLE DES MATInRES 4ABLE DES MATInRES
0ARTIE ) #ULTURES ET FORMATION TECHNIQUE ..........................................................
!NNA 0ELLEGRINO
/HVFRPSWHVUHQGXVGHVRXYULHUVLWDOLHQVDX[H[SRVLWLRQVXQLYHUVHOOHV
une source pour l’étude de la culture technique et professionnelle
entre le XIXe et le XXe siècle. ........................................................................................................................
7
!NTOINE $EROUET
/·LQYHQWLRQGHO·DXWUHIRUPDWLRQGHVLQJpQLHXUV
débats et controverses autour des enseignements non techniques
au milieu du XXe siècle. ..................................................................................................................................
-ARIE0IERRE %SCUDIm
3ROLWLTXHGHO·HVSULWFKH]*DVWRQ%HUJHU$X[RULJLQHVGHO·,16$ 0ARTIE )) 0OLITIQUES DE LA MINE ...............................................................................................
,UC 2OJAS
L’exploitation technique des houillères ligériennes
GXUDQWOHSUHPLHUFRQÁLWPRQGLDO...............................................................................................
2OBERT %DGARD .DONG
/D&RPSDJQLHGHV0LQHVG·8UDQLXPGH)UDQFHYLOOH&208)
JHQqVHHWFRQWU{OHGHO·DFWLYLWp .......................................................................
0ARTIE ))) 4ECHNIQUES MARITIMES .........................................................................................
0ASCAL 2OBERT
Une propulsion électrique Alsthom
pour le paquebot Normandie. ...............................................................................................................
117
bTIENNE $ELAIRE
/DFRQJpODWLRQGXWKRQXQHÀOLqUHWHFKQLTXHHPEDUTXpH......................
137
5NIVERSITm DE TECHNOLOGIE DE "ELFORT-ONTBmLIARD 4ABLE DES MATInRES 0ARTIE )6 #INmMA ½GURES DE L´OUVRIER ....................................................................
4ANGUI 0ERRON
L’image de l’ouvrier italien dans le cinéma français
GHVDQQpHVDX[DQQpHV.................................................................................................
,AURENT 'ARREAU
Le Sel de la terre de Biberman.
..............................................................................................................
171
!NTONY &IANT
(QWUHGRFXPHQWDLUHHWÀFWLRQUHSUpVHQWDWLRQVGHO·RXYULHU
dans 24 CityGH-LD=KDQJNH..............................................................................................................
187
0ARTIE 6 6ARIA .....................................................................................................................................................
199
&RANCIS 0mROZ
/·HQWUHSULVH6LJQDX[*LURGGHO·pPDLOOHULHIDPLOLDOH
à la société internationale. ........................................................................................................................
9VES#LAUDE ,EQUIN
Couverts à redécouvrir et à reconcevoir. .............................................................................
!NDREW &EENBERG
%HIRUHWKH,QWHUQHW7KH)UHQFK([SHULHQFHZLWK9LGHRWH[ .....................
'REGORY (} "LAISE -AGNIN 4HOMAS -ARTY
Le socialisme à la découpe. Retour sur le découpage territorial
des circonscriptions électorales législatives
DXSDUWLVRFLDOLVWHGHSXLV .........................................................................................................
,ISTE DES AUTEURS ..............................................................................................................................................
2mSUMmS
4ABLE DES MATInRES
.......................................................................................................................................
# DE 2%#)43 #RmDITS PHOTOGRAPHIQUES PP ET #/-5& 0ANORAMA N€ P P MINISTnRE DES -INES DU 'ABON
PP ET CRmDITS PERSONNELS
PP ET !$ 6)4!- RUE DE LA &ONTAINE AU 2OI 0!2)3
7RXVOHVD\DQWVGURLWQ·D\DQWSXrWUHLGHQWLÀpVOHXUVGURLWVVHURQWUpVHUYpV
Université de Technologie de Belfort-Montbéliard (UTBM)
Site de Sevenans, rue du château.
90010 Belfort cedex
Tél : 03 84 58 32 73
Directeur de Publication :
Christian Lerminiaux
(Administrateur provisoire UTBM)
Coordinateur de la publication :
Paul Arthaud - [email protected]
Maquettage texte et couverture :
Atelier Gaia, Elisabeth Fuhrer - [email protected]
#AHIERS DE 2%#)43 REVUE
,ES #AHIERS DE 2%#)43 ONT POUR VOCATION DE VALORISER LES RECHERCHES DES MEMBRES DU LABORATOIRE mPONY
ME MAIS AUSSI D´ACCUEILLIR LES CONTRIBUTIONS DES CHERCHEURS EXTmRIEURS SUR LES THmMATIQUES DE L´HISTOIRE
DE LA TECHNIQUE ET DE L´INDUSTRIE DE L´mCONOMIE DE LA GESTION ET PLUS GmNmRALEMENT DE TOUTE SCIENCE
HUMAINE QUI VISE g APPRmHENDER LE PHmNOMnNE TECHNOLOGIQUE DANS L´ENSEMBLE DE SES DIMENSIONS SYN
CHRONIQUES ET DIACHRONIQUES EN LE RESITUANT DANS SA COMPLEXITm ET SA CONTEXTUALITm
4HE JOURNAL OF 2%#)43
4HE PURPOSE OF THE JOURNAL OF 2%#)43 IS TO PROMOTE RESEARCH WORK CARRIED OUT BY THE MEMBERS OF THE EPONYMOUS
RESEARCH TEAM )T ALSO RECEIVES THE CONTRIBUTIONS OF NONMEMBER RESEARCHERS WORKING ON THE THEMES OF THE HIS
TORY OF TECHNOLOGY AND INDUSTRY OF ECONOMY OF MANAGEMENT AND MORE GENERALLY OF ANY HUMAN SCIENCE WHICH
AIMS TO COMPREHEND THE TECHNOLOGY PHENOMENON IN ITS SYNCHRONIC AND DIACHRONIC DIMENSIONS BY PLACING IT IN
ITS COMPLEXITY AND CONTEXTUALITY
HTTPRECITSUTBMFR
#AHIERS DE 2%#)43 N€ ,E NUMmRO 5N DES ¦ #AHIERS DE 2%#)43 § PRmSENTE LES ACTIVITmS DU ,ABORATOIRE \ #OMMUNICATIONS DU SmMINAIRE ¦ !CTEURS ET LOGIQUES DU TERRITOIRE §
\ !CTIVITmS DE RECHERCHE DU ,ABORATOIRE
\ 4RAVAUX DE RECHERCHE DES MEMBRES DE LA *EUNE bQUIPE
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
#AHIERS DE 2%#)43 N€ #E NUMmRO COMPORTE \ ,ES COMMUNICATIONS DU SmMINAIRE ¦ 'UERRE TRANSPORT ET INDUSTRIE § TENU g 3EVENANS
\ ,ES ACTIVITmS DE RECHERCHE DU LABORATOIRE 2%#)43
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
#AHIERS DE 2%#)43 N€ #E NUMmRO EST CONSTITUm DE TROIS ENSEMBLES \ LES COMMUNICATIONS DU SmMINAIRE ¦ !UX FRONTInRES DU BREVET §
\ DIVERS ARTICLES SUR LES CHOIX TECHNOLOGIQUES LES STRATmGIES D´INNOVATION ET LES POLITIQUES
INFORMATIONNELLES
\ LES TRAVAUX DES MEMBRES DU LABORATOIRE 2%#)43
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
#AHIERS DE 2%#)43 N€ #E NUMmRO EST CONSTITUm DE TROIS ENSEMBLES \ !RT ET TECHNIQUE ,ION DE "ELFORT .ICOLAS 3CHyFFER L´ENFANCE DANS LA PUBLICITm \ 4RAVAIL ET TRAVAILLEURS AUTOMOBILE "ELFORT -ULHOUSE 3UISSE \ 0RODUCTION ET SOCImTm ENTREPRISES 34/ CONTRATS DE TRAVAIL "ULGARIE
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
#AHIERS DE 2%#)43 N€ #E NUMmRO EST CONSTITUm DE CINQ ENSEMBLES \ -mMOIRE ET HISTOIRE & *EQUIER \ %NTREPRISE EN &RANCHE#OMTm !LSTOM 0EUGEOT (OUILLnRES DE
2ONCHAMP ETC \ #RmATION INVENTION DIFFUSION BREVETABILITm CRmATIVITm \ #APITAL HUMAIN FORMATION ENTRETIEN ET DmFORMATION DEUX
RmVOLUTIONS DES CORPS "ELFORT ET -ULHOUSE FORMATIONS EN CHIMIE APPLIQUmE RESTRUCTURA
TIONS DE L´EMPLOI \ #INmMA ET HISTOIRE 6ILLES ET LIBERTm
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
#AHIERS DE 2%#)43 N€ #E NUMmRO EST CONSTITUm DE QUATRE ENSEMBLES \ 0RATIQUES ET CULTURE DE L´INGmNIEUR \ 4ECHNOLOGIE ET CONCURRENCE INDUSTRIELLE \ !NTHROPOLOGIE HISTORIQUE DE LA RmVOLUTION INDUSTRIELLE \ 6ARIA
,A REVUE #AHIERS DE 2%#)43 N€ EST DISPONIBLE
GRATUITEMENT SUR HTTPPEMUTBMFR
/UVRAGES PUBLImS PAR LE 0xLE mDITORIAL MULTIMmDIA 54"-
‡ $)IXWpH DQDO\VH IRQFWLRQQHOOH. &'5RP GH IRUPDWLRQ j O·DQDO\VH IRQFWLRQQHOOH
H[WHUQH87%0DYHFOHFRQFRXUVGH36$3HXJHRW&LWURsQODEHO5,35HFRQQXG·LQWpUrW
SpGDJRJLTXHGXPLQLVWqUHGHO·eGXFDWLRQQDWLRQDOH
‡$QJODLVXQHPpGLDWLRQWHFKQRORJLTXH3DXO$UWKDXG
‡$XWRVWXG\&XUULFXOXPIUDQoDLVHWDQJODLV&XUVXVSRXUO·LQJpQLHULHGHVV\VWqPHV
et le secteur automobile. &ROOHFWLI
‡ Cahiers de RECITS (Recherches et Études sur le Changement Industriel,
7HFKQRORJLTXHHW6RFLpWDO6L[QXPpURVSDUXV
‡&LUFXODWLRQVWHFKQLTXHV(QDPRQWGHO·LQQRYDWLRQKRPPHVREMHWVHWLGpHVHQ
mouvement. 6RXVODGLUGH0LFKHO&RWWH
‡&RGHVGHOHFWXUHGHVSDWULPRLQHVUHOLJLHX[Collectif, sous la dir. de Jean-Jacques
&ODLU
‡&RPSUHQGUHO·DFWLYLWpGHFRQFHSWLRQ'HQLV&KRXOLHU
‡'HO·HVSLRQQDJHLQGXVWULHOjODYHLOOHWHFKQRORJLTXH0LFKHO&RWWH
‡ (VSLRQ UpVLVWDQW WHUURULVWH ÀJXUHV GX FLQpPD Textes réunis par Laurent
+H\EHUJHU
‡/·pYDOXDWLRQFUpDWLYH-HDQ3LHUUH0LFDsOOLHW$ODLQ-pU{PH)RXJqUHV
‡)URQWLqUHV HQ LPDJH 8QH PpPRLUH FLQpPDWRJUDSKLTXH Sous la dir. de Robert
%HORW
‡*pRSRVLWLRQQHPHQWHWPRELOLWpV*36(JQRVHW*DOLOHR« Sous la dir. de Maxime
:DFN$KPHG1DLW6LGL0RK-DDIDU*DEHU3LHUUH<YHV*LOOLpURQ<YHV$OH[DQGUH
‡+LVWRLUHVGHWHUULWRLUHV/HVWHUULWRLUHVLQGXVWULHOVHQTXHVWLRQXVIIIe-XXe siècles. Sous
ODGLUGH/DXUHQW7LVVRW)UDQFHVFR*DUXIR-HDQ&ODXGH'DXPDV3LHUUH/DPDUG
‡+{WHOVGH3DULV'HO·DXEHUJHDXSDODFH;,;e-XXe siècles. -HDQ0DUF/HVXU
‡/·LQJpQLHXUHDXF±XUGHO·LQQRYDWLRQ&ROOHFWLI
‡/·LQJpQLHXUGDQVVRQHQYLURQQHPHQW&ROOHFWLI
‡,QQRYHUHWPDQDJHU3RXUTXRL"&RPPHQW"&ROOHFWLI
‡ .KRXULEJD*HQqVHG·XQHYLOOHPLQLqUH0RKDPPHG6DKVDK
‡/HV PLJUDWLRQV LQWHUQDWLRQDOHV HQ (XURSH HW DX[ eWDWV8QLV GHV DQQpHV j
%UXQR0DUQRW
‡1RXYHOOHV(XURSHV7UDMHFWRLUHVHWHQMHX[pFRQRPLTXHV6RXVODGLUGH3HWLD.ROHYD
1DWKDOLH5RGHW.URLFKYLOLHW-XOLHQ9HUFXHLO
‡1XLWVG·(XURSH3RXUGHVYLOOHVDFFHVVLEOHVHWKRVSLWDOLqUHV/XF*ZLD]G]LQVNL
‡/·RO\PSLVPHjO·pFROH"eULF0RQQLQ
‡3RXUXQHVFLHQFHGHODFRQFHSWLRQ)RQGHPHQWVPpWKRGHVSUDWLTXHVSous la dir. de
-RsOOH)RUHVW&DUROLQH0pKLHUHW-HDQ3LHUUH0LFDsOOL
‡5HJDUGVLQWHUFXOWXUHOVYHUVO·$VLH&KLQH&RUpH-DSRQ-XQJ6RRN%$(
‡5pVHDX[PRQDVWLTXHV&ROOHFWLIVRXVODGLUGH-HDQ-DFTXHV&ODLU
‡5pVLVWDQFHV HXURSpHQQHV 8QH PpPRLUH FLQpPDWRJUDSKLTXH Sous la dir. de Robert
%HORW
‡5pXVVLU VRQ SURMHW LQGXVWULHO 3KLOLSSH )DEUH -RsOOH )RUHVW 0LFKqOH *XLQJDQG -HDQ
3LHUUH0LFDsOOLHW'LGLHU5pPRQG
‡5RXOHQWOHVPpFDQLTXHV2XYUDJHSpGDJRJLTXHPXOWLPpGLD'DYLG3HUULQHQ
OLJQHVXUKWWSSHPXWEPIU
‡/DUpYROXWLRQGHVFRUSV'pFURLVVDQFHHWFURLVVDQFHVWDWXUDOHGHVKDELWDQWVGHVYLOOHVHW
GHVFDPSDJQHVHQ)UDQFH/DXUHQW+H\EHUJHU
‡5KLQVXG 8Q WHUULWRLUH HQ GHYHQLU " Collectif, sous la direction de Pierre Lamard et
5D\PRQG:RHVVQHU
‡6XFKDUG(QWUHSULVHIDPLOLDOHGXFKRFRODW1DLVVDQFHG·XQHPXOWLQDWLRQDOH
suisse. &ROOHFWLIVRXVODGLUGH&ODLUH$OLQH1XVVEDXPHW/DXUHQW7LVVRW
‡/DWHFKQRORJLHDXULVTXHGHO·KLVWRLUHSous la dir. de Robert Belot, Michel Cotte, Pierre
/DPDUG
‡/D WHFKQRORJLH HQWUH j O·XQLYHUVLWp &RPSLqJQH 6HYHQDQV %HOIRUW0RQWEpOLDUG«
3LHUUH/DPDUGHW<YHV&ODXGH/HTXLQ
‡/HV86$IDFHjXQHGRXEOHJRXYHUQDQFH'H1L[RQj5HDJDQ/RWÀ%HQQRXU
‡9DXEDQ. L’homme, l’ingénieur, le réformateur.7H[WHVUpXQLVSDU/DXUHQW+H\EHUJHUHW
<YHV3DJQRW
‡ Les villes d’Afrique face à leurs déchets. (PPDQXHO1JQLNDPHWePLOH7DQDZD
Pour connaître les publications
du Pôle éditorial multimédia
de l’université de technologie de Belfort-Montbéliard (UTBM)
YRLUOHFDWDORJXHHWOHVQRXYHDXWpVVXUOHVLWH87%0
HTTPPEMUTBMFR
Achevé d’imprimer
en octobre 2010
à l’imprimerie Schraag-Trévenans
Note aux contributeurs
Procédure de soumission
/HVPDQXVFULWVVHURQWDGUHVVpVjODUpGDFWLRQODXUHQWKH\EHUJHU#XWEPIUDYHF
a) les coordonnées complètes de leurs auteurs (adresse, courriel et téléphone) ;
b) leurs fonctions ;
c) leur institution de rattachement ;
GXQUpVXPpPRWVPD[LPXPDFFRPSDJQpGHVDWUDGXFWLRQHQDQJODLV
e) dix mots clés maximum (français et anglais).
/HQRPEUHPD[LPDOGHFDUDFWqUHVHVWGHHVSDFHVFRPSULVHV
Pour chaque ouvrage cité, la bibliographie devra inclure nom et prénom de l’auteur, titre, éditeur, date et lieu de l’édition.
Pour chaque référence citée, la bibliographie, en note de bas de page, devra suivre les normes suivantes sur le fond et sur
ODIRUPHUHVSHFWGHODFDVVHGHODSRQFWXDWLRQHWF
2XYUDJH
Première occurrence :
7KRPDV 3LNHWW\ Les hauts revenus en France au XXe siècle. Inégalités et redistributions, 1901-1998, 3DULV *UDVVHW
Occurrences suivantes :
7KRPDV3LNHWW\Les hauts revenus..., op. cit.S
$UWLFOH
Première occurrence :
1DWKDQ5RVHQEHUJHW0DQXHO7UDMWHQEHUJ©$*HQHUDO3XUSRVH7HFKQRORJ\DW:RUN7KH&RUOLVV6WHDP(QJLQH
LQWKH/DWH1LQHWHHQWK&HQWXU\8QLWHG6WDWHVªGDQVJournal of Economic HistoryPDUVS
Occurrences suivantes :
1DWKDQ5RVHQEHUJHW0DQXHO7UDMWHQEHUJ©$*HQHUDO3XUSRVHªloc. cit.S
&KDSLWUHGDQVRXYUDJHFROOHFWLI
Première occurrence :
)ORULDQ6FKPDOW]©2WWR%LFNHQEDFKHWODUHFKHUFKHELRPpGLFDOHVXUOHVJD]GHFRPEDWjOD5HLFKVXQLYHUVLWlW
6WUDVVEXUJHWDXFDPSGHFRQFHQWUDWLRQGX6WUXWKRI1DW]ZHLOHUªGDQV&KULVWLDQ%RQDK$QQH'DQLRQ*ULOOLDW
-RVLDQH 2OII1DWKDQ et alii (dir.), Nazisme, science et médecine eGLWLRQV *O\SKHV 3DULV S FROO
©6RFLpWpKLVWRLUHHWPpGHFLQHª
Occurrences suivantes :
)ORULDQ6FKPDLW]©2WWR%LFNHQEDFKªloc. cit.S
Si le texte comprend des documents à reproduire tels que tableaux, graphiques, images, etc., l’auteur veillera à signaler
O·HPSODFHPHQWGpVLUpSRXUFKDFXQG·HX[HWjOHXUDSSHOGDQVOHWH[WHDLQVLTX·jODPHQWLRQV\VWpPDWLTXHGHVWLWUHVOpgendes et sources.
Illustrations :
Les graphiques, images et cartes doivent être transmis séparément au format .jpg ou .tif (300 DPI de préférence). Tout
autre document remis sous forme de papier doit être un original prêt à la reproduction et exempt de toute souillure ou
de collage.
Les graphiques seront fournis accompagnés du tableau Excel d’origine.
Les images photographiques sont traitées de préférence à partir de positifs (tirage brillant) bien contrastés.
/DWDLOOHPD[LPDOHGHVpOpPHQWVJUDSKLTXHVHVWGH[FP
Texte :
/HVWH[WHVVHURQWIRXUQLVDXIRUPDWGRFRXUWISROLFHGHFDUDFWqUHV7LPHV1HZ5RPDQRX7LPHVGHFRUSVMXVWLÀp8WLOLVHUXQLQWHUOLJQDJHGHFPHWVpSDUHUFKDTXHSDUDJUDSKHSDUXQVDXWGHOLJQHVDQVUHWUDLW
5pVHUYHUOHVLWDOLTXHVDX[WHUPHVpWUDQJHUVHWWH[WHVpWUDQJHUV0HWWUHHQWUHJXLOOHPHWVOHVFLWDWLRQV1e pas souligner de
mots ni écrire en majuscules.
1HSDVGpSDVVHUWURLVQLYHDX[GHWLWUHQXPpURWHUOHVWLWUHVHWOHVDOLJQHUjJDXFKH
WLWUHVGHQLYHDX«HQ7LPHV1HZ5RPDQRX7LPHJUDV
WLWUHVGHQLYHDX«HQ7LPHV1HZ5RPDQRX7LPHVJUDV
WLWUHVGHQLYHDX«HQ7LPHV1HZ5RPDQRX7LPHVQRQJUDV
'URLWVG·DXWHXU
L’auteur s’engage à fournir une contribution originale.
6LO·DXWHXUXWLOLVHXQGRFXPHQWD\DQWGpMjSDUXGDQVXQHDXWUHSXEOLFDWLRQLOIRXUQLUDOHVGURLWVGHUHSURGXFWLRQDLQVL
que les éventuelles mentions à indiquer.
&RRUGLQDWLRQpGLWRULDOH3DXO$UWKDXG87%0
SDXODUWKDXG#XWEPIU
#AHIERS DE 2%#)43
.€ #ULTURE ET FORMATION
TECHNIQUE
0OLITIQUES DE LA MINE
4ECHNIQUES MARITIMES
#INmMA &IGURES DE L´OUVRIER
6ARIA
2ECHERCHES ET bTUDES SUR LE #HANGEMENT )NDUSTRIEL
4ECHNOLOGIQUE ET 3OCImTAL
)33. ß$% "%,&/24-/.4"b,)!2$
"ELFORT CEDEX 4mL &AX 

Documents pareils