Adoption de l`alimentation méditerranéenne basée sur la théorie de
Transcription
Adoption de l`alimentation méditerranéenne basée sur la théorie de
Adoption de l’alimentation méditerranéenne basée sur la théorie de l’autodétermination : Différences entre les hommes et les femmes Thèse Vicky Leblanc Doctorat en Nutrition Philosophiae Doctor (Ph.D.) Québec, Canada © Vicky Leblanc, 2015 RÉSUMÉ L’alimentation méditerranéenne est reconnue comme un modèle de saine alimentation et ses bienfaits sur la santé cardiovasculaire sont bien documentés. Puisque des différences entre les hommes et les femmes ont été rapportées quant aux habitudes alimentaires et à la modification de celles-ci en réponse à des interventions, on peut se questionner à savoir si les hommes et les femmes peuvent retirer les mêmes bénéfices en adoptant cette alimentation. D’autre part, la motivation constitue un facteur déterminant dans les changements alimentaires et des évidences suggèrent que la motivation autodéterminée est associée à l’adoption et au maintien de comportements alimentaires sains. Peu d’études ont cependant évalué l’importance de la qualité de la motivation impliquée dans les changements alimentaires, et aucune ne semble avoir considéré les différences potentielles entre les hommes et les femmes. L’étude présentée dans cette thèse visait à déterminer l’influence du genre dans l’adoption d’une alimentation de type méditerranéen en réponse à un programme d’éducation en nutrition basé sur une approche motivationnelle auprès d’individus présentant certains facteurs de risque cardiovasculaire. Afin de rencontrer cet objectif, 64 hommes et 59 femmes préménopausées ont participé à un programme d’éducation en nutrition de 12 semaines basé sur l’approche de l’entretien motivationnel. L’intervention nutritionnelle visait à promouvoir la motivation autodéterminée, plus particulièrement en soutenant la satisfaction des besoins d’autonomie, de compétence et du sentiment d’attachement des individus dans la détermination d’objectifs alimentaires et de stratégies favorables à adopter. L’intervention comportait trois rencontres de groupe, trois rencontres individuelles et quatre suivis téléphoniques avec une nutritionniste. Une amélioration similaire de l’adhésion à l’alimentation méditerranéenne a été observée chez les hommes et les femmes en réponse à l’intervention, mais avec des changements plus prononcés de certaines composantes alimentaires chez les hommes. Une augmentation de la motivation autodéterminée était associée à une amélioration de l’adhésion à l’alimentation méditerranéenne chez les hommes seulement. Des changements métaboliques plus prononcés ont été observés chez les hommes. En conclusion, nos résultats indiquent que le programme d’éducation en nutrition basé sur une approche motivationnelle a contribué à l’amélioration des apports alimentaires et à la diminution de facteurs de risque cardiovasculaire, plus particulièrement chez les hommes. iii ABSTRACT The Mediterranean diet is now recognized as one of the best models of food patterns and its cardioprotective effects are well established in the literature. As evidence suggests differences between men and women in eating habits and in dietary changes in response to interventions, it can be questioned whether men and women could get the same health benefits from the adoption of the Mediterranean diet. It has also been suggested that motivation is an important factor in the context of dietary changes and some studies indicate that self-determined motivation toward eating is associated with the adoption of healthy dietary behaviors and long-term adherence to those changes. However, few studies assessed the importance of quality in motivational factors related to dietary changes, and to our knowledge, none has considered potential differences between men and women. This study aimed at assessing the impact of gender in the adoption of a Mediterranean diet in response to a nutritional education program based on a motivational approach, in men and women presenting risk factors for cardiovascular disease. To meet this objective, 64 men and 59 premenopausal women were recruited into our 12-week nutritional education program based on the motivational interviewing approach. The nutritional intervention aimed at promoting self-determined motivation, more precisely in a context that fosters satisfaction of basic psychological needs for autonomy, competence, and relatedness in the determination of dietary changes and potential strategies. The nutritional intervention included three group sessions, three individual sessions and four follow-up telephone calls with a registered dietitian. Both men and women increased their adherence to the Mediterranean diet in response to the nutritional intervention, although men showed more pronounced changes in some specific food groups. A positive association between increases in self-determined motivation and increases in the adherence to the Mediterranean diet was observed in men only. Men also showed more pronounced changes in metabolic variables. In conclusion, our results indicate that the nutritional intervention program based on a motivational approach led to improvement in dietary intakes and to decreases in cardiovascular risk factors, more particularly in men. v TABLE DES MATIÈRES RÉSUMÉ .............................................................................................................................. iii ABSTRACT............................................................................................................................ v TABLE DES MATIÈRES ................................................................................................... vii LISTE DES TABLEAUX .....................................................................................................xi LISTE DES FIGURES ....................................................................................................... xiii LISTE DES ABRÉVIATIONS ............................................................................................ xv REMERCIEMENTS .......................................................................................................... xvii AVANT-PROPOS ...............................................................................................................xxi INTRODUCTION GÉNÉRALE ............................................................................................ 1 CHAPITRE 1 : Revue de littérature ....................................................................................... 5 1.1 Prévalence des maladies cardiovasculaires au Canada .................................................. 7 1.2 Modèles de saine alimentation proposés dans la littérature ........................................... 9 1.2.1 Évaluation des habitudes alimentaires plutôt que les apports en nutriments ......... 9 1.2.2 Régime DASH ........................................................................................................ 10 1.2.3 Profil de type Prudent ............................................................................................ 10 1.2.4 Guide alimentaire canadien................................................................................... 11 1.2.5 Régime méditerranéen ........................................................................................... 14 1.2.6 Méthodes permettant de calculer un score d’adhésion aux différents modèles de saine alimentation ............................................................................................................. 16 1.3 Bienfaits de l’alimentation méditerranéenne................................................................ 18 1.3.1 Bienfaits sur la santé.............................................................................................. 18 1.3.2 Bienfaits sur la qualité de vie ................................................................................ 21 1.4 Déterminants des choix alimentaires sains................................................................... 22 1.4.1 Définition des concepts de genre et de sexe .......................................................... 23 1.4.2 Différences relatives au genre quant aux habitudes et comportements alimentaires ............................................................................................................................... 24 1.4.3 Impact de l’alimentation sur la santé : l’influence du sexe ................................... 27 1.5 Différences entre les hommes et les femmes en réponse à une intervention nutritionnelle visant la prévention de maladies cardiovasculaires ........................................ 29 1.6 Différences entre les hommes et les femmes dans le contexte de l’alimentation méditerranéenne .................................................................................................................... 30 1.6.1 Différences entre les hommes et les femmes dans l’adhésion à l’alimentation méditerranéenne ................................................................................................................ 30 vii 1.6.2 Différences entre les hommes et les femmes dans la réponse à une intervention nutritionnelle basée sur l’alimentation méditerranéenne ................................................ 31 1.7 Théories de changements de comportements liés à la santé ........................................ 33 1.7.1 Théorie sociale cognitive ...................................................................................... 33 1.7.2 Modèle transthéorique .......................................................................................... 35 1.7.3 Théorie de l’autodétermination ............................................................................. 37 1.8 Approche de l’entretien motivationnel ........................................................................ 45 1.8.1 Définition et principes ........................................................................................... 45 1.8.2 Complémentarité entre la théorie de l’autodétermination et l’entretien motivationnel .................................................................................................................... 47 1.8.3 L’efficacité de l’entretien motivationnel pour améliorer les comportements liés à la santé.............................................................................................................................. 49 1.8.4 L’efficacité de l’entretien motivationnel pour améliorer les changements alimentaires ...................................................................................................................... 51 CHAPITRE 2 : Problématique ............................................................................................. 53 CHAPITRE 3 : Différences relatives au genre dans les apports alimentaires : quelle est la contribution des variables motivationnelles? ....................................................................... 59 RÉSUMÉ.............................................................................................................................. 63 ABSTRACT ......................................................................................................................... 65 INTRODUCTION ................................................................................................................ 67 METHODOLOGY ............................................................................................................... 68 Participants ...................................................................................................................... 68 Measurements ................................................................................................................... 70 Statistical Analyses ........................................................................................................... 73 RESULTS............................................................................................................................. 73 DISCUSSION ...................................................................................................................... 75 REFERENCES ..................................................................................................................... 80 CHAPITRE 4 : Différences entre les hommes et les femmes dans les apports alimentaires et le profil métabolique en réponse à une intervention nutritionnelle de 12 semaines visant l’adoption de l’alimentation méditerranéenne ...................................................................... 89 RÉSUMÉ.............................................................................................................................. 93 ABSTRACT ......................................................................................................................... 95 INTRODUCTION ................................................................................................................ 97 METHODOLOGY ............................................................................................................... 99 Participants ...................................................................................................................... 99 Study Design ................................................................................................................... 100 Measurements of Dependent Variables .......................................................................... 101 Statistical Analyses ......................................................................................................... 103 RESULTS........................................................................................................................... 104 viii DISCUSSION ..................................................................................................................... 107 REFERENCES ................................................................................................................... 114 CHAPITRE 5 : Différences relatives au genre dans les effets à long terme d’un programme d’intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne : changements dans les apports et comportements alimentaires, ainsi que dans les variables anthropométriques et métaboliques .................................................................................... 127 RÉSUMÉ ............................................................................................................................ 131 ABSTRACT........................................................................................................................ 133 INTRODUCTION .............................................................................................................. 135 METHODOLOGY ............................................................................................................. 137 Participants ..................................................................................................................... 137 Study Design.................................................................................................................... 138 Measurements of dependent variables ............................................................................ 139 Statistical analyses .......................................................................................................... 141 RESULTS ........................................................................................................................... 142 DISCUSSION ..................................................................................................................... 144 REFERENCES ................................................................................................................... 150 CHAPITRE 6 : Effets d’un programme d’intervention nutritionnelle basé sur la théorie de l’autodétermination et visant l’adoption de l’alimentation méditerranéenne: différences relatives au genre dans la motivation autodéterminée et l’adhésion à l’alimentation méditerranéenne .................................................................................................................. 171 RÉSUMÉ ............................................................................................................................ 175 ABSTRACT........................................................................................................................ 177 INTRODUCTION .............................................................................................................. 179 METHODOLOGY ............................................................................................................. 181 Participants ..................................................................................................................... 181 Study Design.................................................................................................................... 182 Measurements of Dependent Variables .......................................................................... 183 Statistical Analyses.......................................................................................................... 185 RESULTS ........................................................................................................................... 186 DISCUSSION ..................................................................................................................... 189 REFERENCES ................................................................................................................... 194 CHAPITRE 7 : Changements de la qualité de vie liée à la santé suivant une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne : évaluation des différences de genre chez des hommes et des femmes présentant des facteurs de risque cardiovasculaire .................................................................................................................. 207 RÉSUMÉ ............................................................................................................................ 211 ABSTRACT........................................................................................................................ 213 INTRODUCTION .............................................................................................................. 215 ix METHODOLOGY ............................................................................................................. 216 Recruitment of participants and Study design ................................................................ 216 Measurements of Dependent Variables .......................................................................... 216 Statistical Analyses ......................................................................................................... 218 RESULTS........................................................................................................................... 219 DISCUSSION .................................................................................................................... 221 REFERENCES ................................................................................................................... 224 CHAPITRE 8 : Conclusion générale ................................................................................. 233 BIBLIOGRAPHIE ............................................................................................................. 247 ANNEXE : Score méditerranéen ....................................................................................... 267 x LISTE DES TABLEAUX CHAPITRE 1 Tableau 1. Recommandations nutritionnelles canadiennes visant la prévention des maladies cardiovasculaires (2013) ................................................................................. 8 Tableau 2. Types d'aliments à privilégier selon le Guide alimentaire canadien ................ 13 CHAPITRE 3 Table 1. Physiological characteristics of men and women ................................................. 85 Table 2. Dietary intakes and eating behaviors in men and women .................................... 86 Table 3. Basic psychological needs, global and eating related motivation in men and women .......................................................................................................................... 87 Table 4. Association between eating related self-determination index and dietary intakes, eating behaviors and anthropometric profile in men and women ................................ 88 CHAPITRE 4 Table 1. Baseline characteristics of men and women ....................................................... 120 Table 2. Dietary intakes, Medscore and food group intakes at baseline and after the 12week nutritional intervention program ....................................................................... 121 Table 3. Changes in dietary intakes, Medscore and food group intakes in response to the 12-week nutritional intervention program ................................................................. 123 Table 4. Anthropometric and metabolic variables at baseline and after the 12-week nutritional intervention program ................................................................................ 125 Table 5. Changes in anthropometric and metabolic variables in response to the 12-week nutritional intervention program ................................................................................ 126 CHAPITRE 5 Table 1. Characteristics of men and women at baseline ................................................... 156 Table 2. Changes in dietary intakes in men and women .................................................. 157 Table 3. Changes in Medscore and food groups in men and women ............................... 160 Table 4. Changes in anthropometric and metabolic variables in men and women .......... 164 Table 5. Changes in eating behaviors in men and women................................................ 168 xi CHAPITRE 6 Table 1. Characteristics of men and women at baseline ................................................... 201 Table 2. Changes in the eating-related self-determination index and its specific forms of regulation in men and women in response to the 12-week nutritional intervention program and at follow-up ........................................................................................... 202 Table 3. Associations between changes in eating-related self-determined motivation and changes in the Medscore and in BMI in men and women .......................................... 205 CHAPITRE 7 Table 1. Characteristics of health-related quality of life in men and women at baseline . 228 Table 2. Changes in health-related quality of life in men and women in response to the 12week nutritional intervention program, and at 6 and 9-month follow-up .................. 229 Table 3. Associations between changes in the Medscore, eating-related self-determined motivation and body weight and changes in global HRQOL in men and women from baseline to 6-month follow-up .................................................................................... 232 xii LISTE DES FIGURES CHAPITRE 1 Figure 1. Pyramide de l'alimentation méditerranéenne traditionnelle ................................. 15 Figure 2. Schématisation de la théorie sociale cognitive ..................................................... 34 Figure 3. Schématisation du modèle transthéorique ............................................................ 35 Figure 4. Schématisation de la théorie de l'autodétermination ............................................ 38 Figure 5. Similitudes entre les principes de la théorie de l'autodétermination et de l'entretien motivationnel ................................................................................................ 49 CHAPITRE 4 Figure 1. Description of the 12-week nutritional intervention program and measurements performed at baseline and after the end of the intervention ........................................ 119 CHAPITRE 5 Figure 1. Description of the 12-week nutritional intervention program and measurements performed at baseline, after the end of the intervention and then at 3-month and 6month post intervention ............................................................................................... 155 CHAPITRE 6 Figure 1. Continuum of the Self-Determined Motivation. ................................................ 199 Figure 2. Description of the 12-week nutritional intervention program and measurements performed at baseline, after the end of the intervention and then at 3-month and 6month post intervention ............................................................................................... 200 CHAPITRE 7 Figure 1. Description of the 12-week nutritional intervention program and measurements performed at baseline, after the end of the intervention and then at 6 and 9-month follow-up. .................................................................................................................... 227 xiii LISTE DES ABRÉVIATIONS BMI: Body mass index C : Cholestérol C-LDL : Concentrations de cholestérol lié aux lipoprotéines de basse densité C-HDL : Concentrations de cholestérol lié aux lipoprotéines de haute densité CVD: Cardiovascular diseases DASH : Dietary Approach to Stop Hypertension FFQ: Food frequency questionnaire FSH: Follicle-stimulating hormone GAC : Guide alimentaire canadien HRQOL: Health-related quality of life IMC: Indice de masse corporelle MCV : Maladies cardiovasculaires MedDiet: Mediterranean diet Medscore: Mediterranean score MI: Motivational interviewing MTT : Modèle transthéorique Score Med : Score méditerranéen SDI: Self-determination index SDT: Self-Determination Theory TAD : Théorie de l’autodétermination TFEQ: Three-Factor Eating Questionnaire TSC : Théorie sociale cognitive VAS: Visual analog scale xv REMERCIEMENTS Cette thèse est le résultat d’un projet s’étant échelonné sur un peu plus de quatre ans, qui aura été un parcours extrêmement riche sur le plan du savoir académique et tout autant pour l’expérience acquise en recherche. Ma décision de poursuivre au doctorat était essentiellement basée sur le désir de demeurer dans le domaine de la recherche et de participer au développement et à la réalisation d’une intervention clinique, et cette belle opportunité s’est présentée à moi. Je tiens à remercier plusieurs personnes pour leur soutien tout au long de ce projet de recherche. Tout d’abord, je tiens sincèrement à remercier ma directrice de recherche, Simone Lemieux, pour avoir partagé avec moi son expertise comme chercheure, mais également pour sa grande disponibilité, son écoute, sa confiance et ses précieux conseils. Je la remercie également pour son soutien dans les moments où je me suis questionnée quant au chemin que je désirais suivre dans ma carrière professionnelle. Je me sens très choyée d’avoir eu la chance de la côtoyer pendant toutes ces années! Je tiens à remercier ma co-directrice, Sophie Desroches, pour son soutien tout au long de mes études au doctorat. Je remercie également Louise Corneau pour son grand dévouement tout au long du projet de recherche. Merci à Anne-Marie Hudon, ma partenaire de course préférée, une amie et une collègue exemplaire avec qui j’ai eu beaucoup de plaisir à travailler. Merci à Marie-Michelle Royer qui a apporté son aide précieuse dans le développement du projet et les débuts de l’intervention. Je désire aussi souligner la contribution de Valérie Guay, Julie Maltais-Giguère, Kim Labonté, Danielle Aubin et Steeve Larouche dans la réussite du projet, merci à vous! Je remercie tous mes amis et collègues de l’INAF, qui rendent mon quotidien tellement agréable!!! Sans vous nommer un à un, sachez que votre présence fait toute la différence dans notre environnement de travail. Juste un petit mot pour remercier mes « copines » de bureau, Alex, Marie et Caro… Je suis très heureuse d’avoir pu partager pleins de beaux xvii souvenirs avec vous pendant mes études graduées, que ce soit dans le quotidien, à l’occasion de congrès ou encore lors de nos soupers tartare. Je tiens à remercier des amies de longue date qui sont bien précieuses à mes yeux malgré la distance ou nos horaires toujours trop chargés, Sarah, Aboue, Catherine et Marie-Hélène. Vous amitié apporte énormément à mon bonheur dans la vie! Je veux aussi remercier de tout cœur ma famille, plus particulièrement mes parents Claire & Daniel et ma sœur Roxane, pour leur amour et leur appui depuis toujours dans mes choix de vie. Un Merci particulier à Jean-Robert qui m’a offert son havre de paix pour quelques jours pendant la rédaction de ma thèse, ce qui m’a fait le plus grand bien! Et finalement, je tiens à remercier Mathieu pour sa grande écoute et son soutien dans les dernières étapes de ce projet important pour moi. Merci d’avoir contribué à mon équilibre de vie dans les derniers mois :) . On dit que la vie est une aventure que l’on doit oser, le doctorat aura pour moi fait partie de cette belle aventure! xviii Je dédie cette thèse à ma famille. Merci de m’avoir appris à croire en moi et à me dépasser dans la vie… xix AVANT-PROPOS Les travaux de recherche présentés dans le cadre de cette thèse ont mené à la rédaction de cinq articles scientifiques présentés de façon intégrale dans les chapitres 3 à 7. Le premier article visait à identifier les différences relatives au genre dans les apports et comportements alimentaires ainsi que dans les variables motivationnelles, puis à déterminer les associations entre ces variables auprès d'hommes et de femmes préménopausées à risque de maladies cardiovasculaires. Le second présente les différences de genre dans les changements alimentaires, anthropométriques et métaboliques en réponse à l'intervention nutritionnelle de 12 semaines, alors que le troisième présente l'effet de l'intervention à long terme (3 mois et 6 mois après la fin de l'intervention) sur les apports et comportements alimentaires, ainsi que sur les variables anthropométriques et métaboliques. Les quatrième et cinquième articles rapportent les effets de l'intervention sur les changements de motivation autodéterminée et d'adhésion à l'alimentation méditerranéenne (article 4) et sur la perception de la qualité de vie (article 5). Ces chapitres sont précédés d’une introduction générale, d’une revue de la littérature portant principalement sur l’alimentation méditerranéenne, les différences entre les hommes et les femmes dans le contexte d’interventions nutritionnelles et la théorie de l’autodétermination, suivi par une problématique permettant de mettre en contexte la pertinence de notre projet de recherche. Une conclusion générale suit la présentation des cinq articles scientifiques afin de situer la contribution de mes travaux de recherche à l’avancement des connaissances dans le domaine des interventions nutritionnelles cliniques et de faire ressortir les principales perspectives de recherche. Les articles présentés dans cette thèse reposent sur la collaboration de plusieurs personnes. D’abord, ma directrice de recherche, Dr. Simone Lemieux, professeure titulaire à la Faculté des sciences de l’agriculture et de l’alimentation – École de nutrition de l’Université Laval, est la principale responsable de la planification et de la rédaction du projet de recherche en vue d’obtenir du financement, et elle a été impliquée dans toutes les étapes reliées à la rédaction et l’approbation de chacun des articles présentés dans cette thèse. Dr. Catherine Bégin, professeure titulaire à la Faculté des sciences sociales – École xxi de psychologie de l’Université Laval, a collaboré à la planification et l’élaboration du projet de recherche en plus de partager avec nous ses expertises dans les domaines du comportement alimentaire et de la théorie de l’autodétermination. Elle a ainsi apporté une aide précieuse dans l’interprétation des données des articles présentés aux chapitres 3 à 7. Anne-Marie Hudon et Marie-Michelle Royer sont toutes deux co-auteurs pour les articles présentés aux chapitres 4 à 6 puisqu’elles ont été impliquées dans le volet clinique du projet de recherche dans le cadre de leur maîtrise en nutrition, en plus de participer à la collecte et à la saisie de données. Louise Corneau, professionnelle de recherche à l’Institut sur la nutrition et les aliments fonctionnels (INAF), a été en charge de coordonner l’intervention clinique incluant le recrutement des participants et les visites à l’unité d’investigation clinique de l’INAF, en plus d’avoir aussi collaboré à la planification et l’élaboration du projet de recherche. Sylvie Dodin, médecin clinicienne et professeure titulaire à la Faculté de médecine – Département d’obstétrique et de gynécologie de l’Université Laval, a été responsable de la supervision des aspects médicaux du projet de recherche et a également participé à la planification et l’élaboration du projet de recherche. Louise Corneau et Sylvie Dodin sont co-auteurs pour tous les articles présentés dans cette thèse (chapitres 3 à 7). En ce qui me concerne, pour l’ensemble des articles présentés aux chapitres 3 à 7, j’ai agi en tant que premier auteur et j’ai été impliquée dans tous les aspects reliés à la réalisation du projet de recherche. Plus précisément, j’ai contribué au développement du programme d’éducation en nutrition de 12 semaines, j’ai réalisé l’intervention clinique, participé à la saisie de données, pour ensuite procéder aux analyses statistiques des données du projet. J’ai écrit tous les articles présentés dans cette thèse et j’ai été en charge du processus de soumission et de révision en vue de publier dans des revues scientifiques. À l'exception de l’article présenté au septième chapitre, qui a été soumis à Journal of Nutrition Education and Behavior, l'ensemble des articles scientifiques présentés dans cette thèse ont tous été publiés ou acceptés pour publication pendant mes études au doctorat. Voici les références détaillées relatives à chacun des articles scientifiques qui font partie de cette thèse, ces derniers étant présentés selon la dernière version soumise aux revues scientifiques. xxii CHAPITRE 3 Gender differences in dietary intakes: what is the contribution of motivational variables? Leblanc V, Bégin C, Corneau L, Dodin S, Lemieux S. Journal of Human Nutrition and Dietetics. 2015 Feb;28(1):37-46. CHAPITRE 4 Differences between men and women in dietary intakes and metabolic profile in response to a 12-week nutritional intervention promoting the Mediterranean diet. Leblanc V, Hudon AM, Royer MM, Corneau L, Dodin S, Bégin C, Lemieux S. Nutritional Science. 2015; 4(e13): 1-11. CHAPITRE 5 Gender differences in the long-term effects of a nutritional intervention program promoting the Mediterranean diet: changes in dietary intakes, eating behaviors, anthropometric and metabolic variables. Leblanc V, Bégin C, Hudon AM, Royer MM, Corneau L, Dodin S, Lemieux S. Nutrition Journal. 2014 Nov 22;13:107. CHAPITRE 6 Effects of a nutritional intervention program based on the Self-Determination Theory and promoting the Mediterranean diet: Gender differences in eating-related motivation and adherence to the Mediterranean diet. Leblanc V, Bégin C, Hudon AM, Royer MM, Corneau L, Dodin S, Lemieux S. Accepté à Health Psychology Open (9 septembre 2015). CHAPITRE 7 Changes in health-related quality of life following a nutritional intervention promoting the Mediterranean diet: examination of gender differences in men and women presenting risk factors for cardiovascular disease. Leblanc V, Bégin C, Corneau L, Dodin S, Lemieux S. Soumis à Journal of Nutrition Education and Behavior (24 mai 2015). xxiii INTRODUCTION GÉNÉRALE Malgré une diminution du taux de mortalité liée aux maladies cardiovasculaires (MCV) au Canada (Agence de la santé publique du Canada, 2015), la prise en charge des facteurs de risque associés à ces maladies demeure une préoccupation importante au point de vue de la santé publique. La Société canadienne de cardiologie reconnait l’importance de l’alimentation en prévention des MCV (Anderson et al., 2013). Dans les dernières années, le portrait global des recommandations alimentaires pour la santé cardiovasculaire a quelque peu changé. En effet, les recommandations ont longtemps misé principalement sur la restriction de l’apport énergétique et en lipides. Bien que ces éléments figurent toujours parmi celles-ci, davantage d’importance est maintenant accordée à la qualité de l’alimentation (Anderson et al., 2013). À ce propos, l’alimentation méditerranéenne, caractérisée par une consommation abondante de fruits et légumes, céréales entières, noix et légumineuses, d’huile d’olive, par une faible consommation de viandes rouges et de sucreries, puis par une consommation modérée de vin aux repas (Willett et al., 1995), constitue une référence en matière de saine alimentation et ses bienfaits sur la santé cardiovasculaire ont été démontrés à maintes reprises dans des populations méditerranéennes et non méditerranéennes (Sofi et al., 2014). Par ailleurs, ce mode alimentaire est composé d’aliments savoureux en plus d’être reconnu comme convivial et non-restrictif (Willett et al., 1995). Somme toute, ces éléments encouragent l’adoption de l’alimentation méditerranéenne en prévention des MCV et en font un modèle de saine alimentation intéressant dans le contexte d’une intervention nutritionnelle. Bien que de nombreux efforts sont déployés afin de développer des interventions nutritionnelles efficaces, une lacune importante en pratique clinique s’explique par la difficulté éprouvée par un professionnel de la santé à soutenir le client dans l’adoption de changements alimentaires et plus particulièrement dans le maintien de ces changements à long terme, dans une optique de santé. Un des principaux défis consiste à identifier les stratégies les plus favorables afin d’intervenir adéquatement auprès de ces individus. 1 D’une part, la motivation est reconnue comme un concept central dans le contexte des changements alimentaires, bien qu’elle soit généralement considérée en termes d’intensité plutôt qu’en fonction de la qualité des facteurs de motivation. En ce sens, la théorie de l’autodétermination s’intéresse à la qualité de la motivation impliquée dans la régulation du comportement et suggère que le maintien d’un comportement est le résultat du niveau de motivation autodéterminée d’un individu (Deci & Ryan, 1985; Ryan & Deci, 2000). Des études ont démontré qu’un comportement régulé via une motivation autodéterminée favorise le maintien de saines habitudes alimentaires à long terme (Pelletier et al., 2004; Williams et al., 1996). Le succès d’une intervention nutritionnelle à long terme pourrait ainsi reposer en partie sur la place accordée aux facteurs de motivation de l’individu. Le fait d’impliquer activement la personne dans le choix des changements alimentaires ainsi que des stratégies pour réaliser les changements, dans un contexte d’intervention soutenant la motivation autodéterminée, pourrait favoriser l’adoption et le maintien de saines habitudes alimentaires. D’autre part, les différences interindividuelles peuvent influencer la capacité d’adhérer aux recommandations alimentaires dans le contexte d’une intervention. À cet égard, des différences entre les hommes et les femmes sont rapportées dans la littérature en lien avec les habitudes et comportements alimentaires (Arganini, 2012; Garriguet, 2009). Afin de développer des interventions nutritionnelles optimales, il s’avère impératif de déterminer si des différences associées au genre, pouvant se traduire par des comportements et motivations différentes à l’égard de l’alimentation et de la santé, et requérant des approches nutritionnelles adaptées à ces besoins différents, influencent la réponse à une intervention nutritionnelle. Cette éventualité a certainement un fort potentiel pour améliorer la pertinence des conseils nutritionnels prodigués aux hommes et aux femmes. Jusqu’à présent, peu d’études ont comparé les effets d’un programme d’éducation en nutrition visant l’adoption de l’alimentation méditerranéenne entre les hommes et les femmes, et aucune n’a examiné l’impact de facteurs reliés à la motivation autodéterminée sur les différences entre les hommes et les femmes dans la réponse à une intervention nutritionnelle. L’objectif général des travaux présentés dans cette thèse visait à déterminer les différences entre les hommes et les femmes dans leur réponse à un programme 2 d’éducation en nutrition de 12 semaines visant l’adoption d’une alimentation de type méditerranéen et basé sur la théorie de l’autodétermination, plus spécifiquement en termes de changements alimentaires, anthropométriques, métaboliques et liés à la qualité de vie. 3 CHAPITRE 1 : Revue de littérature 5 1.1 Prévalence des maladies cardiovasculaires au Canada Les maladies cardiovasculaires (MCV) regroupent diverses maladies affectant le système circulatoire, notamment le cœur et les vaisseaux sanguins (Agence de la santé publique du Canada, 2015). Ces maladies représentent l’une des principales causes de décès au Canada, soit près de 21% de tous les décès (Agence de la santé publique du Canada, 2015). Bien que le taux de mortalité attribuable aux MCV ait diminué de façon importante dans les dernières décennies, possiblement dû en partie à une meilleure prise en charge des facteurs de risque (Agence de la santé publique du Canada, 2015), on rapporte malgré tout que neuf Canadiens sur dix présentent au minimum un facteur de risque associé au développement de MCV alors que 40% présentent un minimum de trois facteurs de risque (Agence de la santé publique du Canada, 2009). À ce propos, il est bien documenté que l’association de plusieurs facteurs de risque a un effet synergique sur le risque global et prédispose davantage une personne à développer une MCV (Grundy et al., 2005; Yusuf et al., 2004). Certains facteurs de risque associés à ces maladies ne peuvent être modifiés par des interventions, tels que le sexe masculin, l’âge avancé et les antécédents familiaux de MCV prématurées (Anderson et al., 2013). Toutefois, la majorité des facteurs de risque sont modifiables par l’adoption de saines habitudes de vie ou par un traitement pharmacologique, et constituent ainsi des cibles d’intervention appropriées dans la prévention de MCV (Anderson et al., 2013). Les facteurs de risque modifiables incluent les dyslipidémies, le diabète de type 2, l’hypertension artérielle, l’obésité abdominale, le tabagisme, le stress, la sédentarité et une alimentation de faible qualité (Agence de la santé publique du Canada, 2009; Bonora, 2006; Schaefer, 2002). Par ailleurs, chez les adultes d’âge moyen, des différences entre les hommes et les femmes sont rapportées quant à la prévalence de certains facteurs de risque (Tan et al., 2010), avec une proportion plus élevée d’hommes présentant une hypertension artérielle, une dyslipidémie ou une obésité abdominale (Pilote et al., 2007; Scarsella et al., 2003; Williams, 2004). D’autre part, des données indiquent que la présence de diabète contribue davantage au risque de MCV chez les femmes que chez les hommes (Peters et al., 2014; Pilote et al., 2007). 7 Selon les lignes directrices canadiennes, les interventions liées au mode de vie demeurent la pierre angulaire de la prévention de MCV (Anderson et al., 2013). Globalement, les recommandations visent l’amélioration des habitudes alimentaires, l’augmentation de la pratique d’activité physique, une consommation d’alcool modérée, l’abandon du tabagisme et la prise en charge des facteurs de stress psychologique (Anderson et al., 2013). Sur le plan des recommandations nutritionnelles plus spécifiquement (Tableau 1), on encourage une approche hypocalorique s’il y a présence d’embonpoint ou d’obésité, et en ce qui concerne les changements alimentaires, l’accent est mis sur les aliments et les modes alimentaires à privilégier plutôt que sur les restrictions. Tableau 1. Recommandations nutritionnelles canadiennes visant la prévention des maladies cardiovasculaires (2013) Restriction calorique visant à atteindre et maintenir un poids santé. Favoriser les acides gras polyinsaturés et monoinsaturés, incluant les acides gras oméga-3 (provenant principalement du poisson), en remplacement des acides gras trans et saturés. Limiter les apports en lipides totaux à < 30% de l’apport énergétique quotidien. Limiter le cholestérol alimentaire à 200 mg/jour chez les personnes atteintes de dyslipidémies ou présentant un risque cardiovasculaire élevé. Augmenter les apports en fruits, en légumes et en produits céréaliers à grains entiers. Augmenter les apports en fibres alimentaires à > 30 g/jour. Diminuer les apports en sucres simples. Diminuer les apports en sodium. Les modes alimentaires Méditerranéen, Portfolio ou DASH (Dietary Approach to Stop Hypertension) sont recommandés pour améliorer le profil lipidique ou réduire le risque cardiovasculaire. Augmenter la consommation d’aliments enrichis en phytostérols, de fibres solubles, du soya et des noix pour diminuer le cholestérol plasmatique. Vu la prévalence considérablement élevée des facteurs de risque dans la population et l’importance accordée à l’amélioration des habitudes alimentaires dans le contexte de la prévention de MCV, des efforts doivent être déployés afin de développer des interventions 8 adaptées aux besoins des personnes et qui favoriseront une meilleure observance des recommandations alimentaires. Pour ce faire, il importe d’abord d’examiner les principaux modèles de saine alimentation proposés. 1.2 Modèles de saine alimentation proposés dans la littérature 1.2.1 Évaluation des habitudes alimentaires plutôt que les apports en nutriments Au cours des dernières décennies, plusieurs chercheurs ont recommandé d’évaluer l’alimentation des individus à partir des habitudes alimentaires ou de groupes d’aliments (Freeland-Graves & Nitzke, 2013; Hu, 2008; Kant, 1996), plutôt que d’évaluer les apports en certains nutriments spécifiques. L’un des principaux arguments proposés s’explique par le fait qu’il s’agit d’une méthode plus représentative des habitudes alimentaires réelles des individus. En effet, ceux-ci ne consomment pas de nutriments de façon isolée, mais bien des repas composés d’une variété d’aliments (Hu, 2002). De plus, l’évaluation de l’alimentation à partir de groupes d’aliments permet de considérer l’effet synergique potentiel de la combinaison des nutriments présents dans un même aliment (Hu, 2002). Ces éléments soutiennent la pertinence de considérer les habitudes alimentaires afin d’obtenir un portrait plus complet de la qualité de l’alimentation, et ainsi pouvoir mieux prédire l’impact de l’alimentation sur la santé. Plusieurs modèles de saine alimentation sont proposés dans la littérature. Certains de ces modèles sont définis théoriquement à partir de recommandations alimentaires émises par des organismes de santé publique alors que d’autres sont plutôt créés à partir de données empiriques, provenant généralement d’enquêtes menées dans les populations (Waijers et al., 2007). Dans le cadre de cette thèse, l’objectif n’est pas de dresser une liste exhaustive des modèles existants, mais plutôt de présenter les plus fréquemment cités dans la littérature afin de mettre en lumière notre choix d’avoir recours au modèle de l’alimentation méditerranéenne dans notre intervention. 9 1.2.2 Régime DASH Le régime Dietary Approaches to Stop Hypertension (DASH) est principalement reconnu pour ses effets bénéfiques sur la tension artérielle auprès d’adultes hypertendus et normotendus (Fung et al., 2008; Sacks et al., 2001) ainsi que sur les concentrations de CLDL (Obarzanek et al., 2001). L’adhésion à un régime de type DASH a également été associée à une diminution du risque de MCV (Fung et al., 2008; Schwingshackl & Hoffmann, 2015). Ce sont les bienfaits reconnus de ce régime sur la santé qui en font maintenant un modèle de saine alimentation couramment utilisé. Ce régime se décrit comme une alimentation riche en fruits, légumes, noix et légumineuses et produits laitiers faibles en matières grasses, par une consommation prédominante de grains entiers, par une faible consommation de viandes rouges et de viandes transformées, et par des apports limités en acides gras saturés (Karanja et al., 1999). Les recommandations liées au nombre de portions à consommer dans chacun des groupes d’aliments varient selon les besoins énergétiques quotidiens des individus (National Heart, Lung, and Blood Institute, 2006). 1.2.3 Profil de type Prudent Contrairement au modèle d’alimentation précédent, le profil alimentaire de type Prudent constitue un modèle dont les composantes sont définies selon la population étudiée. En effet, les profils alimentaires sont généralement définis à l’aide d’une forme d’analyse factorielle exploratoire, soit l’analyse en composantes principales (Newby & Tucker, 2004). Brièvement, cette analyse identifie les profils alimentaires auprès d'une population à l'aide de l'information nutritionnelle, souvent rapportée par un questionnaire de fréquence alimentaire ou un journal alimentaire (Hu et al., 2000). L’analyse en composantes principales a pour but de former de plus petits groupes de variables corrélées, sans toutefois être corrélés les uns aux autres. Il s’agit donc d’un regroupement d'aliments basé sur le degré de corrélation existant entre ces aliments. Les profils alimentaires générés représentent la combinaison d'aliments consommés par les individus inclus dans l’échantillon (Hu et al., 2000). Les profils sont nommés de façon qualitative selon la 10 composition des aliments qu’ils incluent et permettent de comparer des personnes entre elles selon leurs apports alimentaires (Newby & Tucker, 2004). Un profil alimentaire de type Prudent regroupe des apports alimentaires sains et se caractérise généralement par une consommation élevée de légumes, fruits, légumineuses, grains entiers, poisson et fruits de mer, et de volaille (Hu et al., 1999). Dans la littérature, ce profil est souvent comparé à un profil alimentaire moins sain, soit le profil de type Western, généralement caractérisé par une consommation élevée de viandes rouges et viandes transformées, beurre, produits laitiers riches en matières grasses, d’œufs et de grains raffinés (Hu et al., 1999). Une particularité des profils alimentaires s’explique par le fait que chaque personne se voit attribuer un score global pour chacun des profils générés (Hu et al., 2000). Par exemple, une personne peut présenter un score élevé à la fois pour le profil Prudent et le profil Western. Dans l’optique d’évaluer l’impact de la qualité alimentaire sur la santé, il peut s’avérer pertinent de procéder à l’analyse de plusieurs profils alimentaires simultanément. Quoiqu’il en soit, plusieurs auteurs ont mis en relation divers profils alimentaires, dont le profil de type Prudent, avec certains facteurs de risque pour la santé. Des études ont montré que le profil Prudent était inversement associé au risque de MCV, chez les hommes (Hu et al., 2000) et chez les femmes (Fung et al., 2001). 1.2.4 Guide alimentaire canadien Le Guide alimentaire canadien (GAC) définit la saine alimentation auprès de la population canadienne (Santé Canada, 2007). Ce modèle d’alimentation regroupe les recommandations visant à combler les besoins nutritionnels des Canadiens et des Canadiennes, à diminuer le risque de développer l’obésité et diverses maladies chroniques telles que le diabète de type 2, les MCV, certains cancers et l’ostéoporose, et à permettre d’atteindre un état de santé global et de bien-être. Le GAC souligne également l’importance de combiner une saine alimentation à un mode de vie actif. 11 Les recommandations alimentaires formulées dans le GAC proposent les quantités d’aliments permettant de répondre aux besoins des individus de même que le type d’aliments qui font partie d’une saine alimentation (Santé Canada, 2007). Ce modèle alimentaire présente les aliments selon quatre groupes différents, soit Légumes et fruits, Produits céréaliers, Laits et substituts et Viandes et substituts. De plus, il respecte les normes nutritionnelles se rapportant aux Apports nutritionnels de référence et tient compte de l’Étendue des valeurs acceptables pour les macronutriments fixée pour les glucides, protéines et les lipides. Le nombre de portions recommandé pour chacun des groupes alimentaires varie en fonction du sexe et de l’âge, ou de l’étape de la vie des individus. Dans ses recommandations, le GAC souligne également l’importance de savourer une variété d’aliments provenant des quatre groupes alimentaires (Tableau 2). 12 Tableau 2. Types d'aliments à privilégier selon le Guide alimentaire canadien Légumes et fruits Consommer au minimum un légume vert foncé et un légume orangé chaque jour. Choisir des légumes et des fruits préparés avec peu ou pas de matières grasses, sucre ou sel. Consommer des légumes et des fruits entiers de préférence aux jus. Produits céréaliers Consommer au minimum la moitié des portions de produits céréaliers sous forme de grains entiers. Choisir des produits céréaliers plus faibles en lipides, sucre ou sel. Laits et substituts Boire chaque jour du lait écrémé ou du lait contenant 1% ou 2% de matières grasses. Choisir des substituts du lait plus faibles en matières grasses. Viandes et substituts Consommer régulièrement des substituts de la viande (ex : légumineuses, tofu). Consommer au minimum deux portions de poisson chaque semaine. Choisir des viandes maigres ou des substituts préparés avec peu ou pas de matières grasses ni de sel. Autres recommandations Consommer une petite quantité de lipides insaturés chaque jour. Boire de l’eau pour étancher la soif. Limiter la consommation d’aliments et de boissons riches en calories, lipides, sucre et sel. Choisir des viandes maigres ou des substituts préparés avec peu ou pas de matières grasses ni de sel. 13 1.2.5 Régime méditerranéen Le régime méditerranéen fait référence au mode alimentaire adopté par les populations des pays bordant la mer Méditerranée, plus particulièrement la Grèce, la région de la Crête et le sud de l’Italie, dans les années 1960 (Willett et al., 1995). L’intérêt envers le régime méditerranéen comme modèle de saine alimentation a pris tout son sens dans le cadre de la Seven Countries Study (Keys, 1970). Cette étude de grande envergure menée par Keys et al. visait à étudier le risque de MCV auprès de 16 cohortes provenant de divers pays dans le monde entier. Les résultats de leur étude ont permis de constater que l’incidence de MCV était plus faible chez les populations vivant dans les régions entourant la mer Méditerranée que dans les pays au nord de l’Europe et en Amérique du Nord (Keys et al., 1986). De plus, les populations méditerranéennes présentaient une espérance de vie plus longue et un taux de mortalité plus faible relié aux MCV et à certains cancers comparativement à plusieurs autres pays dans le monde (Keys et al., 1986; World Health Organization, 1993). À cette époque, malgré certaines différences dans les habitudes alimentaires des populations méditerranéennes, leur alimentation présentait plusieurs caractéristiques communes quant aux groupes d’aliments et à leur importance dans l’alimentation, notamment la prédominance de l’huile d’olive (Trichopoulou & Lagiou, 1997; Willett, 1994; Willett et al., 1995). L’alimentation méditerranéenne traditionnelle se distingue par l’importance accordée à la présence de produits végétaux, d’huile d’olive et d’aliments frais, cultivés localement et peu transformés (Willett et al., 1995). Plus spécifiquement, l’alimentation méditerranéenne traditionnelle est caractérisée par une consommation abondante de fruits, légumes, céréales entières, noix et légumineuses, par une consommation modérée de poissons, volailles et de produits laitiers, principalement sous la forme de yogourt et de fromage, puis par une faible consommation de viandes rouges et de sucreries (Giugliano & Esposito, 2005; Trichopoulou & Lagiou, 1997; Willett et al., 1995). L’huile d’olive constitue la principale source de matières grasses ajoutées. Le vin est consommé de façon modérée et généralement lors des repas (Giugliano & Esposito, 2005; Willett et al., 1995). Cette alimentation fournit ainsi des apports importants en fibres alimentaires, acides gras oméga-3, phytostérols, vitamines, minéraux et en antioxydants 14 (Willett et al., 1995). Par ailleurs, l’apport en lipides est plutôt élevé et très variable selon le pays dont il est question, variant d’environ 30% en Italie à plus de 40% en Grèce, mais procure toutefois un faible apport en acides gras saturés (environ 7 à 8% de l’apport énergétique) (Trichopoulou & Lagiou, 1997; Willett et al., 1995). Le régime méditerranéen a été illustré sous la forme d’une pyramide (Figure 1) afin de représenter visuellement les proportions relatives et les fréquences de consommation des aliments et groupes d’aliments contribuant à ce modèle de saine alimentation (Willett et al., 1995). Il importe toutefois de mentionner que la pyramide méditerranéenne vise à représenter les choix alimentaires sains, plutôt que de définir des recommandations spécifiques quant à la quantité d’aliments à consommer (Willett et al., 1995). Figure 1. Pyramide de l'alimentation méditerranéenne traditionnelle. © 2009 Oldways Preservation & Exchange Trust. Tirée de www.oldwayspt.org (Middleton, 2009). 15 Des études ont démontré que l’alimentation méditerranéenne considérée dans son ensemble aurait un impact plus important sur la santé cardiovasculaire que la somme des effets isolés de chacune de ses composantes (de Lorgeril et al., 1999; Trichopoulou et al., 2003). L’alimentation méditerranéenne constitue donc une référence en matière de saine alimentation (Sofi et al., 2014). En plus de ses bienfaits sur la santé, ce mode alimentaire est composé d’une grande diversité d’aliments savoureux, et où les aspects de convivialité, plaisir et bien-être entourant la consommation des aliments s’avèrent des principes fondamentaux (Willett et al., 1995). Enfin, en plus de promouvoir de saines habitudes alimentaires, ce modèle soutient l’importance d’être physiquement actif sur une base régulière (Willett et al., 1995). Dans sa globalité, le régime méditerranéen constitue ainsi un mode de vie sain. En résumé, tous les modèles d’alimentation présentés dans cette section partagent des points communs. En effet, ils accordent tous une place importante à la consommation de fruits et légumes, de produits céréaliers à grains entiers, de protéines de source végétale, de produits laitiers faibles en matières grasses, d’huiles végétales insaturées et suggèrent de limiter les sources de gras saturés et la consommation de sucreries. Certaines études ont démontré que l’adhésion à ces modèles de saine alimentation est associée à plusieurs bienfaits sur la santé, notamment sur la santé cardiovasculaire (Hu, 2008; Schwingshackl & Hoffmann, 2015; Sofi et al., 2014). Cependant, on constate que le régime méditerranéen traditionnel constitue pour sa part plus qu’un simple modèle de saine alimentation, il s’avère un mode de vie en soi. Les principes relatifs au régime méditerranéen en font un modèle particulièrement intéressant dans le contexte d’interventions nutritionnelles visant la prévention des MCV. 1.2.6 Méthodes permettant de calculer un score d’adhésion aux différents modèles de saine alimentation Pour la majorité des modèles d’alimentation, il est possible de calculer un score d’adhésion reflétant la qualité globale de l’alimentation. En général, le score est développé en accordant un pointage à la consommation de différents aliments, groupes d’aliments ou 16 d’une combinaison d’aliments et de nutriments caractérisant le modèle alimentaire. Par exemple, le Healthy eating index constitue un score reflétant la qualité de l’alimentation développé afin d’évaluer le niveau de concordance des apports alimentaires selon les recommandations alimentaires du GAC (Garriguet, 2009). En ce qui concerne plus spécifiquement l’adhésion à l’alimentation méditerranéenne, plusieurs scores sont proposés dans la littérature (Beunza et al., 2010; Estruch et al., 2006). Il demeure que pour la plupart, un score d’adhésion plus élevé se traduit par une alimentation plus saine. Une des méthodes les plus fréquemment utilisées est celle des scores méditerranéens où les médianes de consommation des aliments et nutriments ciblés par le score dans une population donnée sont utilisées afin de déterminer le nombre de points accordés à une personne (Bach et al., 2006). Plus spécifiquement, cette personne reçoit un point lorsque sa consommation d’un aliment ou nutriment retrouvé dans l’alimentation méditerranéenne est supérieure à la médiane de la population de référence. À l’inverse, pour un aliment ou nutriment rarement consommé selon le mode alimentaire méditerranéen, la personne reçoit un point lorsque sa consommation est inférieure à la médiane. Une limite à l’utilisation des médianes de consommation des aliments et nutriments s’explique par le fait que le niveau d’adhésion à l’alimentation méditerranéenne d’un individu peut être comparé à celui d’une population donnée, sans toutefois nécessairement refléter le niveau d’adhésion à l’alimentation méditerranéenne traditionnelle. Une autre méthode permettant d’évaluer le niveau d’adhésion au mode alimentaire méditerranéen consiste à baser le score méditerranéen sur la pyramide méditerranéenne traditionnelle où un score est accordé à chaque composante de la pyramide selon une méthode préétablie (Bach et al., 2006). Cette méthode est généralement préconisée dans le contexte d’études d’intervention puisqu’elle permet de mieux quantifier le niveau d’adhésion des individus à l’alimentation méditerranéenne traditionnelle, et permet par le fait même d’évaluer la qualité globale de l’alimentation. De plus, ce type de scores méditerranéens permet de déterminer plus facilement l’impact réel de l’alimentation sur différentes variables liées à la santé, par exemple la prévalence de MCV et ses facteurs de risque (Sofi et al., 2014). 17 Un score d’adhésion à l’alimentation méditerranéenne (score Med) a été développé dans la population québécoise et peut être calculé à partir des apports alimentaires rapportés via un questionnaire de fréquence alimentaire (Goulet et al., 2003). Ce score Med inclut 11 composantes, soit les produits céréaliers, les légumes, les fruits, les légumineuses, noix et graines, l’huile d’olive, les produits laitiers, les poissons et fruits de mer, les volailles, les œufs, les viandes rouges et viandes transformées, et les sucreries (voir en Annexe pour plus de détails). Un score variant de 0 à 4 est attribué à chacune des onze composantes de la pyramide méditerranéenne. Pour les groupes d’aliments situés à la base de la pyramide (p.ex. : légumineuses), un score élevé reflète une consommation élevée. Au contraire, pour les groupes d’aliments retrouvés aux niveaux supérieurs de la pyramide (p.ex. : viande rouge), un score élevé est plutôt attribué à une faible consommation de ces aliments. Le score Med peut varier entre 0 et 44 points (Goulet et al., 2003). Dans le cadre des travaux présentés dans cette thèse, nous avons choisi le mode alimentaire méditerranéen à titre de modèle de saine alimentation. De plus, nous avons eu recours à ce score Med afin d’évaluer le niveau d’adhésion à l’alimentation méditerranéenne et de le mettre en relation avec différents bienfaits associés à ce type d’alimentation. 1.3 Bienfaits de l’alimentation méditerranéenne 1.3.1 Bienfaits sur la santé Les bienfaits de l’alimentation méditerranéenne sur la santé et sur la longévité ont clairement été démontrés par une récente méta-analyse incluant plusieurs études de cohortes prospectives et regroupant plus de deux millions d’individus (Sofi et al., 2014). Plus précisément, les résultats de cette étude indiquent que l’adhésion à l’alimentation méditerranéenne est associée à une diminution du taux de mortalité toutes causes confondues, à des diminutions de l’incidence et de la mortalité liées aux MCV et aux cancers, ainsi qu’à une incidence plus faible de maladies neuro-dégénératives (Sofi et al., 2014). Cette méta-analyse appuie ainsi de façon robuste les effets favorables de l’alimentation méditerranéenne en prévention primaire et secondaire des MCV. 18 Par ailleurs, l’étude PREDIMED, soit la plus importante étude d’intervention randomisée et contrôlée visant à évaluer les effets de l’alimentation méditerranéenne en prévention primaire de MCV, a récemment permis de confirmer le rôle protecteur de l’alimentation méditerranéenne sur la santé cardiovasculaire auprès de 7447 hommes et femmes espagnols présentant un risque élevé de MCV (Estruch et al., 2013). Cette étude menée sur une période de 4 ans avait pour but de comparer les effets d’un régime méditerranéen supplémenté en huile d’olive ou en noix à une alimentation faible en lipides (groupe témoin) sur le risque d’événements coronariens. Les résultats ont démontré une diminution du risque relatif d’environ 30 % des événements cardiovasculaires majeurs (infarctus, accidents vasculaires cérébraux, mortalité cardiovasculaire) chez les sujets randomisés au régime méditerranéen supplémenté en huile d’olive ou en noix, comparativement au groupe témoin (Estruch et al., 2013). Les effets favorables de l’alimentation méditerranéenne ont aussi été documentés pour d’autres problématiques de santé telles que les dyslipidémies, l’inflammation, l’hypertension artérielle, la régulation du poids corporel, l’incidence et le traitement du diabète de type 2, soit toutes des conditions prédisposant aux MCV. Plusieurs études soutiennent les bienfaits de l’alimentation méditerranéenne sur le profil lipidique, principalement par une augmentation des concentrations de C-HDL et une diminution des triglycérides, et également sur la tension artérielle, la résistance à l’insuline et des marqueurs sériques liés à l’inflammation (Grosso et al., 2014; Kastorini et al., 2011). Bien que certaines études ne rapportent pas de relation entre l’adhésion à l’alimentation méditerranéenne et la diminution de la prévalence de l’obésité (Trichopoulou et al., 2005; Sanchez-Villegas et al., 2006; Estruch et al., 2006) plusieurs ont démontré des effets positifs sur la régulation du poids corporel se traduisant par une diminution du gain de poids (Buckland et al., 2008), ou une perte de poids (Buckland et al., 2008; Esposito et al., 2011). Dans le même sens, certains travaux ont montré qu’une meilleure adhésion à l’alimentation méditerranéenne était associée à une circonférence de la taille plus faible 19 (Kastorini et al., 2011; Romaguera et al., 2009; Trichopoulou et al., 2005). Par ailleurs, aucune étude n’a rapporté que l’adhésion à l’alimentation méditerranéenne favoriserait un gain de poids (Buckland et al., 2008; Esposito et al., 2011). Les effets physiologiques de certaines composantes de l’alimentation méditerranéenne pourraient expliquer l’impact positif sur la régulation du poids (Buckland et al., 2008). En effet, la présence abondante d’aliments de source végétale favorise une consommation élevée de fibres alimentaires, reconnues pour leur effet favorable sur la satiété, et pourrait contribuer à diminuer la densité énergétique de l’apport alimentaire global (Buckland et al., 2008). La consommation régulière d’aliments à la fois savoureux et rassasiants, par exemple les noix, pourrait également favoriser une meilleure régulation du poids (McManus et al., 2001). Enfin, certains travaux suggèrent que la consommation prédominante d’huile d’olive (acides gras monoinsaturés) pourrait favoriser l'oxydation des substrats énergétiques via une amélioration du métabolisme du glucose, une thermogenèse induite par l’alimentation augmentée ainsi qu’une dépense énergétique quotidienne totale plus élevée, en comparaison avec une alimentation plus riche en acides gras saturés (Buckland et al., 2008). Ce type d’alimentation aurait également des effets bénéfiques dans la prévention et le traitement du diabète de type 2. Une récente méta-analyse rapporte qu’une meilleure adhésion à ce mode alimentaire est associée à une diminution de 23% du risque de développer le diabète de type 2 (Koloverou et al., 2014). Des études indiquent que l’adhésion à cette alimentation permettrait également une meilleure prise en charge du diabète, notamment par un meilleur contrôle glycémique et une amélioration de la sensibilité à l’insuline (Ajala et al., 2013; Estruch et al., 2006). D’autre part, l’obésité, plus particulièrement l’obésité abdominale, constitue un facteur de risque important dans le développement du diabète de type 2 (Hu et al., 2001; Wang et al., 2005). Comme certaines études ont démontré que l’adhésion à l’alimentation méditerranéenne peut avoir des effets favorables sur le poids, ce mécanisme peut aussi contribuer à expliquer le rôle protecteur de ce mode alimentaire sur le risque de diabète de type 2 (Buckland et al., 2008; Schroder, 2007). 20 En résumé, l’alimentation méditerranéenne est associée à plusieurs bienfaits sur la santé et son rôle protecteur dans la prévention de MCV est maintenant établi avec le niveau le plus élevé d’évidence scientifique. 1.3.2 Bienfaits sur la qualité de vie L’alimentation méditerranéenne a également été associée à la perception d’une meilleure santé physique et mentale, plus précisément dans les populations méditerranéennes (Henriquez Sanchez et al., 2012; Landaeta-Diaz et al., 2013; Munoz et al., 2009). Selon une étude transversale, l’adhésion à l’alimentation méditerranéenne est associée à la perception d’une meilleure qualité de vie relative à la santé, chez les hommes et les femmes (Munoz et al., 2009). L’étude de Henriquez Sanchez et al. appuie ces résultats en démontrant des associations positives entre l’adhésion à l’alimentation méditerranéenne et certains aspects physiques (fonctionnement physique, limites liées à la santé physique, tolérance à la douleur physique, santé générale) et mentaux (limites liées aux émotions, vitalité, fonctionnement social) reliés à la qualité de vie (Henriquez Sanchez et al., 2012). De plus, leurs résultats indiquent qu’une adhésion élevée à cette alimentation au départ ou une augmentation de l’adhésion durant le suivi serait associée à une meilleure qualité de vie physique (fonctionnement physique, santé générale) et mentale (vitalité). Les auteurs soulignent toutefois une limite importante à l’égard de leur étude, soit le fait que la qualité de vie ait été évaluée seulement après le suivi de 4 ans. Par conséquent, la relation suggérée entre l’adhésion à l’alimentation méditerranéenne et la qualité de vie ne permet pas de considérer le niveau de qualité de vie des individus au départ (Henriquez Sanchez et al., 2012). Divers mécanismes sont suggérés afin d’expliquer l’impact positif de l’alimentation méditerranéenne sur la qualité de vie, notamment les effets favorables de cette alimentation sur le risque de maladies chroniques et sur les facteurs de risque qui y sont associés (Martinez-Gonzalez et al., 2008; Martinez-Gonzalez et al., 2011; Sanchez-Villegas et al., 2006). L’adhésion à l’alimentation méditerranéenne a aussi été associée à une meilleure santé mentale, plus précisément par ses effets protecteurs sur le risque de développer des 21 maladies dégénératives ou des désordres mentaux, et sur le risque de déclin cognitif (Engelhart et al., 2002; Sanchez-Villegas et al., 2009; Sofi et al., 2010). En définitive, la littérature supporte les bienfaits de l’alimentation méditerranéenne sur la santé, mais également sur la qualité de vie des individus. Une fois de plus, ceci témoigne de la pertinence d’avoir recours à ce modèle d’alimentation en vue de préserver une santé et un bien-être optimaux. 1.4 Déterminants des choix alimentaires sains Bien que l’adoption de saines habitudes alimentaires puisse contribuer à un meilleur état de santé, plusieurs facteurs provenant de l’environnement et liés à l’individu sont susceptibles d’influencer les choix alimentaires, et peuvent ainsi influencer le potentiel d’adhérer à des recommandations alimentaires en vue d’améliorer la santé (Brug et al., 2008). Les choix alimentaires sont motivés par des attributs d’ordre individuel qui se situent dans le contexte plus large de facteurs familiaux, sociaux, culturels, économiques, politiques et physiques (Raine, 2005). Parmi les déterminants collectifs de la saine alimentation, mentionnons l’étiquetage nutritionnel, un environnement favorable à la disponibilité et l’accessibilité des aliments sains à coût abordable, les messages publicitaires ainsi que les habitudes et comportements alimentaires de l’entourage de l’individu, par exemple la famille, les amis et les collègues (Raine, 2005). Les choix alimentaires d’une personne sont également influencés par des déterminants individuels. À cet égard, la motivation est reconnue comme un concept central impliqué dans le processus de choix alimentaires sains (Guillaumie et al., 2010), et sera abordée plus en détails à la section 1.7.3. D’autres facteurs individuels peuvent se rapporter à la génétique, l’état physiologique (p.ex., la faim), l’expérience personnelle à l’égard des aliments (p.ex., les préférences alimentaires), aux connaissances, perceptions et croyances à l’égard de la saine alimentation et à la préoccupation reliée au poids et à l’image corporelle (Drewnowski, 1997; Freeland-Graves & Nitzke, 2013; Raine, 2005). Ces déterminants peuvent aussi interagir avec certaines 22 caractéristiques sociodémographiques, incluant l’âge, le niveau d’éducation et le genre (Henson et al., 2010). Tous ces facteurs peuvent influencer les choix alimentaires et par conséquent favoriser ou non une saine alimentation. Cependant, dans l’optique de mieux comprendre les différences interindividuelles dans la réponse à une intervention nutritionnelle visant à améliorer la santé, une attention particulière doit être accordée aux déterminants individuels. Parmi les facteurs mentionnés précédemment, le genre ressort comme un aspect important. Afin de mieux comprendre l’implication du genre dans le contexte de l’alimentation, il importe d’abord de définir plus clairement ce concept. 1.4.1 Définition des concepts de genre et de sexe Depuis quelques années, un intérêt de plus en plus important est accordé aux différences entre les hommes et les femmes dans les domaines de la santé et de l’alimentation (Cornier et al., 2010; Shi et al., 2009; Stevens et al., 2010). Plusieurs arguments soutiennent l’importance de considérer les différences entre les hommes et les femmes dans le domaine de la santé lorsque l’on s’intéresse aux variations interindividuelles, notamment afin d’améliorer la qualité des travaux scientifiques au point de vue de la validité, de la fiabilité et de la généralisation des résultats d’études (Institute of Gender and Health, 2012). Cependant, dans un tel contexte, il importe de distinguer les différences sexuelles des différences relatives au genre lorsque l’on compare les hommes et les femmes. Globalement, le sexe et le genre sont deux concepts fortement liés entre eux, mais toutefois distincts (Institute of Gender and Health, 2012). Actuellement, une limite importante dans la littérature se traduit par une utilisation de ces deux concepts de façon interchangeable, possiblement en raison d’une mauvaise compréhension de leur définition respective. Le genre réfère aux rapports socialement construits, traits de personnalité, attitudes, comportements, valeurs, puissance relative et influence que la société attribue aux hommes et aux femmes. Pour sa part, le sexe se définit comme un construit biologique regroupant 23 les variations anatomiques, physiologiques, génétiques et hormonales existant entre les espèces. Dans une perspective de préciser le réel impact de l’adhésion à des recommandations alimentaires sur la santé, les différences relatives au genre et au sexe ont avantage à être considérées. 1.4.2 Différences relatives au genre quant aux habitudes et comportements alimentaires De façon générale, les femmes rapportent une meilleure qualité alimentaire que les hommes (Garriguet, 2009; Liebman et al., 2006). Selon la littérature, les femmes ont une consommation plus élevée de fruits et légumes, aliments riches en fibres alimentaires et faibles en lipides, et consomment moins de viandes rouges, d’alcool et de boissons gazeuses que les hommes (Arganini, 2012; Kiefer et al., 2005; Li et al., 2000; Liebman et al., 2001). Plusieurs études indiquent que les hommes et les femmes présentent aussi des caractéristiques différentes liées à leurs attitudes et croyances à l’égard de l’alimentation et de la santé (Arganini, 2012; Beardsworth, 2002; Wardle et al., 2004). En effet, les hommes accorderaient moins d’importance à l’adoption d’une saine alimentation comparativement aux femmes (Courtenay et al., 2002; Wardle et al., 1997), et il est à noter que cette tendance a été observée dans plusieurs pays à travers le monde (Wardle et al., 2004). De plus, les hommes semblent attribuer une priorité moindre à la santé dans le processus de choix alimentaires en comparaison à d’autres éléments tels que les saveurs et la commodité des aliments (Fagerli & Wandel, 1999; Steptoe et al., 2002; Wardle et al., 2004), et affirment être davantage ambivalents face à des choix alimentaires sains en comparaison avec les femmes (Povey et al., 2001; Sparks et al., 2001). D’autres études ont démontré que les femmes ont une attitude plus positive à l’égard de l’alimentation, sont plus susceptibles de se mettre en action afin d’améliorer leurs habitudes alimentaires, rapportent un niveau de connaissances en nutrition plus élevé et affirment lire davantage les étiquettes 24 nutritionnelles comparativement aux hommes (Baker & Wardle, 2003; Goodman et al., 2011; Krukowski et al., 2006). Par ailleurs, des données indiquent qu’une proportion plus importante de femmes que d’hommes rapportent faire des efforts afin d’avoir des apports alimentaires concordant avec les recommandations alimentaires. Les différences entre les hommes et les femmes liées aux attitudes et croyances à l’égard de l’alimentation sont donc susceptibles d’expliquer en partie les différences relatives au genre observées dans les habitudes alimentaires (Wardle et al., 2004). Les différents rôles sociaux et responsabilités attribués aux hommes et aux femmes dans la société peuvent aussi sans doute expliquer les différences notées entre les hommes et les femmes dans le contexte de l’alimentation. Les femmes sont plus nombreuses que les hommes à être en charge de l’achat et de la préparation des repas sur une base régulière (Beardsworth, 2002). De plus, davantage de femmes que d’hommes se considèrent compétents pour cuisiner à partir d’ingrédients de base (Beardsworth, 2002). Un autre aspect important à considérer est la préoccupation reliée au poids et à l’alimentation. À cet égard, on constate qu’une proportion plus élevée de femmes que d’hommes affirment faire des efforts afin de contrôler leur poids en modifiant leur alimentation (Johnson & Bedford, 2004; Wardle et al., 2004). Considérant que les diètes visent typiquement la perte de poids en amenant la personne vers une alimentation composée d’aliments faibles en lipides et en sucre et abondante en fruits et légumes, et que les femmes rapportent être plus souvent à la diète que les hommes, il est possible que les différences de genre observées dans les habitudes alimentaires s’expliquent en partie par l’histoire de diètes (Liebman et al., 2001; Wardle et al., 2000, 2004). Dans le même sens, certains auteurs suggèrent que les femmes affichent un désir plus important de consommer des aliments peu caloriques (Fagerli & Wandel, 1999). Par ailleurs, selon une étude menée aux Pays-Bas, les femmes semblent également plus susceptibles que les hommes de ressentir un sentiment de culpabilité envers la nourriture, de consommer des aliments afin de se réconforter en présence de stress ou d’ennui et d’avoir certaines pensées obsessives à l’égard de leur alimentation (Beardsworth, 2002). En résumé, des distinctions sont observées entre les hommes et les femmes dans leur relation envers la nourriture. 25 Plusieurs outils ont été proposés afin de mesurer différents aspects reliés aux comportements alimentaires. Le Three-Factor Eating Questionnaire permet d’évaluer certaines dimensions du comportement alimentaire, plus spécifiquement la restriction cognitive (qui se caractérise par l’intention de contrôler la quantité ou la qualité de ses apports alimentaires afin de contrôler son poids), la désinhibition (qui se définit par une surconsommation d’aliments en réponse à une variété de stimuli associés à un sentiment de perte de contrôle sur la prise alimentaire) et la susceptibilité à la faim (qui réfère à la consommation d’aliments en réponse à des sensations et des perceptions de faim interne et externe), et fut utilisé dans un très grand nombre d’études (Stunkard & Messick, 1985). Des différences relatives au genre ont été documentées à l’égard de ces comportements alimentaires. De façon générale, les femmes présentent un niveau de restriction cognitive plus élevé que les hommes et sont plus susceptibles de restreindre volontairement leurs apports alimentaires dans le but de contrôler leur poids corporel ou de favoriser la perte de poids (Carmody et al., 1995; Neumark-Sztainer et al., 1999; Provencher et al., 2003). Bien que la littérature ne soit pas unanime à ce sujet, certaines études rapportent une association négative entre la restriction cognitive et l’apport énergétique (de Castro, 1995; Lindroos et al., 1997). En ce qui a trait à la désinhibition alimentaire, les hommes présentent en général des niveaux moins élevés que les femmes (Carmody et al., 1995; Neumark-Sztainer et al., 1999; Provencher et al., 2003). Cependant, selon une étude de Drapeau et al., les hommes seraient plus susceptibles à la désinhibition situationnelle, c’est-à-dire associée à des facteurs contextuels tels que la présence de nourriture, et moins à la désinhibition émotionnelle, c’est-à-dire associée à des émotions positives ou négatives, par rapport aux femmes (Drapeau et al., 2003). Chez les hommes comme chez les femmes, la désinhibition est associée positivement à l’apport énergétique (Lindroos et al., 1997) ainsi qu’à la densité énergétique (Goulet et al., 2008). En ce qui concerne la susceptibilité à la faim, il semble que les hommes soient plus influencés par des sensations de faim interne comparativement aux femmes, ce qui suggère une perception plus efficace des sensations physiologiques de la faim chez les hommes (Drapeau et al., 2003). En résumé, les différences entre les hommes et les femmes liées aux attitudes, croyances, responsabilités, rôles sociaux et comportements à l’égard de l’alimentation et de la santé 26 sont de plus en plus documentées dans la littérature et méritent d’être considérées dans le contexte de changements alimentaires (Arganini, 2012; Beardsworth, 2002; Wardle et al., 2004). 1.4.3 Impact de l’alimentation sur la santé : l’influence du sexe Des différences fondamentales existent entre les hommes et les femmes quant à l’impact de l’alimentation sur la santé. Plus précisément, le fait qu’un même changement alimentaire exerce des effets différents sur le profil métabolique des hommes et des femmes relève davantage de différences sexuelles. Jusqu’à maintenant, une part considérable de ces différences a été attribuée aux rôles des estrogènes (Brown & Clegg, 2010). Les différences observées entre les hommes et les femmes quant aux effets de la prise alimentaire sur la santé seraient en partie attribuables aux rôles des estrogènes liés à la composition et la distribution du tissu adipeux (Brown & Clegg, 2010; Stevens et al., 2010). En effet, les femmes présentent un pourcentage de tissu adipeux plus élevé que les hommes et emmagasinent une proportion plus importante de tissu adipeux au niveau souscutané. À l’inverse, les hommes présentent un pourcentage de tissu adipeux plus faible et emmagasinent de façon préférentielle le tissu adipeux au niveau abdominal. Dans la littérature, il est bien établi que l’accumulation de tissu adipeux au niveau abdominal contribue à augmenter le risque de MCV, notamment par le développement de dyslipidémies et de la résistance à l’insuline (Bjorntorp, 1996; Wajchenberg, 2000). Les estrogènes pourraient expliquer en partie ces différences dans la composition corporelle, possiblement par un taux d’oxydation des acides gras plus faible en état postprandial chez les femmes que chez les hommes (Wu & O'Sullivan, 2011). En d’autres mots, une conversion de l’énergie sous forme de tissu adipeux serait favorisée chez les femmes par l’effet des estrogènes. D’autre part, ces hormones semblent aussi réguler la distribution du tissu adipeux. En effet, le tissu adipeux abdominal varie inversement selon les niveaux d’estrogènes (Bouchard et al., 1993) et l’accumulation de tissu adipeux abdominal se produit chez les femmes lorsque les niveaux d’estrogènes deviennent suffisamment faibles (Shi et al., 2009). Enfin, plusieurs travaux indiquent que les estrogènes seraient également 27 impliquées dans la régulation de la prise alimentaire et des sensations d’appétit (Shi et al., 2009; Brown & Clegg, 2010). Par exemple, ces hormones pourraient influencer l’action de l’insuline liée à l’équilibre énergétique via une influence sur la prise alimentaire et l’entreposage du tissu adipeux (Shi et al., 2009; Brown & Clegg, 2010). De façon sommaire, ces travaux indiquent que l’impact d’une perte ou d’un gain de poids sur l’accumulation ou la mobilisation des graisses n’est pas le même chez les hommes et les femmes en raison de leur profil hormonal, et que ces différences dans la distribution du tissu adipeux peut avoir des effets sur le profil métabolique. Des différences sexuelles en réponse à des interventions nutritionnelles menées dans un contexte isocalorique, c’est-à-dire un contexte où le poids demeure stable, ont également été observées dans la littérature. En effet, les travaux de Knopp et al. ont montré qu’un changement dans les apports en lipides et en glucides avait un impact plus important sur les concentrations de C-LDL et sur le ratio C-total sur C-HDL chez les hommes que chez les femmes. Au contraire, ce même changement alimentaire avait un impact plus important sur les concentrations de C-HDL et de triglycérides chez les femmes que chez les hommes (Knopp et al., 2005). Ces résultats suggèrent que les changements alimentaires n’ont pas nécessairement les mêmes effets sur les facteurs de risque cardiovasculaire chez les hommes et les femmes, et que ces différences pourraient s’expliquer par les hormones sexuelles (Knopp et al., 2005). En résumé, dans un contexte qui reproduit les conditions de vie réelle, par exemple une intervention nutritionnelle visant à améliorer les habitudes alimentaires et la santé, les différences rapportées entre les hommes et les femmes peuvent ainsi s’expliquer à la fois par des différences relatives au genre et des différences sexuelles, et le fait de considérer ces deux concepts favorise une compréhension plus exacte des différences entre les hommes et les femmes dans la réponse à une intervention nutritionnelle. 28 1.5 Différences entre les hommes et les femmes en réponse à une intervention nutritionnelle visant la prévention de maladies cardiovasculaires Peu d’études ont directement comparé les hommes et les femmes dans leur réponse à une intervention nutritionnelle. Néanmoins, certaines études suggèrent que les changements observés en ce qui a trait au profil métabolique ne seraient pas les mêmes chez les hommes et les femmes en réponse à une intervention nutritionnelle donnée (Knopp et al., 2005; Li et al., 2003; Weggemans et al., 1999). Plus précisément, des différences entre les hommes et les femmes ont été rapportées en réponse à des interventions visant la modification de la composition en macronutriments d’une diète dans un contexte d’intervention contrôlée, c’est-à-dire où une partie ou la totalité des aliments et boissons à consommer est fournie aux individus. Comme la diminution des lipides alimentaires a longtemps été la principale cible en prévention et dans le traitement des MCV, plusieurs études ont comparé les hommes et les femmes dans un contexte d’intervention visant la diminution des apports en lipides totaux et en acides gras saturés. Certaines études ont démontré que les hommes répondaient mieux à une intervention nutritionnelle visant la diminution de leur apport en acides gras saturés, par une diminution des concentrations de C-LDL plus importante que chez les femmes (Knopp et al., 2005; Li et al., 2003; Weggemans et al., 1999). Une étude de Li et al. effectuée auprès d’hommes et de femmes présentant un risque modéré de dyslipidémies rapporte une diminution plus marquée des concentrations de C-LDL chez les hommes comparativement aux femmes en réponse à une diète faible en lipides totaux et en acides gras saturés dans un contexte isocalorique (Li et al., 2003). Des résultats semblables ont été rapportés par Weggemans et al. chez des hommes et des femmes en santé, avec des diminutions plus importantes des concentrations de C-total et de C-LDL chez les hommes que chez les femmes en réponse à une diète faible en acides gras saturés (Weggemans et al., 1999). Comme ces interventions ont été effectuées dans un contexte contrôlé, les différences rapportées entre les hommes et les femmes dans les changements métaboliques s’expliqueraient davantage par des différences sexuelles, et possiblement en partie par les hormones sexuelles (Knopp et al., 2005). Il est toutefois à noter que dans la littérature, 29 certaines études ne rapportent aucune différence entre les hommes et les femmes dans la réponse à une diète donnée (Lapointe et al., 2006). Des différences liées au type et à la quantité de lipides ciblés de même que la contribution d’autres facteurs nutritionnels tels que l’apport en glucides pourraient expliquer les divergences observées entre les études. 1.6 Différences entre les hommes et les femmes dans le contexte de l’alimentation méditerranéenne 1.6.1 Différences entre les hommes et les femmes dans l’adhésion à l’alimentation méditerranéenne L’impact de l’alimentation méditerranéenne sur le risque de MCV a rarement été évalué chez les hommes et les femmes distinctement. D’un point de vue épidémiologique, quelques études réalisées dans des populations méditerranéennes indiquent un effet bénéfique plus important de l’alimentation méditerranéenne chez les femmes que chez les hommes. Une étude de Chrysohoou et al. menée auprès d’hommes et de femmes grecs visait à comparer les hommes et les femmes quant à l’impact des facteurs de risque cardiovasculaire sur le risque de développer une MCV au sein d’une population méditerranéenne (Chrysohoou et al., 2003). Leurs résultats indiquent que les femmes adhèrent davantage à l’alimentation méditerranéenne traditionnelle comparativement aux hommes, ce qui expliquerait l’effet protecteur plus important de cette alimentation sur le risque de MCV chez les femmes que chez les hommes. Une autre étude ayant évalué l’effet de l’adhésion à l’alimentation méditerranéenne sur la présence de facteurs de risque impliqués dans le développement de MCV rapporte des résultats semblables, avec un effet protecteur plus marqué de l’alimentation méditerranéenne sur la santé cardiovasculaire des femmes que des hommes (Panagiotakos et al., 2007). 30 1.6.2 Différences entre les hommes et les femmes dans la réponse à une intervention nutritionnelle basée sur l’alimentation méditerranéenne Dans le contexte d’une intervention contrôlée menée dans des conditions isocaloriques, une récente étude québécoise s’est intéressée aux différences entre les hommes et les femmes quant à l’impact de l’alimentation méditerranéenne sur les facteurs de risque cardiovasculaire (Bédard et al., 2014). Cette étude a démontré une différence entre la réponse des hommes et celle des femmes en ce qui a trait aux changements dans l’homéostasie de l’insuline en réponse à l’adhésion à l’alimentation méditerranéenne, avec une amélioration observée chez les hommes seulement. Ces résultats démontrent que l’adoption de l’alimentation méditerranéenne engendre des changements métaboliques attribuables à des différences sexuelles, mais n’excluent pas la possibilité de différences relatives au genre, comme par exemple des différences liées au niveau d’adhésion aux recommandations alimentaires. À ce propos, certaines études ont évalué la réponse des hommes et des femmes à un programme d’éducation en nutrition visant l’adoption de l’alimentation méditerranéenne. En effet, les résultats d’une intervention effectuée dans une population italienne à risque de MCV indiquent que l’adhésion à l’alimentation méditerranéenne mène à des effets bénéfiques similaires sur certains facteurs de risque cardiovasculaire non traditionnels, plus particulièrement sur la dysfonction endothéliale et sur les marqueurs de l’inflammation, chez les hommes et les femmes (Esposito et al., 2004). Cependant, puisque les auteurs ne rapportent pas le niveau d’adhésion à l’alimentation méditerranéenne, il est impossible de déterminer si l’amélioration des facteurs de risque est associée à une adhésion aux recommandations alimentaires semblable chez les hommes et les femmes. Récemment, le succès du programme d’éducation en nutrition développé dans le cadre de l’intervention PREDIMED a été rapporté selon le genre (Zazpe et al., 2010). Plus précisément, l’intervention était d’une durée de 12 mois et basée sur une approche motivationnelle, et incluait 1) une rencontre individuelle tous les trois mois lors de laquelle les personnes recevaient des recommandations individualisées favorables à l’adhésion à 31 l’alimentation méditerranéenne; 2) une rencontre de groupe tous les trois mois; 3) de la documentation fournissant une description des aliments méditerranéens traditionnels, une liste d’achats variant au fil des saisons, des plans alimentaires, des recommandations en lien avec la fréquence de consommation à atteindre et des recettes; 5) une quantité constante d’huile d’olive vierge (équivalente à 1L / semaine) ou de noix mélangées (équivalente à 30 g/jour) (Zazpe et al., 2008). Il est à noter qu’aucune restriction calorique n’était exigée de la part des participants dans le cadre de cette étude. Les auteurs évaluaient le succès de l’intervention par l’atteinte d’un minimum de quatre des cinq changements visant à améliorer l’adhésion à l’alimentation méditerranéenne. Plus spécifiquement, les changements visés se traduisaient par une augmentation de la consommation de fruits, de légumes et du ratio acides gras monoinsaturés sur acides gras saturés, et une diminution de la consommation de viandes et de sucreries. Les résultats de cette étude ont démontré un succès plus élevé en terme d’adhésion à l’alimentation méditerranéenne chez les hommes que chez les femmes (Zazpe et al., 2008). Les travaux de ces auteurs ne permettent toutefois pas de mettre directement en relation le succès de l’intervention selon le niveau d’adhésion à l’alimentation méditerranéenne et l’amélioration des facteurs de risque cardiovasculaire après l’intervention de 12 mois selon le genre. En effet, seuls les changements métaboliques observés après trois mois d’intervention ont été évalués distinctement chez les hommes et les femmes (Estruch et al., 2006). Ces résultats indiquent que les hommes et les femmes améliorent de façon semblable leurs facteurs de risque cardiovasculaire au cours des trois premiers mois d’intervention (Estruch et al., 2006). Les différences entre les hommes et les femmes en réponse à un programme d’éducation en nutrition ont également été rapportées dans une population non méditerranéenne. En effet, une étude menée aux Pays-Bas a évalué l’impact d’un programme d’éducation visant l’adoption de l’alimentation méditerranéenne auprès d’hommes et de femmes présentant une hypercholestérolémie (Bemelmans et al., 2000). L’intervention était d’une durée de 12 mois et comportait trois rencontres de groupe. Ces rencontres visaient principalement à transmettre des connaissances reliées à l’alimentation méditerranéenne et à améliorer les habiletés relatives à l’achat et la préparation des aliments (Siero et al., 2000). Des recommandations alimentaires spécifiques portant sur le nombre de portions à consommer 32 quotidiennement étaient également transmises aux participants (Siero et al., 2000). Les auteurs rapportent que les femmes ont augmenté de façon significative leur apport en fibres alimentaires, leur consommation de fruits et de volaille, et diminué leur consommation de viandes rouges, alors que de tels changements n’ont pas été observés chez les hommes (Bemelmans et al., 2000). Les résultats indiquent aussi une diminution des concentrations de C-total chez les femmes et non chez les hommes en réponse à l’intervention, suggérant ainsi un meilleur succès de l’intervention chez les femmes (Bemelmans et al., 2000). En définitive, parmi les rares études ayant comparé l’impact de l’alimentation méditerranéenne sur le risque de MCV selon le genre, les données suggèrent pour la plupart que les hommes et les femmes répondent différemment à une intervention nutritionnelle basée sur l’alimentation méditerranéenne en ce qui concerne les changements métaboliques, et que ces différences peuvent s’expliquer en partie par le niveau d’adhésion à l’intervention. 1.7 Théories de changements de comportements liés à la santé Les théories de changements de comportements visent à comprendre les mécanismes sousjacents et à identifier les cibles d’intervention favorables à un changement de comportement, et permettent ainsi de développer des interventions pouvant conduire à un changement planifié des comportements. Un survol de trois théories couramment citées dans le domaine du changement de comportement en santé, soit 1) la théorie sociale cognitive, 2) le modèle transthéorique et 3) la théorie de l’autodétermination, est présenté dans cette section. 1.7.1 Théorie sociale cognitive La théorie sociale cognitive (TSC) a été développée par Bandura en 1986 et se décrit à la fois comme une théorie de prédiction et du changement de comportement (Bandura, 1986). En effet, elle permet non seulement d’expliquer le comportement à partir de divers 33 GpWHUPLQDQWV PDLV DXVVL OHV SURFHVVXV GH FKDQJHPHQW HW OHV VWUDWpJLHV j IDYRULVHU DILQ GH PHQHU j XQ FKDQJHPHQW GH FRPSRUWHPHQW *RGLQ /D 76& UHJURXSH TXDWUH FRQVWUXLWVOHVDWWHQWHVFRQFHUQDQWOHVUpVXOWDWVGHO¶DFWLRQTXLFRQVWLWXHQWOHVFUR\DQFHV HQ O¶HIILFDFLWp GX FRPSRUWHPHQW SRXU REWHQLU OH UpVXOWDW GpVLUp OHV FUR\DQFHV HQ O¶HIILFDFLWpSHUVRQQHOOHGDQVO¶DGRSWLRQG¶XQFRPSRUWHPHQWOHVIDFWHXUVVRFLRVWUXFWXUHOV TXL UpIqUHQW DX[EDUULqUHVHW pOpPHQWV IDFLOLWDQW O¶DGRSWLRQGXFRPSRUWHPHQWSXLV OHV EXWVGLVWDX[D\DQWSRXUIRQFWLRQG¶RULHQWHUOHVFRPSRUWHPHQWVHWSUR[LPDX[D\DQWSRXU IRQFWLRQGHUpJXOHUO¶HIIRUWHWJXLGHUO¶DFWLRQ)LJXUH )LJXUH6FKpPDWLVDWLRQGHODWKpRULHVRFLDOHFRJQLWLYH$GDSWpHGH%DQGXUDHWWLUpH GXOLYUH/HVFRPSRUWHPHQWVGDQVOHGRPDLQHGHODVDQWp*RGLQ /DQRWLRQG¶HIILFDFLWpSHUVRQQHOOHHVW XQFRQFHSWFHQWUDO GDQVFHWWHWKpRULHHW FRQVWLWXHOD EDVH GH OD PRWLYDWLRQ GH OD SHUVpYpUDQFH HW GHV UpDOLVDWLRQV /¶HIILFDFLWp SHUVRQQHOOH VH GpILQLWFRPPHODSHUFHSWLRQTX¶DXQLQGLYLGXTXDQWjVDFDSDFLWpG¶DGRSWHUDYHFVXFFqVOHV FRPSRUWHPHQWVUHTXLVFHTXLOHPRWLYHjV¶HQJDJHUGDQVO¶DFWLRQHWjSHUVpYpUHUPDOJUpOD SUpVHQFH GH EDUULqUHV %DQGXUD /D 76& VRXWLHQW TX¶XQH SHUVRQQH D\DQW XQ VHQWLPHQWG¶HIILFDFLWpSHUVRQQHOOHIDLEOHQHV¶HQJDJHUDSDVGDQVO¶DFWLRQSXLVTX¶HOOHQHFURLW SDV DYRLUOHVFRPSpWHQFHV QpFHVVDLUHVHW SUpVHQWHXQpWDWpPRWLRQQHOQpJDWLI¬O¶LQYHUVH XQH SHUVRQQH D\DQW XQ VHQWLPHQW G¶HIILFDFLWp SHUVRQQHOOH pOHYp VHUD SOXV VXVFHSWLEOH d’adopter le comportement puisqu’elle a le sentiment d’avoir les compétences et présente un état émotionnel moins négatif. Une des principales forces de la TSC s’explique par le fait que cette théorie permet de prédire un changement de comportement, en plus de fournir des stratégies pour amener un individu à changer son comportement (Godin, 2012). Cependant, on rapporte que ce modèle s’avère complexe à utiliser lorsque considéré dans son intégralité (Godin, 2012). 1.7.2 Modèle transthéorique Prochaska et DiClemente sont les auteurs du modèle transthéorique (MTT) dont l’origine remonte dans les années 1980 (Prochaska & DiClemente, 1983). Le MTT aborde le changement de comportement comme un processus dynamique qui évolue à travers différents stades. Essentiellement, le modèle permet d’évaluer six stades du changement, deux processus cognitifs (attitude et efficacité personnelle) ainsi que divers processus de changement (Godin, 2012). Plus spécifiquement, les stades de changement incluent la précontemplation (pré-réflexion), la contemplation (réflexion), la préparation, l’action, le maintien et la conclusion (terminaison) (Figure 3). Figure 3. Schématisation du modèle transthéorique. Adaptée de Prochaska et al., 1994, et tirée du livre Les comportements dans le domaine de la santé (Godin, 2012). 35 Selon le MTT, le cheminement d’une personne à travers les stades du changement n’est pas nécessairement linéaire et le changement entre deux stades peut s’effectuer de façon progressive ou régressive. De plus, l’atteinte d’un stade n’est pas définitive, c’est-à-dire qu’une personne peut par exemple atteindre le stade d’action et retourner en contemplation par la suite. Cette théorie suggère des stratégies expérientielles (visant la prise de conscience) et des stratégies comportementales (impliquées dans le processus décisionnel d’action) ayant pour objectif de favoriser le passage d’un stade à l’autre. Le MTT propose également deux processus cognitifs permettant de prédire l’adoption d’un comportement, le premier étant la balance décisionnelle où sont évalués les avantages et les désavantages perçus à l’adoption du comportement, et le deuxième est celui de l’efficacité personnelle. Ce modèle soutient que les personnes de stades différents se distingueraient par leurs attitudes (avantages et désavantages perçus) et leur sentiment d’efficacité personnelle, et présenteraient des cognitions plus favorables en progressant à travers les stades de changement. Le MTT permet d’identifier les cognitions susceptibles d’être présentes chez les individus selon le stade où ils se trouvent et permet alors de préciser le message à leur transmettre, ce qui constitue l’une des principales forces de ce modèle (Godin, 2012). Toutefois, ce dernier s’avère critiqué en raison du fait que des périodes de temps arbitraires sont suggérées afin de définir les différents stades de changement et que le délai nécessaire pour modifier un comportement est fixe peu importe le comportement et la population ciblés. En résumé, on constate que la TSC et le MTT sont des théories qui permettent de prédire un changement de comportement. Or, dans le but de développer une intervention nutritionnelle visant des changements alimentaires durables, il s’avère pertinent de recourir à une théorie qui prédit également le maintien du comportement. Une particularité qui distingue la théorie de l’autodétermination (TAD) des autres théories présentées dans cette section relève du fait qu’elle permet à la fois de prédire le changement et le maintien d’un comportement (Deci & Ryan, 1985; Ryan & Deci, 2000). D’autre part, la motivation est reconnue comme un facteur déterminant dans le changement des habitudes et comportements alimentaires et cette théorie repose essentiellement sur la qualité de la motivation humaine (Deci & Ryan, 1985; Ryan & Deci, 2000). 36 1.7.3 Théorie de l’autodétermination La TAD est une théorie proposée par les auteurs Deci et Ryan et s’intéresse à la qualité de la motivation impliquée dans la régulation d’un comportement ainsi qu’aux conséquences sur l’apprentissage, la performance, l’expérience personnelle et le bien-être qui s’y rattachent (Deci & Ryan, 1985; Ryan & Deci, 2000). Cette théorie postule qu’un comportement peut être régulé par différentes formes de motivation qui se distinguent par leur niveau d’autodétermination (Deci & Ryan, 1985; Ryan & Deci, 2000). Ces formes de motivation sont regroupées en trois catégories, soit la motivation intrinsèque, la motivation extrinsèque (incluant la régulation externe, introjectée, identifiée et intégrée) et l’amotivation. Plus précisément, la motivation intrinsèque reflète le degré le plus élevé d’autodétermination et se définit par le fait de s’investir dans une activité pour la satisfaction et le plaisir émanant de l’activité elle-même. Par exemple, dans le contexte alimentaire, une personne qui prend plaisir à cuisiner des repas équilibrés fait preuve d’une motivation intrinsèque. La régulation intégrée constitue la forme la plus autodéterminée de la motivation extrinsèque et représente l’assimilation de la régulation aux valeurs personnelles, c’est-à-dire que la régulation est en parfaite congruence avec les besoins et autres valeurs de la personne. Un individu qui choisit de manger sainement parce que cela fait partie intégrante de son style de vie démontre une régulation intégrée. La régulation identifiée reflète la participation à une activité en raison d’une conséquence personnellement significative et importante de la mise en pratique de l’activité, malgré le fait que la personne peut ne pas apprécier l’activité en soi. Par exemple, si une personne considère que de manger sainement est une façon de s’assurer des bienfaits à long terme au plan de la santé, celle-ci fait preuve de régulation identifiée. La régulation introjectée survient quand un comportement est guidé par des pressions internes, afin d’éviter les émotions négatives telles que l’anxiété et le sentiment de culpabilité. On peut reconnaître la régulation introjectée si par exemple une personne se soucie de son alimentation parce qu’elle ne veut pas avoir honte de son apparence. La régulation externe constitue la forme de régulation la moins autodéterminée et qui s’observe lorsqu’un individu effectue une activité dans le but d’obtenir une récompense ou afin d’éviter les 37 SXQLWLRQV3DUH[HPSOHXQHSHUVRQQHTXLVHVRXFLHGHVRQDOLPHQWDWLRQSDUFHTXHOHVJHQV DXWRXUG¶HOOHOXLPHWWHQWGHODSUHVVLRQSRXUOHIDLUHIDLWSUHXYHGHUpJXODWLRQH[WHUQH(QILQ O¶DPRWLYDWLRQVHWUDGXLWSDUXQPDQTXHGHPRWLYDWLRQLQWULQVqTXHHWH[WULQVqTXHjO¶pJDUG G¶XQHDFWLYLWpHWXQHLQFDSDFLWpjWURXYHUXQVHQVjVHVDFWHV3DUH[HPSOHXQHSHUVRQQHTXL DIILUPH QH SDV VDYRLU SRXU TXHOOHV UDLVRQV HOOH GHYUDLW VH GRQQHU OD SHLQH GH PDQJHU VDLQHPHQWIDLWSUHXYHG¶DPRWLYDWLRQ /DYDOLGLWpG¶XQFRQWLQXXPG¶DXWRGpWHUPLQDWLRQDOODQWGHODPRWLYDWLRQQRQDXWRGpWHUPLQpH YHUV OD PRWLYDWLRQ DXWRGpWHUPLQpH HVW VXSSRUWpH SDU SOXVLHXUV WUDYDX[ 9DOOHUDQG )LJXUH&HSHQGDQWLOHVWpJDOHPHQWSRVVLEOHGHGLFKRWRPLVHUOHVGLIIpUHQWHVIRUPHVGH PRWLYDWLRQVHORQGHX[FRPSRVDQWHVVRLWODUpJXODWLRQFRQWU{OpHHWODUpJXODWLRQDXWRQRPH (OOLRW 6KHOGRQ 3HOOHWLHU 6KHOGRQ (OOLRW /D PRWLYDWLRQ QRQ DXWRGpWHUPLQpH RX OD UpJXODWLRQ FRQWU{OpH LQFOXW O¶DPRWLYDWLRQ OD UpJXODWLRQ H[WHUQH HW OD UpJXODWLRQ LQWURMHFWpH ,O HVW j QRWHU TXH O¶DPRWLYDWLRQ HVW SDUIRLV LQFOXVH GDQV OD FRPSRVDQWHGHODPRWLYDWLRQFRQWU{OpHDORUVTX¶RQODUHWURXYHSDUIRLVGDQVXQHFDWpJRULHj SDUWV¶H[SOLTXDQWSRVVLEOHPHQWSDUOHIDLWTX¶HOOHUHIOqWHXQPDQTXHG¶LQWHQWLRQG¶DJLU1J HW DO 3RXU VD SDUW OD PRWLYDWLRQ DXWRGpWHUPLQpH RX OD UpJXODWLRQ DXWRQRPH UHJURXSHODPRWLYDWLRQLQWULQVqTXHODUpJXODWLRQLQWpJUpHHWODUpJXODWLRQLGHQWLILpH )LJXUH 6FKpPDWLVDWLRQ GH OD WKpRULH GH O DXWRGpWHUPLQDWLRQ $GDSWpH GH 5\DQ HW 'HFL 5\DQ'HFL En plus de s’intéresser aux différentes formes de motivation, la TAD vise à expliquer les processus par lesquels les comportements non motivés de façon intrinsèque peuvent devenir véritablement autodéterminés de même que les façons d’influencer ces processus (Deci & Ryan, 1985; Ryan & Deci, 2000). Selon la TAD, une personne n’a pas à progresser par tous les niveaux d’autodétermination dans son évolution face au changement. Il s’agit plutôt d’un progrès qui tient compte de l’expérience antérieure de la personne et de facteurs environnementaux plus ou moins favorables (Ryan, 1995). Cette théorie soutient qu’une personne peut intérioriser l’importance d’un changement, faisant en sorte qu’un comportement initialement régulé par des motifs externes (régulation externe) peut évoluer vers une régulation plus autodéterminée, à condition que les besoins psychologiques fondamentaux relatifs à l’autonomie, la compétence et au sentiment d’attachement soient satisfaits (Ryan & Deci, 2000). L’autonomie réfère à la perception d’effectuer une action par choix personnel et d’avoir le sentiment d’être l’initiateur de ses actions; la compétence réfère à la perception de se sentir en contrôle de son environnement et capable de prédire les conséquences de ses actions; le sentiment d’attachement réfère au besoin d’entrer en relation avec les autres et de ne pas se sentir en rupture avec les valeurs associées à son milieu social de référence (Ryan & Deci, 2000). En terme de conséquences reliées à la motivation, les comportements motivés de façon autonome sont plus susceptibles de mener à des effets positifs et de se maintenir dans le temps alors que les comportements motivés de façon contrôlée sont plutôt associés à des effets négatifs et tendront à être maintenus aussi longtemps qu’il y aura présence d’incitatifs externes (p.ex., récompenses, pression) (Ryan & Deci, 2000; Silva et al., 2008; Vallerand, 1997). Des travaux menés dans divers contextes de vie soutiennent cette proposition (Vallerand, 1997). En effet, les formes de régulation autodéterminées ont été associées à des effets positifs sur l’apprentissage, l’intérêt, la persévérance, les efforts, la performance, l’estime de soi, la santé et la satisfaction à l’égard de la vie, alors que les formes de régulation non autodéterminées ont plutôt été associées négativement à ces effets (Vallerand, 1997). Dans ce modèle théorique, on reconnaît également que le contexte social influence de manière importante la satisfaction des besoins psychologiques, et par le fait même la motivation autodéterminée. À ce sujet, la théorie propose que le soutien à l’autonomie 39 s’avère favorable à la régulation d’un comportement de manière plus autodéterminée (Deci et al., 1994). Dans le cadre d’une intervention visant un changement de comportement, un climat d’intervention favorisant le soutien à l’autonomie s’explique par le fait de considérer le point de vue de la personne, de soutenir ses initiatives, d’offrir plusieurs options, de respecter ses choix, de fournir de l’information pertinente, tout en minimisant la pression et le contrôle exercés (Deci & Ryan, 2012). Bien que la motivation autodéterminée soit abordée dans le contexte de l’alimentation dans le cadre de cette thèse, il importe de mentionner l’existence du modèle hiérarchique de la motivation autodéterminée proposé par Vallerand et al. (Vallerand, 1997; Vallerand & Blanchard, 1998; Vallerand & Ratelle, 2002). Selon ce modèle, les différentes formes de motivation (intrinsèque, extrinsèque et l’amotivation) coexistent à trois niveaux, soit situationnel, contextuel et global, et des interactions entre les différents niveaux motivationnels sont possibles (Vallerand, 1997). On soutient également que la motivation exprimée dans une situation ou dans un contexte donné est plus sujette à changer dans le temps que la motivation globale, qui réfère à l’orientation motivationnelle et qui est assimilable à la personnalité de l’individu. De plus, la motivation évaluée sous un angle contextuel s’avèrerait plus utile afin d’expliquer le changement d’un comportement donné dans un contexte spécifique. 1.7.3.1 Les comportements de santé basés sur la théorie de l’autodétermination Plusieurs études effectuées dans divers domaines de la santé appuient les fondements de la TAD. De façon générale, ces études démontrent qu’un niveau de motivation autodéterminée élevé et la présence de motivation intrinsèque constituent des prédicteurs du succès relié à l’autorégulation de la pratique d’activité physique (Fortier et al., 2007a), des comportements alimentaires (Mata et al., 2009; Pelletier & Dion, 2007; Pelletier et al., 2004), de la régulation du poids corporel (Teixeira et al., 2006), de l’observance à la médication à long terme (Williams et al., 1998), de l’amélioration du contrôle de la glycémie et du respect des recommandations alimentaires chez les patients diabétiques (Williams et al., 1998) et du maintien de la cessation tabagique (Williams et al., 2002b). 40 Des données soutiennent l’impact positif de la motivation autodéterminée sur le maintien d’un changement de comportement de santé à long terme (Fortier et al., 2007a; Teixeira et al., 2006; Williams et al., 1996). À ce propos, certains auteurs indiquent clairement que le fait de se sentir autonome de ses propres actions, c’est-à-dire d’avoir un sentiment d’être libre de ses actions, s’avère un prédicteur crucial pour le maintien du changement de comportement (Williams et al., 2002b). La littérature appuie également l’importance d’un climat d’intervention de qualité dans les changements de comportement de santé. Plusieurs études démontrent que la perception du soutien à l’autonomie de la part d’un intervenant prédit la satisfaction des besoins psychologiques fondamentaux (autonomie, compétence et sentiment d’attachement) et favorise la régulation d’un comportement de façon autodéterminée (Deci et al., 1994; Edmunds et al., 2008; Ng et al., 2012; Silva et al., 2010; Williams et al., 2002a). De plus, la satisfaction de ces besoins et la motivation autodéterminée auraient des effets favorables sur le bien-être, notamment une meilleure santé mentale et des comportements de santé plus sains (Ng et al., 2012). Enfin, la promotion de la motivation autonome envers un comportement de santé donné pourrait avoir des effets favorables dans la régulation d’autres comportements de santé, et ainsi avoir des effets synergiques sur la santé des individus (Dunn et al., 2006; Jakicic et al., 2002). Les résultats d’une étude de Mata et al. supportent ces propos et indiquent que la motivation autonome envers la pratique d’activité physique contribue en partie à l’amélioration de la régulation du comportement alimentaire (Mata et al., 2009). 1.7.3.2 La motivation autodéterminée à l’égard de l’alimentation La TAD permet également de mieux comprendre les processus de régulation du comportement alimentaire. À ce jour, peu d’études ont toutefois considéré la motivation autodéterminée spécifique au contexte de l’alimentation. Des données indiquent d’une part que les personnes qui présentent une motivation autodéterminée dans la vie en général 41 tendent davantage à réguler leurs comportements alimentaires de façon autodéterminée, et d’autre part, qu’une régulation autodéterminée à l’égard de l’alimentation est associée à des habitudes et comportements alimentaires sains (Fuemmeler et al., 2006; Pelletier & Dion, 2007; Pelletier et al., 2004). Selon une étude de Pelletier et al. menée auprès d’étudiantes universitaires, les femmes qui présentent une régulation autodéterminée à l’égard de leur alimentation sont plus susceptibles d’avoir des apports alimentaires concordants avec les recommandations du Guide alimentaire canadien, c’est-à-dire de consommer des légumes, des fruits et des produits céréaliers, d’avoir des apports modérés en lipides totaux, en acides gras saturés et en cholestérol, et de limiter leur consommation de croustilles, de chocolat, d’aliments frits et de sucre raffiné, et ce comparativement aux femmes présentant une régulation non autodéterminée (Pelletier et al., 2004). Par ailleurs, les auteurs rapportent que les femmes ayant une régulation autonome à l’égard de leur alimentation se soucient principalement de la qualité des aliments consommés alors que les femmes affichant plutôt une régulation contrôlée se préoccuperont davantage de la quantité de nourriture consommée. Leurs résultats montrent également que les femmes qui présentent une motivation autonome ont des comportements alimentaires plus sains et un bien-être psychologique accru (Pelletier et al., 2004). Au contraire, celles qui présentent une régulation contrôlée semblent avoir une alimentation moins saine, des comportements alimentaires plus dysfonctionnels (symptômes boulimiques) et sont plus susceptibles de présenter une détresse psychologique. Ces mêmes auteurs ont effectué une étude longitudinale visant à tester l’impact de la motivation autodéterminée sur l’amélioration des habitudes alimentaires auprès de personnes à risque de MCV (Pelletier et al., 2004). Leurs résultats indiquent que les personnes qui présentaient une motivation autodéterminée à l’égard de l’alimentation diminuaient davantage le pourcentage de calories consommées provenant des lipides totaux et des gras saturés, menant ainsi à des effets favorables sur la santé cardiovasculaire, plus spécifiquement à une diminution du poids corporel et une amélioration du profil lipidique, en réponse à une intervention menée sur une période de 26 semaines. Cette étude démontre 42 que les personnes ayant une régulation autodéterminée à l’égard de l’alimentation font preuve d’efforts plus soutenus afin d’obtenir des effets favorables sur leur santé à long terme. Une étude épidémiologique de Leong et al. réalisée auprès de femmes de la NouvelleZélande a testé l’effet médiateur potentiel des habitudes et comportements alimentaires dans la relation entre de la motivation autodéterminée et l’IMC (Leong et al., 2012). Leurs résultats ont d’abord permis de démontrer qu’une motivation autonome était associée positivement à des habitudes et comportements alimentaires sains (p.ex., consommation plus élevée de légumes et de fruits) et était associée négativement aux comportements alimentaires moins sains (p.ex., consommation plus faible de chocolat, biscuits, gâteaux, hamburgers et croustilles et risque plus faible d’hyperphagie boulimique). À l’inverse, la motivation contrôlée était associée négativement aux comportements alimentaires sains et était associée positivement à certains comportements alimentaires moins sains. Par ailleurs, la motivation autonome était associée à un IMC plus faible alors que la motivation contrôlée était associée à un IMC plus élevé. Les auteurs de cette étude ont finalement démontré que les habitudes et comportements alimentaires des femmes exerçaient un effet médiateur partiel dans la relation entre la motivation autonome et l’IMC de même que dans la relation entre la motivation contrôlée et l’IMC. De façon sommaire, ces études démontrent qu’un comportement régulé via la motivation autodéterminée spécifique à l’alimentation peut avoir un impact positif sur la santé, plus particulièrement en favorisant une alimentation saine (Verstuyf et al., 2012) et le maintien de ces habitudes alimentaires à long terme (Pelletier et al., 2004). 1.7.3.3 Différences entre les hommes et les femmes quant à la motivation autodéterminée Certaines différences ont été rapportées entre les hommes et les femmes en lien avec la régulation de la motivation autodéterminée. Des études menées dans divers domaines tels que la santé, les relations interpersonnelles et le milieu académique démontrent en général 43 un niveau de motivation autodéterminée plus élevé chez les femmes que chez les hommes (Vallerand & Bissonnette, 1992; Vallerand et al., 1997; Vallerand & O'Connor, 1989). Dans le domaine des comportements de santé, une récente étude ayant évalué la motivation autodéterminée d’hommes et de femmes à l’égard d’un poids santé, c’est-à-dire leurs raisons de viser l’atteinte d’un poids santé, rapporte des niveaux de motivation autodéterminée et de régulation introjectée plus élevés chez les femmes que chez les hommes (Hartmann et al., 2015). Les individus amotivés quant au fait de fournir des efforts pour tendre vers ou maintenir un poids santé étaient exclus de l’étude et principalement représentés par des hommes (67,3%). Les résultats de cette étude ont montré que la régulation autodéterminée prédisait l’amélioration de la qualité de l’alimentation un an plus tard à la fois chez les hommes (par une consommation plus faible de viande) et chez les femmes (par une consommation plus élevée de légumes). En ce qui a trait à la motivation spécifique au contexte alimentaire, les résultats d’une récente étude menée auprès de jeunes adultes suggèrent que la régulation du comportement alimentaire via une motivation autonome favorise un profil anthropométrique sain chez les femmes, mais non chez les hommes (Gropper et al., 2014). Plus spécifiquement, les résultats démontrent que les femmes présentant une motivation autodéterminée à l’égard de leur alimentation ont un IMC et un pourcentage de tissu adipeux plus faibles. Chez les hommes, seulement certaines formes de régulation contrôlée étaient associées au profil anthropométrique. Plus spécifiquement, la régulation introjectée et l’amotivation étaient respectivement associées à un IMC et à un pourcentage de tissu adipeux plus élevés chez les hommes. Bien que ces résultats suggèrent un patron d’associations distinct entre les variables motivationnelles spécifiques au contexte alimentaire et le profil anthropométrique selon le genre, ces différences demeurent peu discutées par les auteurs. En définitive, on constate qu’il y a actuellement peu de littérature portant sur la motivation autodéterminée spécifique au contexte de l’alimentation, et qu’une seule étude semble avoir considéré les hommes et les femmes distinctement. Par ailleurs, aucune étude n’a mis en 44 relation la motivation autodéterminée à l’égard de l’alimentation et la qualité de l’alimentation selon le genre. 1.8 Approche de l’entretien motivationnel L’entretien motivationnel constitue une approche permettant de mettre en application la théorie de l’autodétermination, par exemple dans le cadre d’une intervention nutritionnelle visant à changer les comportements alimentaires. 1.8.1 Définition et principes L’entretien motivationnel constitue une approche qui a été développée dans les années 1980 et qui se définit comme une méthode centrée sur le client, directive, et visant à potentialiser la motivation intrinsèque envers un changement en utilisant l’exploration et la résolution de l’ambivalence (Miller & Rollnick, 2002). En d’autres mots, cette approche vise à soutenir le client dans sa démarche afin qu’il exprime son ambivalence et parvienne à résoudre les conflits existant entre la volonté de conserver un statut quo (ses comportements actuels) et celle de changer (ses comportements souhaités), en explorant ses propres valeurs et ses perceptions (Rollnick & Miller, 1995). De plus, ce style d’intervention se veut directif puisqu’il a comme objectif de renforcer la motivation intrinsèque et l’engagement du client envers un changement de comportement, en le soutenant afin qu’il soit en mesure de prendre lui-même ses décisions face au changement envisagé (Rollnick & Miller, 1995). Cette approche soutient que l’ambivalence est naturelle devant toute perspective de changement et peut engendrer un certain niveau de résistance (Miller & Rollnick, 2002). En ce sens, l’entretien motivationnel vise à diminuer cette résistance en évoquant le discours au changement, c’est-à-dire en amenant le client à affirmer les avantages qu’il perçoit en faveur du changement. Les principales composantes sous-jacentes à cette approche sont la collaboration, l’évocation et l’autonomie (Miller & Rollnick, 2002). La collaboration réfère à l’interaction entre l’intervenant et le client favorable au développement d’un partenariat 45 qui reconnaît l’expertise et les points de vue du client. L’intervenant crée une atmosphère propice au changement, plutôt que coercitive (Moyers et al., 2005). L’évocation s’appuie sur l’idée que le client possède en lui les ressources et la motivation nécessaires à la résolution de l’ambivalence face au changement. La motivation intrinsèque est renforcée en faisant appel aux perceptions, aux objectifs et aux valeurs personnelles du client plutôt qu’en formulant des conseils rigides susceptibles d’augmenter la résistance face au changement (Miller & Rollnick, 2002; Rollnick & Miller, 1995). L’autonomie réfère pour sa part au soutien offert par l’intervenant au client dans son droit et sa capacité d’autodirection à prendre une décision éclairée (Miller & Rollnick, 2002; Rollnick & Miller, 1995). L’approche de l’entretien motivationnel propose quatre principes généraux référant aux attitudes de l’intervenant au cours d’une rencontre, ceux-ci étant 1) d’exprimer de l’empathie, 2) de faire ressortir les incohérences entre le comportement actuel et les buts ou les valeurs du client, 3) de gérer les résistances tout en évitant l’argumentation et 4) d’encourager le sentiment d’efficacité personnelle (Miller & Rollnick, 2002). Initialement, les auteurs Miller et Rollnick divisaient cette approche en deux phases (Miller & Rollnick, 2002). La première phase consiste à résoudre l’ambivalence et à bâtir la motivation intrinsèque au changement (Miller & Rollnick, 2002). À cette étape, une attention particulière est accordée à l’importance du changement pour le client et à la confiance que celui-ci éprouve quant à ses capacités de changer. La seconde phase vise principalement à renforcer l’engagement au changement ainsi qu’à aider le client à développer et implanter un plan d’action relatif au changement (Arkowitz et al., 2008). Diverses stratégies permettent l’application des principes généraux liés à cette approche, soit 1) de poser des questions ouvertes afin de faire émerger les préoccupations du client, 2) l’écoute réflective, où l’on renvoie au client une image de ses propos, ce qui permet d’aider une personne à verbaliser ce qu’elle veut dire et à transmettre ce qu’elle ressent de manière plus explicite, 3) le résumé, où l’on récapitule de façon succincte les propos que le client a communiqués, ce qui permet à l’intervenant de renchérir sur les éléments motivationnels, puis 4) la valorisation, où l’intervenant exprime au client la confiance qu’il a en lui et en sa capacité de changer (Miller & Rollnick, 2002). Ces stratégies sont présentes au cours des 46 deux phases décrites précédemment, mais dans des proportions différentes selon les objectifs visés (Miller & Rollnick, 2002). Récemment, certains aspects de l’approche de l’entretien motivationnel ont été raffinés (Miller & Rollnick, 2013). Parmi les changements apportés, on constate que l’approche est désormais présentée en quatre phases motivationnelles, plutôt que deux, qui se superposent dans le temps. Ces phases sont respectivement l’engagement dans la relation, la focalisation, l’évocation et la planification. Dans le cadre de cette thèse, il semblait toutefois plus pertinent de s’attarder aux principes d’origine, sur lesquels reposent la majorité des travaux présentés dans la littérature actuellement et sur lesquels a été développé notre projet de recherche. Il est à noter que malgré ces changements, la vision de l’approche reste essentiellement la même. 1.8.2 Complémentarité entre la théorie de l’autodétermination et l’entretien motivationnel Certains auteurs ont invoqué la TAD comme un cadre théorique permettant d’expliquer les processus et l’efficacité de l’entretien motivationnel (Markland et al., 2005). En effet, la TAD se définit comme une théorie portant sur la motivation humaine et reconnue comme une approche descendante (top-down) liée au changement de comportement, c’est-à-dire que les hypothèses formulées découlent d’une théorie (Vansteenkiste et al., 2012). Plus spécifiquement, une telle approche permet de comprendre les mécanismes sous-jacents aux interventions basées sur cette théorie et favorables au succès. Par contre, la principale limite s’avère de parvenir à traduire les concepts théoriques liés à la motivation autodéterminée en des méthodes d’intervention clinique. Pour sa part, l’entretien motivationnel constitue plutôt une approche clinique liée au changement de comportement et regroupant diverses techniques d’intervention. L’entretien motivationnel est considéré par certains auteurs comme une approche ascendante (bottom-up), c’est-à-dire qui est en grande partie sans fondement théorique et plutôt basée sur l’intuition et des observations cliniques dans divers contextes de vie (Vansteenkiste et al., 2012). 47 Au-delà de cette distinction, des similitudes sont notées entre les concepts de la TAD et ceux de l’entretien motivationnel (Markland et al., 2005; Vansteenkiste & Sheldon, 2006). D’abord, les deux modèles se basent sur la même hypothèse, soit celle selon laquelle les êtres humains sont naturellement orientés vers la croissance, la santé et le bien-être (Markland et al., 2005). Les deux modèles sont explicitement centrés sur l’individu et orientés sur le processus impliqué dans le changement de comportement plutôt que sur les conséquences qui en découlent (Markland et al., 2005). La TAD soutient que l’engagement personnel profond ainsi qu’un climat d’intervention favorisant la satisfaction des besoins d’autonomie, de compétence et du sentiment d’attachement s’avèrent des conditions nécessaires au succès des interventions comportementales en santé, et plus particulièrement au maintien des changements à long terme (Teixeira et al., 2012). En ce sens, l’environnement social proposé par l’entretien motivationnel concorde avec la satisfaction de ces trois besoins, soit par une structure encadrant le changement, le soutien à l’autonomie et l’implication de l’intervenant (Figure 5). De plus, les deux modèles possèdent comme concept central la motivation, et visent plus particulièrement à promouvoir la motivation intrinsèque envers un comportement (Deci & Ryan, 2012; Resnicow & McMaster, 2012). Enfin, dans un contexte de pratique clinique, la TAD et l’entretien motivationnel encouragent l’intervenant à démontrer de l’empathie, à poser un regard inconditionnel et à explorer l’ambivalence du client face au changement, et ce sans porter de jugement et sans exercer de pression (Markland et al., 2005). 48 )LJXUH 6LPLOLWXGHV HQWUH OHV SULQFLSHV GH OD WKpRULH GH O DXWRGpWHUPLQDWLRQ HW GH O HQWUHWLHQPRWLYDWLRQQHO7LUpHGXOLYUH/HVFRPSRUWHPHQWVGDQVOHGRPDLQHGH ODVDQWp*RGLQ -XVTX¶jSUpVHQWSOXVLHXUVpWXGHVRQWWHVWpFHUWDLQVFRQVWUXLWVGHOD 7$'GDQVXQFRQWH[WH G¶LQWHUYHQWLRQ YLVDQW XQ FKDQJHPHQW GH FRPSRUWHPHQW GH VDQWp HQ D\DQW UHFRXUV j O¶DSSURFKH GH O¶HQWUHWLHQ PRWLYDWLRQQHO HW DSSXLHQW OD FRPSOpPHQWDULWp GH FHV GHX[ PRGqOHV )RUWLHU HW DO E 6LOYD HW DO :LOOLDPV HW DO /HV SURFKDLQHV VHFWLRQV SUpVHQWHURQW SOXV VSpFLILTXHPHQW O¶HIILFDFLWp GH O¶DSSURFKH GH O¶HQWUHWLHQ PRWLYDWLRQQHOHQOLHQDYHFOHVFKDQJHPHQWVGHFRPSRUWHPHQWGHVDQWp /¶HIILFDFLWpGHO¶HQWUHWLHQPRWLYDWLRQQHOSRXUDPpOLRUHUOHVFRPSRUWHPHQWVOLpV jODVDQWp /HV GRQQpHV GH OD OLWWpUDWXUH SHUPHWWHQW GH GpPRQWUHU O¶DSSOLFDELOLWp GH O¶HQWUHWLHQ PRWLYDWLRQQHO j XQ ODUJH pYHQWDLO GH FRPSRUWHPHQWV GH VDQWp 5HVQLFRZ HW DO /¶HIILFDFLWp GH FHWWH DSSURFKH D QRWDPPHQW pWp UDSSRUWpH GDQV OH FRQWH[WH GH FRPSRUWHPHQWV PDODGDSWpV SH[ SUREOqPH G¶DOFRROLVPH GH MHX[ FRPSRUWHPHQWV j ULVTXH UHOLpV DX VLGD 0LOOHU 5RVH GH SURPRWLRQ GH OD VDQWp SH[ DFWLYLWp physique, alimentation, observance à la médication) (Martins & McNeil, 2009; Miller & Rose, 2009) ainsi que de la régulation du poids corporel (Barnes & Ivezaj, 2015). Selon un récent article de revue, l’entretien motivationnel est de façon générale efficace pour initier et maintenir un changement de comportement (Rubak et al., 2005). La littérature suggère qu’une intervention basée sur l’entretien motivationnel est plus susceptible de mener à des effets favorables en comparaison à une intervention traditionnelle ou à un groupe recevant uniquement de l’information (Lundahl et al., 2013; Rubak et al., 2005). Par ailleurs, en plus de constituer un style d’intervention applicable dans plusieurs domaines de la santé, l’efficacité de l’entretien motivationnel a été validée auprès de divers intervenants et d’individus présentant des caractéristiques variables en termes d’âge, de sexe et d’origine ethnique (Lundahl et al., 2013). L’article de revue de Rubak et al. indique que l’entretien motivationnel peut s’avérer efficace suite à une rencontre d’une durée de 15 minutes et que plus le nombre de rencontres augmente, plus l’effet tend à être important (Rubak et al., 2005). Dans le cadre d’études comprenant deux rencontres motivationnelles d’un minimum de 60 minutes, 81% ont démontré un effet favorable (Burke et al., 2003; Rubak et al., 2005). Certains travaux précisent que le nombre de rencontres n’est pas associé aux effets observés, mais que le temps total alloué à l’entretien motivationnel lors d’une rencontre semble influencer les résultats, avec des effets favorables plus importants observés lors d’une rencontre prolongée (Lundahl et al., 2013). De plus, l’impact positif de cette approche semble se prolonger plus d’un an suivant une intervention (Lundahl et al., 2013). Les limites actuelles des études s’expliquent par le peu d’information fournie en lien avec les interventions prodiguées et par le fait que le degré de fidélité de l’approche est rarement rapporté, rendant ainsi l’interprétation des données plus difficile. Davantage d’études devront évaluer les aspects plus techniques reliés à l’entretien motivationnel, c’est-à-dire la durée et le nombre de rencontres optimaux afin de favoriser les changements de comportement. En dépit de cela, aucune étude ne rapporte d’effets négatifs à l’égard de cette approche (Rubak et al., 2005). 50 1.8.4 L’efficacité de l’entretien motivationnel pour améliorer les changements alimentaires Plusieurs études ont évalué l’impact de l’entretien motivationnel dans le contexte de changements liés aux habitudes alimentaires et à l’activité physique, ceux-ci étant souvent combinés ensemble (Martins & McNeil, 2009). Globalement, les résultats indiquent que cette approche s’avère favorable aux changements reliés à l’alimentation et à l’activité physique, qu’elle soit utilisée seule ou en complément d’une autre intervention (Martins & McNeil, 2009). Plus spécifiquement, des évidences démontrent que les personnes ayant reçu une approche basée sur les principes de l’entretien motivationnel améliorent leur sentiment d’efficacité personnelle à l’égard de leur alimentation et de l’activité physique (Bennett et al., 2008; Resnicow et al., 2004), augmentent la pratique d’activité physique (Bennett et al., 2007; Carels et al., 2007; Harland et al., 1999), diminuent leur apport énergétique (Befort et al., 2008), et augmentent leur consommation de fruits et légumes (Ahluwalia et al., 2007; Befort et al., 2008; Elliot et al., 2007; Hardcastle et al., 2008). De plus, certaines études visant des changements dans les habitudes de vie, dont les habitudes alimentaires, rapportent une diminution de l’IMC en réponse à une intervention basée sur l’entretien motivationnel (Hardcastle et al., 2008; Schwartz et al., 2007). Les résultats rapportés dans un récent article de revue amènent un peu de controverse quant aux effets potentiels de l’entretien motivationnel dans le contexte de changements alimentaires (Lundahl et al., 2013). En effet, Lundahl et al. indiquent que cette approche ne semble pas présenter d’avantages évidents dans le domaine de la saine alimentation (Lundahl et al., 2013). Les auteurs mentionnent toutefois baser leurs conclusions sur seulement six études, incluant deux études dans lesquelles l’approche motivationnelle n’était pas utilisée lors de rencontres en personne, mais plutôt via internet ou le téléphone (Lundahl et al., 2013). Il semble donc que des études supplémentaires seront nécessaires afin de clarifier les meilleures stratégies à adopter pour assurer le succès d’interventions en nutrition basées sur cette approche. En définitive, en tenant compte de l’ensemble des connaissances actuelles, l’entretien motivationnel s’avère un style d’intervention prometteur dans le contexte de changements 51 alimentaires, pouvant facilement être intégré à d’autres approches efficaces éprouvées, et ce, plus particulièrement lorsque l’ambivalence et la motivation semblent constituer des obstacles au changement (Miller & Rose, 2009). 52 CHAPITRE 2 : Problématique 53 Les bienfaits de l’alimentation méditerranéenne sur la santé, et plus particulièrement sur la santé cardiovasculaire, sont clairement démontrés dans la littérature (Sofi et al., 2014). D’autre part, différents travaux soutiennent la faisabilité d’adopter les principes de l’alimentation méditerranéenne au sein de populations non méditerranéennes dans le but d’améliorer la santé (Bemelmans et al., 2000; Logan et al., 2010). Plus spécifiquement au Québec, des données appuient la faisabilité d’adhérer à l’alimentation méditerranéenne chez les femmes (Goulet et al., 2003; Goulet et al., 2007), mais aucune étude ne permet actuellement de dresser le portrait chez les hommes. Enfin, dans le but de développer une intervention nutritionnelle adaptée aux individus et favorable aux changements alimentaires à long terme, il semble pertinent d’avoir recours à une approche motivationnelle soutenant l’autonomie, la compétence et le sentiment d’attachement des individus (Pelletier et al., 2004; Williams et al., 2002b). Devant ces constats, il s’avérait important de confirmer si les hommes et les femmes retirent les mêmes bienfaits de l’alimentation méditerranéenne en réponse à une intervention nutritionnelle dans le contexte québécois. Également, il était pertinent de déterminer de quelle façon la motivation autodéterminée spécifique à l’alimentation est associée au niveau d’adhésion à l’alimentation méditerranéenne selon le genre. Par conséquent, l’objectif général des travaux de cette thèse était de déterminer les différences entre les hommes et les femmes dans leur réponse à un programme d’éducation en nutrition de 12 semaines visant l’adoption d’une alimentation de type méditerranéen et basé sur la théorie de l’autodétermination, plus spécifiquement en termes de changements dans les apports alimentaires, variables anthropométriques et métaboliques et de la qualité de vie. Afin d’atteindre cet objectif, plusieurs objectifs spécifiques ont été définis et poursuivis dont les résultats sont présentés dans les articles scientifiques aux chapitres 3 à 7 de cette thèse. 55 Le premier objectif spécifique des présents travaux visait à caractériser et comparer les besoins psychologiques fondamentaux et les facteurs de motivation des hommes et des femmes avant le début de l’intervention visant l’adoption de l’alimentation méditerranéenne. Des études ont démontré que les femmes sont plus susceptibles de se mettre en action afin d’améliorer leurs habitudes alimentaires, rapportent de meilleures connaissances en nutrition et affirment lire davantage les étiquettes nutritionnelles comparativement aux hommes (Baker & Wardle, 2003; Krukowski et al., 2006). Ces observations suggèrent que les femmes sont plus prédisposées à s’engager dans de saines habitudes alimentaires comparativement aux hommes, ce qui a amené à émettre l’hypothèse que les femmes démontrent un niveau de motivation autodéterminée plus élevé avant le début de l’intervention. Le deuxième objectif spécifique était de déterminer les différences entre les hommes et les femmes quant aux changements alimentaires, en réponse au programme d’éducation en nutrition de 12 semaines visant l’adoption d’une alimentation de type méditerranéen (court terme), ainsi qu’à six mois suivant la fin de l’intervention nutritionnelle (long terme). En supposant que les femmes allaient avoir une alimentation de meilleure qualité que les hommes avant le début de l’intervention, nous avons émis l’hypothèse que les hommes amélioreraient davantage leurs habitudes alimentaires que les femmes en réponse à l’intervention nutritionnelle. 56 Le troisième objectif spécifique était de déterminer les changements dans les facteurs de motivation en réponse à l’intervention nutritionnelle de 12 semaines et à long terme, ainsi que leur association avec les changements dans l’adhésion à l’alimentation méditerranéenne chez les hommes et les femmes distinctement. Considérant qu’un comportement régulé via la motivation autodéterminée semble favorable à l’adoption de saines habitudes alimentaires (Pelletier et al., 2004), nos hypothèses étaient 1) que les hommes augmenteraient davantage leur motivation autodéterminée en comparaison avec les femmes, et 2) qu’une amélioration de la motivation autodéterminée serait associée à une meilleure adhésion à l’alimentation méditerranéenne, à la fois chez les hommes et chez les femmes. Le quatrième objectif spécifique était de déterminer les différences entre les hommes et les femmes quant aux changements anthropométriques, métaboliques et de qualité de vie, en réponse à l’intervention nutritionnelle de 12 semaines et six mois suivant la fin de l’intervention. En tenant compte de l’hypothèse formulée à l’objectif 2, nous avons émis l’hypothèse que les hommes bénéficient davantage d’un programme d’éducation en nutrition visant l’adoption de l’alimentation méditerranéenne, via une amélioration plus importante de leur profil métabolique et de leur niveau de qualité de vie. 57 CHAPITRE 3 : Différences relatives au genre dans les apports alimentaires : quelle est la contribution des variables motivationnelles? Vicky Leblanc, Catherine Bégin, Louise Corneau, Sylvie Dodin, Simone Lemieux Journal of Human Nutrition and Dietetics, 2015, Feb;28(1) :37-46. 59 Gender differences in dietary intakes: What is the contribution of motivational variables? Vicky Leblanc1, Catherine Bégin2, Louise Corneau1, Sylvie Dodin1,3, and Simone Lemieux1. 1 Institute of Nutrition and Functional Foods, Laval University, 2440 Hochelaga Blvd, Québec, Canada, G1V 0A6 2 School of Psychology, Laval University, Pavillon Félix-Antoine Savard, 2325 rue des Bibliothèques, Québec, Canada, G1V 0A6 3 Department of Obstetric and Gynaecology, Laval University, Pavillon Ferdinand-Vandry, 1050 Medicine Avenue, Québec, Canada, G1V 0A6 Address of correspondence: Simone Lemieux, Ph.D, RD. Institute of Nutrition and Functional Foods 2440 Hochelaga Blvd Laval University, Québec Québec, Canada, G1V 0A6 Phone: (418) 656-2131 ext.: 3637 Fax: (418) 656-5877 E-mail: [email protected] (can be published) Keywords : Self-Determination Theory, gender differences, basic psychological needs, eating behaviors, energy density, body mass index. Abbreviations: SDT, Self-Determination Theory; FSH, Follicle-stimulating hormone; C, Cholesterol; SDI, Self-determination index; FFQ, Food frequency questionnaire; TFEQ, Three-Factor Eating Questionnaire; BMI, Body mass index. 61 RÉSUMÉ Cette étude visait à identifier les différences de genre dans les apports et comportements alimentaires ainsi que pour les variables motivationnelles, puis à déterminer les associations entre ces variables auprès d’hommes et de femmes préménopausées à risque de maladies cardiovasculaires. L’échelle de régulation du comportement alimentaire a permis d’évaluer la motivation autodéterminée spécifique au contexte alimentaire. Les apports alimentaires ont été mesurés à partir d’un questionnaire de fréquence et le Three-Factor Eating Questionnaire a permis d’évaluer les comportements alimentaires. Les hommes présentaient des valeurs plus élevées pour l’apport énergétique, la densité énergétique, le pourcentage de lipides et des valeurs plus faibles pour le pourcentage de glucides, comparativement aux femmes. Des niveaux plus faibles de susceptibilité émotionnelle à la désinhibition étaient observés chez les hommes. Les femmes présentaient une motivation autodéterminée plus élevée que les hommes. Une association inverse entre la motivation autodéterminée et la densité énergétique était observée chez les femmes seulement. Ces résultats suggèrent que les différences entre les hommes et les femmes dans les apports alimentaires pourraient s’expliquer par des associations distinctes entre la motivation autodéterminée et les variables alimentaires selon le genre. 63 ABSTRACT Differences between men and women in dietary intakes and eating behaviors have been reported and could be explained by gender differences in motivational variables associated with the regulation of food intake. Our main objectives were to identify gender differences in dietary intakes, eating behaviors and motivational variables and to determine how motivational variables were associated with dietary intakes and eating behaviors in men and women. Sixty-four men and 59 premenopausal women were included in the study and presented cardiovascular risk factors. The regulation of eating behaviors scale was completed to assess motivational variables. A validated food frequency questionnaire was administered to evaluate dietary intakes and subjects completed the Three-Factor Eating questionnaire to assess eating behaviors. Men had higher energy intake, energy density and percentage of energy from lipids and lower percentage of energy from carbohydrates than women (P 0.04). Men also had a lower emotional susceptibility to disinhibition than women (P = 0.0001). Women reported a higher score for eating related self-determined motivation (i.e. eating related SDI) than men (P = 0.002). The most notable gender difference in the pattern of associations was that eating related SDI was negatively associated with energy density (r = -0.30; P = 0.02), only in women. Women had a better dietary profile and higher eating related SDI than men. However, gender differences in dietary variables might be explained by a potential gender specific pattern of association of eating related SDI with dietary intakes and eating behaviors. 65 INTRODUCTION Gender differences have been reported for dietary intakes and eating behaviors (1) . More specifically, previous studies reported that women have higher fruit and vegetables consumption and tend to have greater interest in healthy diets and desire to eat food lower in calories than men (2, 3) . Gender differences in eating behaviors have also been reported, women generally showing higher dietary restraint and disinhibition levels than men (4) . It has been shown that disinhibition is positively associated with energy intake (5) and energy density (6) whereas dietary restraint is generally negatively associated with energy intake and dietary fat intakes (5, 7). Motivation to adopt healthy eating is recognized as a potential factor involved in the regulation of dietary intakes and eating behaviors (8) . Accordingly, the Self-Determination Theory (SDT) (9, 10) emphasizes the importance of motivation quality and proposes that the regulation of a behavior may take many forms that correspond to different behavioral regulatory styles according to motivation, which differ by their self-determination level. Another key postulate from the SDT addresses the processes that facilitate internalization of nonself-determined regulatory styles towards more self-determined regulatory styles (9, 10) . Moreover, the SDT has identified three basic psychological needs which are autonomy, competence, and relatedness that foster the process of internalization and development of optimal motivation and personal well-being (10) . With regard to the regulation of eating behaviors, Pelletier et al. (2004) showed that global self-determined motivation in life predisposes individuals to adopt a more self-determined orientation in the regulation of eating behaviors. Studies also showed that behaviors regulated by self-determined motivation promote adoption of healthy eating behaviors and long-term maintenance of healthy eating habits (11, 12) , and could also be a protective factor against social pressures unfavourable to healthy eating behaviors (11, 13) . However, literature about the potential influence of motivation on eating behaviors is scarce. In addition, according to the SDT, the same behavior can be regulated differently between individuals (14) , which suggests that it might not fulfill the same role in men and in women. Although gender differences related 67 to motivational factors have not been specifically investigated in a dietary context, literature suggests that women generally display a more self-determined motivational profile compared to men in a diversity of life domains, such as sports, leisure, interpersonal relationships and education (15). To our knowledge no study has yet investigated the contribution of motivational variables in explaining gender differences in dietary intakes and eating behaviors. In addition, the pattern of associations relating motivational variables to dietary intakes and eating behaviors according to gender has never been documented. Moreover, while the adoption of healthy eating habits is encouraged in the prevention of chronic diseases (16) , dietary changes remain difficult to achieve for many individuals. In order to favour adherence to healthy eating habits in men and women, we first need to get a better understanding of its underlying factors using a gender specific approach. According to the literature, motivation related to the regulation of food intake and eating behaviors is clearly one of these underlying factors. In a context of intervention, it would thus be beneficial to identify motivational factors influencing healthy eating according to gender, to promote optimal support in dietary changes. The main objective of our study was therefore to identify gender differences in dietary intakes, eating behaviors and motivational variables and to verify whether some gender differences in motivational variables could explain differences observed between men and women in dietary intakes and eating behaviors. We also wanted to determine how motivational variables were associated with dietary intakes and eating behaviors in men and women, separately. METHODOLOGY Participants This study was conducted among a sample of 64 men and 59 premenopausal women aged between 25 and 50 years old and presenting cardiovascular risk factors. Data presented in 68 this article correspond to baseline values from a nutritional intervention study aiming at assessing changes in dietary variables in men and women in response to a nutritional intervention promoting the Mediterranean diet (MedDiet). This latter study is a part of a broader research project in which our research team was interested to document differences between men and women in response to the MedDiet both in a controlled setting (i.e. all meals adjusted to energy needs were provided to subjects for four weeks) and also in a more real life intervention context (nutrition education program). When designing the study we decided to focus on premenopausal women and to compare them to men in the same age range because we wanted to maximize the potential impact of sex-related hormones on metabolic changes observed in response to the MedDiet (17) . Therefore, in order to be able to compare results obtained in a controlled setting to those obtained in the more real life context we have used the same inclusion criteria. In women, a follicle-stimulating hormone (FSH) measurement was performed if needed (e.g., when women presented periods irregularities) to confirm the premenopausal status (FSH < 20 IU/l) (18). Men and women included in the study had to present slightly elevated LDL-Cholesterol (C) concentrations (between 3.0 and 4.9 mmol/L) (19) or a total-C to HDLC ratio ≥ 5.0, and at least one of the four following criteria of the metabolic syndrome (16) : 1) triglyceride concentrations ≥ 1.7 mmol/L; 2) fasting glycaemia between 6.1 et 6.9 mmol/L; 3) blood pressure concentrations ≥ 130/85 mm Hg; 4) waist circumference ≥ 80 cm in women and ≥ 94 cm in men (20). Participants also had to have a stable body weight ( 2.5 kg) for a minimum of three months prior to the beginning of the study and to be involved in food purchases and/or meal preparation at home. We excluded men and women who had cardiovascular events and who used medication that could affect dependent variables under study. Smokers, participants with an alcoholism history, pregnant women and participants with a high Mediterranean score (Medscore > 29, concordant with a typical Mediterranean food pattern) (21) were also excluded. Briefly, the Medscore (range between 0-44 points) was calculated based on the 11 components of the Mediterranean pyramid, i.e. grains; fruits; vegetables; legumes, nuts and seeds; olive oil; dairy products; fish; poultry; eggs; sweets and red meat/processed meat, and allowed to assess the level of adherence to the Mediterranean food pattern, i.e. healthy dietary intakes. A high score for food groups 69 found at the bottom of the pyramid (e.g., legumes) reflects a high consumption whereas a high score for food groups found at the top of the pyramid (e.g., red meat) reflects a low consumption, as previously described (21) . In addition, men included in the study were matched to women for LDL-C concentrations and age. All participants voluntarily agreed to participate in the research project and were recruited through different media advertisements in the Québec City Metropolitan area. This study was approved by the Laval University Research Ethics Committee. Written informed consent was obtained from all men and women prior to their participation in the study. Measurements Motivational variables Basic psychological needs scale (22) is a 21-item questionnaire that assesses three basic psychological needs, i.e. autonomy (7 items), competence (6 items) and relatedness (8 items), which are determinants of motivation according to Self-Determination Theory (SDT) and mediate the impact of social factors on individual’s level of self-determined motivation. More specifically, autonomy reflects a desire to engage in activities and to be the origin of one’s own behavior; competence is defined as the need to interact effectively with one’s environment to produce desired outcomes while preventing undesired events; relatedness is defined as the need to feel connected to and accepted by significant others in a social milieu (22) . Each item was measured on a 7-point Likert scale, which allowed calculating three subscale scores corresponding to the satisfaction of each of the three needs. The Global motivation scale (GMS-28) (15, 23) is a questionnaire that assesses fundamental motivation in life and displays high level of reliability and validity among the adult population (15) . This scale includes 28 items and assesses intrinsic motivation (12 items) (which refers to engaging in an activity for its own sake and experience of pleasure and satisfaction derived from participation), identified regulation (4 items) (i.e. refers to 70 behaviors that are performed by choice because the individual judges them as important), introjected regulation (4 items) (i.e. refers to behaviors that are in part internalized by the person) and external regulation (4 items) (i.e. refers to behaviors that are not selfdetermined because they are regulated through external means such as rewards and constraints), and amotivation (4 items) (i.e. pertains to the lack of intentionality and therefore refers to the relative absence of motivation (neither intrinsic or extrinsic)). Each item was measured on a 7-point Likert scale, which allowed calculation of the global selfdetermination index (SDI). The Regulation of eating behaviors scale (11) is a 24-item validated questionnaire that assesses self-determined motivation for the regulation of eating behaviors. Items included in this questionnaire (4 items per self-determined regulatory styles) assess intrinsic motivation (e.g., “I like to find new ways to create meals that are good for my health”), different self-determined regulatory styles which are integrated (e.g., “Eating healthy is an integral part of my life”), identified (e.g., “I believe it will eventually allow me to feel better”), introjected (e.g., “I feel I must absolutely be thin”) and external (e.g., “Other people close to me insist that I do”), and amotivation (e.g., “I don’t know why I bother”) (10) . Each item was measured on a 7-point Likert scale, which allowed calculation of the eating related SDI (15), specific to eating regulation. Dietary Variables A validated food frequency questionnaire (FFQ) (24) was administered to participants. The FFQ is based on typical foods available in Québec, contains 91 items and 33 subquestions and was administered by a registered dietitian. Participants were questioned about the frequency of intake for different foods and drinks during the last month and could report the frequency of these intakes in terms of day, week or month. Macronutrient and micronutrient intakes obtained from the FFQ were evaluated using the Nutrition Data System for Research (NDS-R, version 4.03_31) software. 71 Eating Behaviors and Meal Preparation Frequency Eating behaviors were assessed by the Three-Factor Eating questionnaire (TFEQ) (25), a 51item validated questionnaire which assesses three factors that refer to cognitions and behaviors associated with eating: dietary restraint (21 items) (conscious control of food intake with concerns about shape and weight), disinhibition (16 items) (overconsumption of food in response to a variety of stimuli associated with a loss of control on food intake) and hunger (14 items) (food intake in response to feelings and perceptions of hunger). More specific subscales are also derived from these three general eating behaviors (26, 27) : rigid restraint, flexible restraint, habitual susceptibility to disinhibition, emotional susceptibility to disinhibition, situational susceptibility to disinhibition, internal hunger, and external hunger (see Table 2). As for involvement in meal preparation, referring to active involvement in meal organization and preparation, participants had to complete a questionnaire where the following question was asked: “ Considering that there are 14 meals in a week (taking into account lunch and dinner only), how many times per week are you involved in meal preparation?” Participants had to choose among categories defined as follow: Never, 1-3 time(s)/week, 4-6 times/week, 7-9 times/week, 10-12 times/week and 13-14 times/week, which allowed to assess weekly frequency in meal preparation. Anthropometric and Metabolic Profile All anthropometric and metabolic variables were measured in the fasting state. According to standardized procedures (28) height was measured to the nearest millimeter with a stadiometer (Seca 222 Mechanical Telescopic Stadiometer), body weight was measured to the nearest 0.1 kg on a calibrated balance (BWB-800S Digital scale, Tanita), and body mass index (BMI) was then calculated. Waist circumference measure was also taken to the nearest millimeter according to standardized procedures (28) . Percentage of body fat was estimated using the Tanita body-fat analyser (Tanita-BC-418 body-fat analyser, Tanita Corp., Tokyo, Japan). Basic lipid profile and glucose and insulin levels were measured with a blood sample taken after a 12-hour overnight fast. 72 Statistical Analyses Student’s t-test allowed comparisons of characteristics related to motivational variables, dietary intakes, eating behaviors, and anthropometric and metabolic profile, whereas the Fisher’s Exact test was performed to compare weekly frequency of meal preparation (categorical data) between men and women. The Fisher’s Exact test was also performed to compare weekly frequency of meal preparation between men and women individually matched for their level of eating related SDI (largest difference within pair set at 3 units of SDI). For variables not normally distributed, a transformation was performed. However, these variables are presented as raw data in the tables. Pearson correlation analyses were performed to examine the association between global SDI and eating related SDI, and also in order to examine how eating related SDI was associated with dietary intakes and eating behaviors. A covariance analysis (Lsmean procedure) was performed in order to determine if gender differences in dietary intakes were still significant when accounting for eating related SDI. The probability level for significance used for the interpretation of all statistical analyses was set at a level of P ≤ 0.05. All analyses were performed using SAS statistical software (version 9.2, SAS Institute Inc., Cary, NC). RESULTS Table 1 shows characteristics of men and women in terms of their age, anthropometric variables and metabolic profile. Men and women included in our study were about the same age and had similar levels of total-C, LDL-C, fasting glucose and fasting insulin, but men had higher BMI, waist circumference, total-C to HDL-C ratio and triglyceride levels than women, whereas women had higher percentage of body fat and HDL-C levels than men. Table 2 presents dietary intakes and eating behaviors in men and women. Men had higher energy intake, energy density and percentage of energy provided by lipids while they had lower percentage of energy provided by carbohydrates than women. In addition, 43.8%, 73 28.1% and 100% of men and 57.6%, 42.4% and 100% of women had respectively lipid, carbohydrate and protein intakes within acceptable macronutrient distribution range. According to meal preparation, men had a lower weekly frequency of meal preparation than women (P 0.0001), with 4.7% versus 22.0% of men and women respectively, reporting a frequency of meal preparation between 13-14 times a week. As for eating behaviors measured with the TFEQ, the only significant gender difference observed was a lower score for emotional susceptibility to disinhibition in men than in women. Table 3 shows basic psychological needs and motivational profile in men and women. No gender differences were observed for basic psychological needs for autonomy, competence and relatedness, and for the global SDI and its respective subscales. As for the regulation of eating behaviors scale represented by the eating related SDI, men reported a significantly lower score in eating related SDI than women. More specifically, intrinsic motivation and integrated regulation were lower in men than in women. Pearson’s correlation analyses were conducted to determine if there were significant associations between the global and the eating related SDI, in men and women. A significant and positive association between the global and the eating related SDI was observed in men (r = 0.50; P 0.0001) as well as in women (r = 0.53; P 0.0001). Analyses were also performed to verify whether some gender differences in eating related SDI could explain differences observed between men and women in dietary intakes. Accordingly, gender differences in energy density and percentage of energy provided by carbohydrates remained significant after statistical adjustment for eating related SDI (Lsmean P 0.02). However, gender difference in the percentage of energy provided by lipids was no longer significant (Lsmean = 0.08) after adjustment for eating related SDI. In order to verify whether gender differences in eating related SDI could explain the difference observed between men and women as regard to weekly frequency of meal preparation, we individually matched men and women with similar eating related SDI. After this procedure it was found that mean eating related SDI levels were respectively 23.12 6.26 in men and 23.11 6.28 in women (t-test, P = 0.99). Then with a total of 42 pairs formed, results showed that a significant gender difference remained for weekly frequency of meal preparation, with men presenting lower weekly frequency of meal preparation than women (Fisher’s Exact test, P = 0.003). 74 Correlation analyses were conducted to determine how eating related self-determined motivation was associated with dietary intakes and eating behaviors, in men and women. Table 4 shows that except for the significant and negative association between eating related SDI and energy density in women, no other dietary variables were associated with eating related SDI among men and women. However, for eating behaviors among men, eating related SDI was significantly and positively associated with flexible restraint, but negatively associated with emotional susceptibility to disinhibition and hunger, more specifically with internal hunger. It was also found that eating related SDI was negatively associated with percentage of body fat. In women, eating related SDI was significantly and negatively associated with disinhibition, more precisely with situational susceptibility to disinhibition. A trend for negative associations between eating related SDI and emotional susceptibility to disinhibition were also observed in women. Moreover, eating related SDI was also negatively associated with BMI, percentage of body fat and waist circumference in women. DISCUSSION Our results suggest that women reported a healthier dietary profile, namely lower energy density, and also had globally a healthier metabolic profile than men. Previous studies support our results by showing that women tend to have better overall diet quality than men (29, 30) . Furthermore, studies showed that dietary intakes of low energy density are associated with a better quality of dietary intakes and a lower BMI (31, 32) and evidence of the beneficial influence of healthy eating habits on health status are well established in the literature (33, 34). This brings support to the observation that the lower energy density in the diet of women was accompanied by a lower BMI and by a healthier lipid profile than what was found in men. As for eating behaviors, the only gender difference was for emotional susceptibility to disinhibition with women having higher level than men. A similar difference was previously shown in other studies (35, 36). 75 According to motivational profile, men and women reported similar basic psychological needs satisfaction and similar level of global self-determined motivation. In addition, our results suggest that for both genders, a higher level of global self-determined motivation in life domains is associated with a higher level of eating related self-determined motivation. However, our results also showed that for a given level of global self-determined motivation, women show higher level of eating related self-determined motivation than men. One of the postulates of the SDT indicates that motivation is determined by the topdown effect from motivation at the next level up in the hierarchy, respectively, the global, contextual and situational motivation (15) . In fact, this postulate proposes that higher hierarchical level of motivation can influence the level below. Although our study does not allow establishing causal associations, it could be hypothesized that global self-determined motivation can influence the level of eating related self-determined motivation in both men and women. However, because no gender differences were observed according to global SDI, other factors are clearly involved in determining the level of eating related selfdetermined motivation and could explain the difference in eating related SDI between men and women. According to the SDT, more self-determined forms of behavioral regulation will be promoted if the basic psychological needs are satisfied (10) . Despite the lack of gender differences in basic psychological needs at the global level, it is possible, based on the hierarchical model of motivation proposed by Vallerand (1997), that gender differences exist in basic psychological needs satisfaction, more specifically related to dietary behaviors. The level of satisfaction of these psychological needs could influence eating related level of self-determined motivation, i.e. dietary self-determined motivation, but also ultimately the behavior, i.e. meal preparation and dietary intakes. Questionnaires evaluating basic psychological needs related to satisfaction at work (37) and in relationships (38) have been previously developed, but no such questionnaire exists for dietary behaviors. Therefore, it would be of interest to develop a tool to assess basic psychological needs more specifically related to dietary behavior in order to test this hypothesis. 76 Overall, our results indicate that women had higher level of eating related self-determined motivation and a diet of better quality than men, which agree with previous study indicating that higher level of self-determined motivation or motivation more autonomously regulated is associated with dietary intakes of better quality (11) . Other gender-related factors than gender differences in eating related SDI seem to be involved in determining dietary intakes and behaviors since analyses performed indicated that when men and women where compared while adjusting for eating related SDI women still had a lower energy density, a higher percentage of energy provided by carbohydrates and a higher frequency of meal preparation than men. For example, it is possible that factors such as nutrition knowledge (39) and attitudes (40) might explain some gender differences in dietary intakes and eating behaviors. The pattern of associations of eating related SDI with dietary intakes and eating behaviors was investigated in men and women. Globally, our results agree with the literature indicating that a higher self-determined motivation was associated with better dietary profile and with eating behaviors predisposing to a healthier body weight management (41, 42) . The most notable difference between men and women in the pattern of associations was that eating related SDI was significantly associated to dietary intakes, only in women. In fact, eating related SDI was associated with lower energy density in women only. Thus, level of self-determined motivation appears to be translated into concrete actions to modify eating habits in women, which is not the case in men. This gender difference in the association between eating related SDI and dietary intakes (i.e. association in women and not in men) suggest that even if men were increasing their eating related SDI, this would not necessarily allow matching-up the quality of the dietary profile observed in women. Results of our covariance analyses showing that gender differences in dietary intakes were still observed after adjustment for eating related SDI bring support to this suggestion. Intervention studies aiming at increasing eating related SDI in men and women will be needed to properly test this hypothesis. In terms of clinical implications, our study allowed characterizing motivational profile, dietary intakes and eating behaviors in men and women presenting cardiovascular risk 77 factors and is therefore a first step toward a better understanding of factors that could potentially help developing efficacious interventions aimed at promoting healthier eating habits and eating behaviors in a preventive health care context (43) . From our study, we are confident that intervention favouring an increase in eating related SDI will be beneficial for men and women but it can be suspected, according to our results, that changes in dietary intakes and eating behaviors in response to such an intervention will not be the same in men and women. Future intervention studies should be addressed to clarify how individual’s motivation related to healthy eating can impact on nutritional intervention outcomes, and identify potential gender differences in this regard. Moreover, intervention studies designed to favour an optimal motivational profile in men and women are also needed. Some limitations of the study need to be mentioned. First, our sample of men and women represents individuals with cardiovascular risk factors, which is not representative of the general population. Although anthropometric and metabolic variables were measured, dietary intakes were self-reported which cannot exclude the risk of misreporting dietary intakes. Nevertheless, our study has important strengths namely the fact that analyses were conducted distinctively in men and women according to motivational and behavioral variables, and dietary intakes. It is also the first study that has closely examined the associations of motivational profile with dietary intakes and eating behaviors, specifically targeting individuals presenting cardiovascular risk factors and who could therefore clearly benefit from improving their eating habits. In conclusion, although men and women showed similar level of global self-determined motivation in life domains, women presented higher level of eating related self-determined motivation than did men. According to our results, the more favourable dietary profile observed in women could not be solely attributed to their higher level of eating related SDI. This observation might be explained by the fact that the pattern of associations of eating related SDI with dietary variables and eating behaviors was not the same in men and women. 78 FINANCIAL SUPPORT This research project was supported by the Canadian Institutes of Health Research (MOP 84568) and Heart and Stroke Foundation of Quebec (2007-180). Canadian Institutes of Health Research and Heart and Stroke Foundation of Quebec had no role in the study design, collection, analysis or interpretation of the data, writing the manuscript, or the decision to submit the paper for publication. V.L. is a recipient of a doctoral scholarship from the Fonds de recherche du Québec - Santé (FRQS). AUTHORSHIP The authors’ contributions are as follow: V.L. was in charge of the analysis and interpretation of data and drafted the manuscript; C.B. contributed to the conception and design of the study as well as to the interpretation of data; L.C. and S.D. contributed to the conception and design of the study; S.L. (corresponding author) was responsible for the conception and design of the study and contributed to the interpretation of data. All of the authors have read and approved the final version of the manuscript submitted for publication. CONFLICT OF INTEREST Authors report no conflict of interest. 79 REFERENCES 1. Li KK, Concepcion RY, Lee H, Cardinal BJ, Ebbeck V, Woekel E & Readdy RT (2012) An examination of sex differences in relation to the eating habits and nutrient intakes of university students. J Nutr Educ Behav 44, 246-250. 2. Fagerli RA & Wandel M (1999) Gender differences in opinions and practices with regard to a "healthy diet". Appetite 32, 171-190. 3. Rolls BJ, Fedoroff IC & Guthrie JF (1991) Gender differences in eating behavior and body weight regulation. Health Psychol 10, 133-142. 4. Provencher V, Drapeau V, Tremblay A, Despres JP & Lemieux S (2003) Eating behaviors and indexes of body composition in men and women from the Quebec family study. Obes Res 11, 783-792. 5. Lindroos AK, Lissner L, Mathiassen ME, Karlsson J, Sullivan M, Bengtsson C & Sjostrom L (1997) Dietary intake in relation to restrained eating, disinhibition, and hunger in obese and nonobese Swedish women. Obes Res 5, 175-182. 6. Goulet J, Provencher V, Piche ME, Lapointe A, John Weisnagel S, Nadeau A, Bergeron J & Lemieux S (2008) Relationship between eating behaviours and food and drink consumption in healthy postmenopausal women in a real-life context. Br J Nutr 100, 910-917. 7. de Castro JM (1995) The relationship of cognitive restraint to the spontaneous food and fluid intake of free-living humans. Physiol Behav 57, 287-295. 8. Ashida S, Wilkinson AV & Koehly LM (2012) Social influence and motivation to change health behaviors among Mexican-origin adults: implications for diet and physical activity. Am J Health Promot 26, 176-179. 9. Deci EL & Ryan RM (1985) Intrinsic motivation and self-determination in human behavior. New York, NY: Plenum. 10. Ryan RM & Deci EL (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol 55, 68-78. 11. Pelletier LG, Dion SC, Slovinec-D'Angel M & Reid R (2004) Why Do You Regulate What You Eat? Relationships Between Forms of Regulation, Eating Behaviors, Sustained Dietary Behavior Change, and Psychological Adjustment. Motivation and Emotion 28, 245-277. 12. Williams GC, Minicucci DS, Kouides RW, Levesque CS, Chirkov VI, Ryan RM & Deci EL (2002) Self-determination, smoking, diet and health. Health Educ Res. 17, 512-521. 80 13. Mask L & Blanchard CM (2011) The protective role of general self-determination against 'thin ideal' media exposure on women's body image and eating-related concerns. J Health Psychol 16, 489-499. 14. Verstuyf J, Patrick H, Vansteenkiste M & Teixeira PJ (2012) Motivational dynamics of eating regulation: a self-determination theory perspective. Int J Behav Nutr Phys Act 9, 21. 15. Vallerand RJ (1997) Toward a hierarchical model of intrinsic and extrinsic motivation. In Advances in Experimental Social Psychology, ed. M.P. Zanna, pp. 271-360. New York, NY: Academic Press. 16. NCEP ATP III (2002) Third Report of the National Cholesterol Education Program (NCEP) Expert Panel on Detection, Evaluation, and Treatment of High Blood Cholesterol in Adults (Adult Treatment Panel III) final report. Circulation 106, 31433421. 17. Bedard A, Riverin M, Dodin S, Corneau L & Lemieux S (2012) Sex differences in the impact of the Mediterranean diet on cardiovascular risk profile. Br J Nutr 108, 14281434. 18. Landgren BM, Collins A, Csemiczky G, Burger HG, Baksheev L & Robertson DM (2004) Menopause transition: Annual changes in serum hormonal patterns over the menstrual cycle in women during a nine-year period prior to menopause. J Clin Endocrinol. Metab. 89, 2763-2769. 19. Grundy SM, Cleeman JI, Merz CN, Brewer HB, Jr., Clark LT, Hunninghake DB, Pasternak RC, Smith SC, Jr. & Stone NJ (2004) Implications of recent clinical trials for the National Cholesterol Education Program Adult Treatment Panel III Guidelines. J Am Coll. Cardiol. 44, 720-732. 20. International Diabetes Federation (2006) IDF worldwide definition of the metabolic syndrome. Available at: http://www.idf.org/webdata/docs/MetS_def_update2006.pdf (Accessed on 12 July 2013). 21. Goulet J, Lamarche B, Nadeau G & Lemieux S (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis. 170, 115-124. 22. Gagné M (2003) The Role of Autonomy Support and Autonomy Orientation in Prosocial Behavior Engagement. Motivation and Emotion 27. 23. Guay F, Mageau GA & Vallerand RJ (2003) On the hierarchical structure of selfdetermined motivation: a test of top-down, bottom-up, reciprocal, and horizontal effects. Pers. Soc. Psychol Bull. 29, 992-1004. 81 24. Goulet J, Nadeau G, Lapointe A, Lamarche B & Lemieux S (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J 3, 13. 25. Stunkard AJ & Messick S (1985) The three-factor eating questionnaire to measure dietary restraint, disinhibition and hunger. J Psychosom Res. 29, 71-83. 26. 26. Westenhoefer J, Stunkard AJ & Pudel V (1999) Validation of the flexible and rigid control dimensions of dietary restraint. Int J Eat Disord 26, 53-64. 27. Bond MJ, McDowell AJ & Wilkinson JY (2001) The measurement of dietary restraint, disinhibition and hunger: an examination of the factor structure of the Three Factor Eating Questionnaire (TFEQ). Int J Obes Relat Metab Disord 25, 900-906. 28. Lohman T, Roche A & Artorel R (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. 29. Liebman M, Pelican S, Moore SA, Holmes B, Wardlaw MK, Melcher LM, Raidl M, Wheeler B & Haynes GW (2006) Dietary intake-, eating behavior-, and physical activity-related determinants of high body mass index in the 2003 Wellness IN the Rockies cross-sectional study. Nutrition Research 26, 111-117. 30. Garriguet D (2009) Diet quality in Canada. Health Rep 20, 41-52. 31. Rolls BJ, Drewnowski A & Ledikwe JH (2005) Changing the energy density of the diet as a strategy for weight management. J Am Diet Assoc 105, S98-103. 32. Raynor HA, Looney SM, Steeves EA, Spence M & Gorin AA (2012) The effects of an energy density prescription on diet quality and weight loss: a pilot randomized controlled trial. J Acad Nutr Diet 112, 1397-1402. 33. Bacon L, Stern JS, Van Loan MD & Keim NL (2005) Size acceptance and intuitive eating improve health for obese, female chronic dieters. J Am.Diet.Assoc. 105, 929936. 34. Sofi F, Cesari F, Abbate R, Gensini GF & Casini A (2008) Adherence to Mediterranean diet and health status: meta-analysis. BMJ. 337, a1344. 35. Waller G & Matoba M (1999) Emotional eating and eating psychopathology in nonclinical groups: a cross-cultural comparison of women in Japan and the United Kingdom. Int J Eat Disord 26, 333-340. 36. Delahanty LM, Meigs JB, Hayden D, Williamson DA & Nathan DM (2002) Psychological and behavioral correlates of baseline BMI in the diabetes prevention program (DPP). Diabetes Care 25, 1992-1998. 82 37. Deci EL, Ryan RM, Gagné M, Leone DR, Usunov J & Kornazheva BP (2001 ) Need satisfaction, motivation, and well-being in the work organizations of a former Eastern Bloc country. Personality and Social Psychology Bulletin 27, 930-942. 38. La Guardia JG, Ryan RM, Couchman CE & Deci EL (2000) Within-person variation in security of attachment: a self-determination theory perspective on attachment, need fulfillment, and well-being. J Pers Soc Psychol 79, 367-384. 39. Baker AH & Wardle J (2003) Sex differences in fruit and vegetable intake in older adults. Appetite. 40, 269-275. 40. Emanuel AS, McCully SN, Gallagher KM & Updegraff JA (2012) Theory of Planned Behavior explains gender difference in fruit and vegetable consumption. Appetite 59, 693-697. 41. Provencher V, Drapeau V, Tremblay A, Despres JP & Lemieux S (2003) Eating behaviors and indexes of body composition in men and women from the Quebec family study. Obes Res. 11, 783-792. 42. Hays NP, Bathalon GP, McCrory MA, Roubenoff R, Lipman R & Roberts SB (2002) Eating behavior correlates of adult weight gain and obesity in healthy women aged 5565 y. Am J Clin Nutr 75, 476-483. 43. Patrick H & Williams GC (2012) Self-determination theory: its application to health behavior and complementarity with motivational interviewing. Int J Behav Nutr Phys Act 9, 18). 83 Table 1. Physiological characteristics of men and women Men (n=64) Women (n=59) Variables Mean SD Mean SD t Age (years) 41.0 7.9 41.8 6.7 0.60 Body weight (kg) 96.6 15.5 77.9* 16.6 7.50 2 Body mass index (kg/m ) 30.8 4.4 29.6* 6.0 2.10 Body fat (%) 26.7 4.5 39.2* 6.2 11.46 Waist circumference (cm) 106.1 10.2 95.8* 11.5 -5.53 Total cholesterol (C) (mmol/L) 5.7 0.8 5.8 0.7 0.87 LDL-C (mmol/L) 3.6 0.7 3.6 0.7 0.07 HDL-C (mmol/L) 1.1 0.2 1.4* 0.3 6.06 Total-C/HDL-C ratio 5.1 1.0 4.2* 0.9 -5.37 Triglycerides (mmol/L) 1.9 0.9 1.5* 0.6 -2.95 Fasting glucose (mmol/L) 5.3 0.5 5.2 0.7 1.34 Fasting insulin (pmol/L) 100.5 45.0 88.5 45.4 -1.79 Analyses are based on Student’s t-test procedure in SAS. For lipid-lipoprotein variables, glycaemia and insulinaemia, n = 63 men and n = 58 women. For percentage of body fat, n = 52 men and n = 48 women. *Values significantly different between men and women (P ≤ 0.05). HDL, high-density lipoprotein; LDL, low-density lipoprotein. 85 Table 2. Dietary intakes and eating behaviors in men and women Variables Men (n=64) Mean SD Women (n=59) Mean SD Dietary intakes Energy intake (kJ) Energy density (kJ/g) Carbohydrates (% of total energy) Proteins (% of total energy) Lipids (% of total energy) 12824 5.52 42.2 18.3 36.8 10280* 5.06* 44.5* 17.8 35.1* 3749 1.00 5.3 2.5 4.8 2389 0.71 5.8 2.8 4.5 t -4.60 -3.05 2.33 -1.19 -2.06 Eating behaviors Dietary restraint 5.9 3.2 6.9 4.1 1.18 Flexible restraint 1.9 1.4 2.4 1.6 1.76 Rigid restraint 1.7 1.3 1.8 1.7 0.46 Disinhibition 6.0 2.8 6.2 2.8 0.48 Habitual susceptibility to disinhibition 0.7 1.0 0.7 1.0 0.12 Situational susceptibility to disinhibition 3.0 1.4 2.5 1.5 -1.84 Emotional susceptibility to disinhibition 0.7 1.0 1.6* 1.2 3.98 Hunger 4.8 3.0 4.2 2.9 -1.12 Internal hunger 1.9 1.8 1.6 1.6 -1.16 External hunger 1.9 1.5 1.8 1.4 -0.10 Analyses are based on Student’s t-test procedure in SAS. For the TFEQ completion, n = 63 men; for flexible restraint, n = 60 men and n = 58 women; for rigid restraint, n = 57 women; for habit- ual susceptibility to disinhibition, n = 58 women; for internal hunger, n=60 men and n=58 women; for external hunger, n=62 men and n = 58 women. For the TFEQ completion, n = 63 men; for flexible restraint, n = 60 men and n = 58 women; for rigid restraint, n = 57 women; for habit- ual susceptibility to disinhibition, n = 58 women; for internal hunger, n=60 men and n=58 women; for external hunger, n=62 men and n = 58 women. *Values significantly different between men and women (P ≤ 0.05). 86 Table 3. Basic psychological needs, global and eating related motivation in men and women Variables Basic psychological needs Autonomy Competence Relatedness Global motivation scale Global self-determination index Men (n=63) Mean SD Women (n=59) Mean SD t 5.44 5.66 5.49 0.72 0.74 0.67 5.31 5.59 5.55 0.82 0.74 0.82 -0.91 -0.57 0.44 8.55 3.21 8.20 3.61 -0.57 Regulation of eating behaviors scale Intrinsic motivation 5.27 1.05 5.78* 0.87 2.96 Integrated regulation 4.88 1.18 5.32* 1.04 2.15 Identified regulation 6.23 0.70 6.33 0.64 0.81 Introjected regulation 2.35 1.01 2.30 0.93 -0.28 External regulation 1.95 1.05 1.63 0.72 -1.83 Amotivation 1.38 0.49 1.22 0.42 1.86 Eating related self-determination index 21.33 6.43 25.08* 6.58 3.18 Analyses are based on Student’s t-test procedure in SAS. For the questionnaire on basic psychological needs, n = 63 men; for the global motivation scale, n = 63 men and n = 58 women; for the regulation of eating behaviours scale, n = 63 men; for integrated regulation, n = 62 men; for identified regulation, n = 58 women. *Values significantly different between men and women (P ≤ 0.05). 87 Table 4. Association between eating related self-determination index and dietary intakes, eating behaviors and anthropometric profile in men and women Eating related self-determination index Men (n=63) Variables r Women (n=59) p Dietary intakes Energy intake (kJ) 0.12 0.34 Energy density (kJ/g) -0.06 0.64 Carbohydrates (% of total energy) -0.01 0.92 Proteins (% of total energy) 0.11 0.38 Lipids (% of total energy) -0.08 0.54 Eating behaviors Dietary restraint 0.09 0.50 Flexible restraint 0.33 0.01 Rigid restraint 0.01 0.93 Disinhibition -0.15 0.24 Habitual susceptibility to disinhibition -0.07 0.60 Situational susceptibility to disinhibition -0.05 0.70 Emotional susceptibility to disinhibition -0.35 0.005 Hunger -0.27 0.03 Internal hunger -0.30 0.02 External hunger -0.12 0.33 Anthropometric profile Body mass index (kg/m2) -0.12 0.34 Body fat (%) -0.31 0.03 Waist circumference (cm) -0.17 0.19 Analyses are based on the Pearson correlation procedure in SAS. 88 r p -0.16 -0.30 -0.13 0.11 -0.007 0.23 0.02 0.32 0.39 0.96 -0.0005 0.09 -0.04 -0.26 -0.09 -0.25 -0.25 -0.18 -0.12 -0.25 1.00 0.52 0.74 0.04 0.49 0.05 0.06 0.18 0.37 0.06 -0.33 -0.43 -0.30 0.01 0.002 0.02 CHAPITRE 4 : Différences entre les hommes et les femmes dans les apports alimentaires et le profil métabolique en réponse à une intervention nutritionnelle de 12 semaines visant l’adoption de l’alimentation méditerranéenne Vicky Leblanc, Anne-Marie Hudon, Marie-Michelle Royer, Louise Corneau, Sylvie Dodin, Catherine Bégin, Simone Lemieux Journal of Nutritional Science, 2015 ; 4(e13) : 1-11. 89 Differences between men and women in dietary intakes and metabolic profile in response to a 12-week nutritional intervention promoting the Mediterranean diet Vicky Leblanc1, Anne-Marie Hudon1, Marie-Michelle Royer1, Louise Corneau1, Sylvie Dodin1,2, Catherine Bégin3, and Simone Lemieux1. 1 Institute of Nutrition and Functional Foods, Laval University, 2440 Hochelaga Blvd, Québec, Canada, G1V 0A6 2 Department of Obstetric and Gynaecology, Laval University, Pavillon Ferdinand-Vandry, 1050 Medicine Avenue, Québec, Canada, G1V 0A6 3 School of Psychology, Laval University, Pavillon Félix-Antoine Savard, 2325 rue des Bibliothèques, Québec, Canada, G1V 0A6 Address of correspondence: Simone Lemieux, Ph.D, RD. Institute of Nutrition and Functional Foods 2440 Hochelaga Blvd Laval University, Québec Québec, Canada, G1V 0A6 Phone: (418) 656-2131 ext.: 3637 Fax: (418) 656-5877 E-mail: [email protected] (can be published) Key words: Differences between men and women, Mediterranean diet, Cardiovascular risk, Self-Determination Theory. Abbreviations: MedDiet, Mediterranean diet; CVD, Cardiovascular diseases; C, Cholesterol; SDT, Self-Determination Theory; FSH, Follicle-stimulating hormone; Medscore, Mediterranean score; MI, Motivational interviewing; FFQ, Food frequency questionnaire; BMI, Body mass index; VAS, Visual analog scale. 91 RÉSUMÉ Cette étude avait pour objectif de documenter les différences de genre dans les changements alimentaires, anthropométriques et métaboliques en réponse à une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne et basée sur la théorie de l’autodétermination. Soixante-quatre hommes et 59 femmes préménopausées à risque de maladies cardiovasculaires ont pris part à l’intervention de 12 semaines. Les apports alimentaires ont été évalués via un questionnaire de fréquence, à partir duquel un score méditerranéen a été calculé. Une augmentation similaire du score méditerranéen a été observée chez les hommes et les femmes en réponse à l’intervention. Les hommes ont davantage diminué leur consommation de viandes rouges et augmenté leur consommation de fruits comparativement aux femmes. Des diminutions similaires de l’IMC et de la circonférence de la taille ont été observées chez les hommes et les femmes. Des diminutions plus importantes des ratios C-total sur C-HDL et triglycérides sur C-HDL ont été notées chez les hommes comparativement aux femmes, mais ces différences devenaient non significatives après l’ajustement pour la valeur de départ. Ces résultats suggèrent que l’intervention a mené à une amélioration plus importante des apports alimentaires et du profil métabolique chez les hommes que chez les femmes. Le profil métabolique plus détérioré chez les hommes au départ semble expliquer en majeure partie l’amélioration plus importante des facteurs de risque cardiovasculaire chez les hommes. 93 ABSTRACT Few studies have compared men and women in response to nutritional interventions but none has assessed differences between men and women in the response to a nutritional intervention program based on the Self-Determination Theory (SDT) and using the Mediterranean diet (MedDiet) as a model of healthy eating, in a context of cardiovascular diseases (CVD) prevention and within a non-Mediterranean population. Our study aimed to document differences between men and women in changes in dietary, anthropometric and metabolic variables, in response to a nutritional intervention program promoting the adoption of the MedDiet and based on the SDT. Sixty-four men and fifty-nine premenopausal women presenting risk factors for CVD were recruited through different media advertisements in the Québec City Metropolitan area (Canada). The 12-week nutritional program used a motivational interviewing approach and included individual and group sessions. A validated food frequency questionnaire (FFQ) was administered to evaluate dietary intakes from which a Mediterranean score (Medscore) was derived. Both men and women significantly increased their Medscore in response to the intervention (P < 0·0001). Men showed a significantly greater decrease in red and processed meat (-0·4 (95% CI, -0·7 to -0·1) portions/d) and a greater increase in fruit (0·9 (95% CI, 0·2 to 1·6) portion/d) intakes than women. When adjusting for the baseline value of the response variable, differences between men and women became non significant for red and processed meat and fruit intakes whereas significant differences between men and women (i.e. larger increases in men than women) were observed for legumes, nuts and seeds (0·6 (95% CI, 0·2 to 1·0) portion/d) and whole grain products (0·5 (95% CI, 0·01 to 1·0) portion/d) intakes. Significant decreases were observed for BMI and waist circumference in both men and women (P 0·04). Significant greater decreases were found for total-C to HDL-C (-0·2 (95% CI, -0·4 to -0·03)) and triacylglycerols to HDL-C (-0·2 (95% CI, -0·4 to -0·04)) ratios in men than in women. For metabolic variables, differences between men and women became non significant for total-C to HDL-C and triacylglycerols to HDL-C ratios when adjusted for the baseline value of the response variable. Our results suggest that the nutritional intervention promoting the adoption of the MedDiet and based on the SDT led to greater improvements in dietary intakes in men than in women, which appear to have 95 contributed to beneficial anthropometric and metabolic changes, more particularly in men. However, the more deteriorated metabolic profile found in men at baseline seems to contribute to a large extent to the more beneficial changes in CVD risk factors observed in men as compared to women. 96 INTRODUCTION Adoption of healthy eating habits is encouraged in the context of chronic disease prevention and the Mediterranean diet (MedDiet) has been ranked as one of the best models to provide protection against cardiovascular diseases (CVD) (1-3) . The MedDiet pattern is characterized by a high intake of vegetables, fruits, legumes, nuts, cereals (mainly unrefined), a high intake of olive oil, a low-to-moderate intake of dairy products, a low intake of meat and poultry, and a regular but moderate intake of alcohol, primarily in the form of wine and generally during meals (3). Studying differences between men and women in response to interventions aimed at preventing or treating diseases is absolutely essential for providing optimal care to men and women. Without such studies comparing men and women, we would not know, for example, that usage of some medications for preventing or treating CVD are efficacious in men but not appropriate in women (4, 5) . At this point it is essential to underline that differences observed between men and women can be explained by both sex and gender differences. Sex differences refer to biological and physiological characteristics that distinguish males from females while gender is described as socially constructed roles, relationships, behaviors, relative to power, and other traits that societies ascribe to men and women (6) . When studying differences between men and women in response to nutritional interventions, both sex and gender differences can be involved to a different degree depending upon the type of intervention and the two constructs have been suggested to be closely interrelated and difficult to dissociate (6). Some studies have documented differences between men and women in the context of controlled studies where all food and drinks are provided. In such a context, differences observed between men and women in response to the intervention refer more to sex than to gender differences (7-9). In fact, in those types of studies the impact of the diet on metabolic variables measured can be influenced by sex-related factors such as sexual hormones (10) and is not likely to be influenced by factors such as diet adherence that is in turn modulated 97 by gender-related factors. A few studies have been performed to compare men and women in response to diet manipulations performed in controlled conditions. Accordingly, a greater decrease has been reported in LDL-Cholesterol (C) levels in response to a low saturated fatty acids diet in men than in women (8, 9, 11) and a recent study published by our team showed decreases in insulin levels in men but not in women, in response to a 4-week MedDiet (7) . On the other hand, in nutritional interventions during which subjects continue to buy their food, cook their meals and make decisions about what they eat, the differences observed between men and women cannot be considered as sex differences since gender specific factors such as attitudes, beliefs and motivation towards food regulation are influencing adherence to dietary recommendations and therefore health benefits that can be obtained from it. This is why when referring to these types of studies the term gender differences is more appropriate. Only a few studies have been performed to assess gender differences in response to educational nutrition program promoting the MedDiet. Among a Mediterranean population, a higher success in improving adherence to the MedDiet in men than women was reported after one year in the PREDIMED trial, which includes Spanish men and women presenting high risk for CVD (12) . Among a non-Mediterranean population, a study has reported the impact of a MedDiet education program in hypercholesterolemic men and women and showed that whereas women improved their dietary intakes in accordance with the education program and significantly decreased their total-C levels, no such changes serum total-C were observed in men. (13). Changing eating habits represents a major challenge for many people (14) and evidence indicates that the extent to which health professionals involve their clients in the decision making process may influence adherence to treatment (15) . In this regard, the Self- Determination Theory (SDT) suggests that stimulating optimal quality of motivation could help individuals to evolve toward healthier eating habits. (16). To the best of our knowledge, no study has assessed differences between men and women in the response to a nutritional intervention program based on the SDT and using the MedDiet as a model of healthy eating, in a context of CVD prevention and within a non-Mediterranean population. 98 Therefore, the objective of this study was to determine differences between men and women in changes in dietary, anthropometric and metabolic variables, in response to a 12week nutritional intervention program promoting the adoption of the MedDiet, based on the SDT, in Canadian men and women presenting risk factors for CVD. METHODOLOGY Participants This study was conducted among a sample of 64 men and 59 premenopausal women aged between 25 and 50 years old, and were recruited through different media advertisements in the Québec City Metropolitan area (Canada). In women, a follicle-stimulating hormone (FSH) measurement was performed if needed (e.g., when women presented menstrual irregularities) to confirm the premenopausal status (FSH < 20 IU/l) (17) . Men and women had to present slightly elevated LDL-C concentrations (between 3·0 and 4·9 mmol/l) (18) or a total-C to HDL-C ratio ≥ 5·0, and at least one of the four following criteria of the metabolic syndrome (19) : 1) triacylglycerol concentrations ≥ 1·7 mmol/l; 2) fasting glycaemia between 6·1 et 6·9 mmol/l; 3) blood pressure measurements ≥ 130/85 mm Hg; 4) waist circumference ≥ 80 cm in women and ≥ 94 cm in men (20). Participants also had to have a stable body weight ( 2·5 kg) for a minimum of three months prior to the beginning of the study and to be involved in food purchases and/or preparation at home. We excluded men and women who had cardiovascular events and who used medication that could affect dependent variables under study, i.e., medication for hypertension, dyslipidemia and diabetes (type 1 and type 2). Pregnant women, smokers, participants with an alcoholism history or with a high Mediterranean score (Medscore > 29, i.e. food pattern already highly concordant with the MedDiet) (21) were also excluded. This study was conducted according to the guidelines laid down in the Declaration of Helsinki and all procedures involving human subjects were approved by the Laval University Research Ethics Committee on human experimentation. All subjects voluntarily agreed to participate in the research 99 project and written informed consent was obtained from all men and women prior to their participation in the study. This clinical trial was registered at www.clinicaltrials.gov as NCT01852721. Study Design The 12-week nutritional program was based on the Self-Determination Theory (SDT) and used a motivational interviewing (MI) approach. The SDT relies on the quality of the motivation that regulates behaviours, which lies on a continuum from lower to higher selfdetermined motivation forms (extending from amotivation to intrinsic motivation) (22) . The SDT also postulates that the key component for the development of intrinsic motivation is the satisfaction of basic psychological needs which are autonomy, competence and relatedness (22) . The study was conducted in five phases (spanning from January 2010 to November 2012) and the nutritional intervention included three group sessions (with 10-15 individuals each), three individual sessions and four follow-up phone calls with a registered dietitian (Figure 1). Three registered dietitians were trained to provide a standardized intervention and participants always met with the same dietitian during individual sessions. The first group session was a lecture, always provided by the same dietitian and aiming at explaining principles of the traditional MedDiet (length: 2·5 hours, n = 13-25 participants/group). At week four, men and women actively participated to a 3-hour Mediterranean cooking lesson during which they had to cook a Mediterranean meal (n = 814 participants/group). At week eight, they shared a 3-hour Mediterranean potluck dinner aimed at discussing barriers met in adopting dietary recommendations since the beginning of the intervention (n = 5-12 participants/group). Individual counselling took place at weeks one, five and 10 and lasted between 45 minutes and one hour for each appointment. Individual follow-up phone calls took place at weeks three, six, nine and 12, and each lasted for about 20-30 minutes. The main objective of individual counselling and follow-up telephone calls was to assess dietary changes and to determine progressive personal goals aimed at improving the adherence to MedDiet principles. Different tools such as the decisional balance and the action plan, congruent with the MI approach, were used during 100 the individual sessions to formulate dietary objectives while increasing self-determined motivation. In accordance with the SDT (22) , basic psychological needs (i.e. autonomy, competence and relatedness) were promoted during the nutritional intervention via the MI approach in order to increase self-determined motivation. More specifically, autonomy and competence of men and women were promoted by the dietitian during individual sessions, i.e. in supporting them into their decision making process about dietary changes and potential strategies to achieve and maintain these changes, but also during the group sessions by improving their cooking skills and knowledge related to food and nutrition. Therefore, the dietitian had a client-centered approach and put no pressure on participants about the type of dietary objectives to be chosen. In addition, no emphasis was put on body weight control. Men and women were encouraged to maintain dietary changes in an autonomous way at the end of the nutritional program and there was no additional contact with the dietitian after the end of the 12-week intervention. Measurements of Dependent Variables All measurements were performed before (t = 0) and after the 12-week nutritional intervention program (t = 12 weeks), except for the perceived adherence to the MedDiet which was assessed only at the end of the intervention (t = 12 weeks). Dietary Variables A validated food frequency questionnaire (FFQ) (23) was administered by a registered dietitian. The FFQ is based on typical foods available in Québec. It contains 91 items and 33 subquestions. Participants were questioned about the frequency of intake of different foods and drinks during the last month and could report the frequency of these intakes in terms of day, week or month. A Medscore (21) was calculated based on the FFQ and allowed to assess the level of adherence to the Mediterranean food pattern. A partial score varying from 0 to 4 is attributed to each of the 11 components of the Mediterranean pyramid. The Medscore could therefore vary between 0 and 44 points. Components of the 101 Medscore are: grains (whole and refined); vegetables (whole and juices); fruits (whole and juices); legumes, nuts and seeds; olive oil (including olives and rapeseed oil); dairy products; fish (including seafoods); poultry; eggs; sweets and red meat/processed meat. As previously described (21) , a high consumption of food groups promoted by the Mediterranean diet (grains, vegetables, fruits, legumes, nuts and seeds, olive oil and fish) contributed to increase the Medscore, whereas a high consumption of food groups less concordant with the Mediterranean diet (sweets and red meat/processed meat) contributed to decrease the Medscore. Moreover, a moderate consumption of dairy products, poultry and eggs obtained the maximum possible score for the respective component. A maximum of one point was respectively attributed to refined grains, vegetable juice, fruit juice consumption and intake of rapeseed oil or margarine made from olive or rapeseed oil. Macronutrient and micronutrient intakes obtained from the FFQ were evaluated using the Nutrition Data System for Research (NDS-R, version 4.03_31) software. Anthropometric and Metabolic Profile According to standardized procedures (24) height was measured to the nearest millimeter with a stadiometer (Seca 222 Mechanical Telescopic Stadiometer), body weight was measured to the nearest 0·1 kg on a calibrated balance (BWB-800S Digital scale, Tanita), and body mass index (BMI) was then calculated. Waist circumference measure was also taken to the nearest millimeter according to standardized procedures (24) . Body fat percentage was estimated using the Tanita body-fat analyser, with the accuracy level being +/- 5% of the institutional standard of body composition analysis-Dual Energy X-ray Absorptiometry (DEXA) and repeatable to within +/- 1% variation when used under consistent conditions (Tanita-BC-418 body-fat analyser (Tanita Corp., Tokyo, Japan)). Blood samples were collected after a 12-hour overnight fast. Total-C, HDL-C and triacylglycerol concentrations in serum were measured using commercial reagents on a Modular P chemistry analyzer (with 0·8% and 1·7% of within and between assay precision, respectively) (Roche Diagnostics, Mannheim, Germany). Serum LDL-C concentrations were obtained by calculation using the Friedewald equation (25) and apolipoprotein B concentrations by immunoturbidimetry (with < 1·5% and < 2·5% of within and between assay precision, respectively) (Roche Diagnostics, Mannheim, Germany). Plasma glucose 102 concentrations were measured with the hexokinase enzymatic method (with 0·7% and < 1·2% of within and between assay precision, respectively) and plasma insulin concentrations by electrochimiluminescence (with < 2·0% and < 2·8% of within and between assay precision, respectively) (Roche Diagnostics, Mannheim, Germany). Systolic and diastolic blood pressures were measured on the right arm and using an automated blood pressure monitor (BPM 300-BpTRU: Vital Signs Monitor) after a 10-minute rest in the sitting position. Measurement of blood pressure was computed as a mean of three readings. Perceived Adherence to the MedDiet At the end of the nutritional intervention (t = 12 weeks), men and women were invited to rate their perception of adherence to the MedDiet principles according to a visual analog scale (VAS) (ranging from 0 to 150 mm). Accordingly, the following question was asked: “In your opinion, to what extent your current dietary intakes meet the MedDiet principles?” (Not at all to perfectly). The distance between 0 mm and the vertical mark drawn on the 150 mm horizontal line was then measured with a ruler and corresponded to the perceived level of adherence to the MedDiet (adapted from Dansinger et al. (26)). Statistical Analyses Results are first presented in descriptive tables with pre-intervention (t = 0) and postintervention (t = 12 weeks) mean values (95% CI) according to men and women (Tables 2 and 4). Then, results are reported as changes within men and within women (delta values) calculated as post-nutritional intervention minus pre-nutritional intervention values and as percentage of change from baseline value (with P value), and two columns with the difference between men and women and the difference between men and women adjusted for the baseline value of the response variable, as means (95% CI) (Tables 3 and 5). Differences between men and women in dietary intakes, anthropometric and metabolic variables were assessed using an analysis of covariance (GLM procedure) on delta values. The least squares means (LSMEANS) of the GLM procedure, which can be defined as a 103 linear combination (sum) of the estimated effects, e.g. means, from a linear model and based on the model used, allowed determining significant changes in outcomes over time in men and women. The main model of the GLM procedure included gender only, but additional analyses included gender, baseline value of the response variable and gender by baseline value interaction in the model. The interaction was removed from the model when it did not reach statistical significance. Student’s t-test was used to compare macronutrient intakes as well as anthropometric and metabolic variables of men and women before the beginning of the nutritional intervention program and allowed comparisons of the perceived adherence to the MedDiet between men and women. The Chi-Square test was performed to compare the frequencies of categorical data, i.e. attrition rate and attendance rate to intervention sessions, between men and women. Since three different dietitians were in charge of providing the intervention, the intervener effect was tested using an analysis of variance with the GLM procedure. For variables not normally distributed, a transformation was performed but these variables are presented as raw data in the tables. In order to determine sample size, we considered a difference of 35% in the change in Medscore as being clinically significant, based on results of a previous study from our group (21) . Therefore a final sample size of 45 men and 45 women was needed to detect a difference of 35% in the change in Medscore between men and women with a power of 0·80 and alpha of 0·05, considering that standard deviation corresponds to 55% of the mean of the change in Medscore. The probability level for significance used for the interpretation of all statistical analyses was set at a level of P 0·05. All analyses were performed using SAS statistical software (version 9.2, SAS Institute Inc., Cary, NC). RESULTS Table 1 shows characteristics of men and women in terms of their age, anthropometric variables and metabolic profile. Men and women included in our study were about the same age, but men had higher BMI, waist circumference, total-C to HDL-C ratio and triacylglycerol levels than women, whereas women had a higher percentage of body fat and HDL-C levels than men. 104 Overall, attrition rate was similar in men and women (10·9% and 13·6% respectively, P = 0·66), and except for higher LDL-C levels in completers, no significant differences were observed in baseline characteristics of participants who dropped out versus the ones who completed the 12-week nutritional intervention. Among completers, no differences between men and women were observed for the attendance rate to the whole intervention (8·9 (SD 2·0) sessions in men and 9·0 (SD 1·8) in women, out of a maximum of 10 sessions) nor for each component taken separately i.e. attendance to group meetings (2·3 (SD 0·8) in men and 2·5 (SD 0·7) in women, out of a maximum of 3 meetings), individual counselling sessions (2·8 (SD 0·6) in men and 2·8 (SD 0·5) in women, out of a maximum of 3 sessions) and follow-up phone calls (3·7 (SD 0·9) in men and 3·7 (SD 0·8) in women, out of a maximum of 4 follow-up phone calls). Moreover, a significant difference in attendance rate between the different group meetings was observed (P 0·0001), with the higher participation rate found at the lecture on traditional Mediterranean principles (group meeting 1) and the lower rate found at the potluck dinner (group meeting 3). Briefly, 95·2, 82·5 and 57·1% of men (P 0·0001) and 98·3, 83·1 and 71·2% of women (P 0·0001) attended group meeting 1, 2 and 3, respectively. Similarly, significant differences in attendance rate between the different individual counselling sessions and also between the different follow-up phone calls were observed (P = 0·002 and P = 0·006, respectively), with a progressive decrease over time in the participation rate. The change in Medscore was not influenced by the dietitian in charge of the intervention as indicated by the analysis of variance (F = 0·36; P = 0·70). Table 2 presents nutritional intakes as well as the Medscore and its components at baseline and at the end of the intervention, and Table 3 presents changes in these variables in response to the 12-week nutritional intervention program, in men and women separately. Significant differences between men and women were found for changes in energy density, percentage of energy intake provided by lipids, saturated and trans fatty acids and total dietary fiber intake. Indeed, men significantly decreased more their energy density, had a greater increase in total dietary fiber intake, and greater decreases in percentage of energy intake from lipids, saturated and trans fatty acids than women, in response to the intervention. Moreover, both men and women significantly increased the percentage of 105 energy intake provided by polyunsaturated fatty acids, although no difference was observed between them. Also, a significant decrease in energy intake was observed in men only in response to the intervention. When statistical analyses were adjusted for the baseline value of the response variable, similar results were obtained for the percentage of energy intake provided by saturated fatty acids and total dietary fiber intake whereas differences between men and women were no longer significant for energy density, percentage of energy intake provided by lipids and trans fatty acids. As for the Medscore, both men and women showed increases in response to the intervention but without significant differences among them. With regards to Medscore components, significant differences between men and women were observed for red and processed meat and fruit intakes. The decrease in red and processed meat and the increase in fruit consumption were more pronounced in men than in women. In addition, intakes of legumes, nuts and seeds, whole grain products and fish and seafood increased while the intake of refined grain products decreased in both men and women without significant differences between them. Moreover, a significant increase in vegetable intake was only observed in men whereas a significant increase in olive oil and olive consumption was only observed in women, in response to the intervention. After statistical adjustment for the baseline value of the response variable, differences between men and women observed for changes in red and processed meat and fruit intakes were no longer significant. Moreover, significant differences between men and women were observed for legumes, nuts and seeds and whole grain products intakes once adjusted for the baseline value, with greater increases observed for theses variables in men than in women. At the end of the nutritional intervention, the perceived level of adherence to the MedDiet, as determined by VAS, was not different between men and women (99·8 (SD 24·2) mm in men and 100·1 (SD 25·3) mm in women; T = 0·07; P = 0·94). A significant and positive association in both men (r = 0·33; P = 0·01) and women (r = 0·28; P = 0·05) was observed between perceived level of adherence to the MedDiet and the actual Medscore calculated after the 12-week nutritional intervention. 106 Table 4 presents anthropometric and metabolic values at baseline and at the end of the intervention, and Table 5 presents changes in anthropometric and metabolic variables in response to the 12-week nutritional intervention program, in men and women separately. As shown in Table 5, no significant differences between men and women were observed for anthropometric changes, in response to the nutritional intervention. However, significant decreases were observed for BMI and waist circumference in both men and women. Also, despite the trend for women to decrease their body weight, only men significantly decreased their body weight and percentage of body fat in response to the nutritional intervention. As for metabolic changes, significant differences between men and women were found for total-C to HDL-C and triacylglycerols to HDL-C ratios, with greater decreases observed for these variables in men than in women. In addition, results showed significant changes in HDL-C (increase) and in triacylglycerol levels and diastolic blood pressure (decreases) in response to the intervention, but only in men. Moreover, differences between men and women observed in total-C to HDL-C and triacylglycerols to HDL-C ratios became non significant after adjustment for the baseline value. DISCUSSION The aim of our study was to determine differences between men and women in dietary, anthropometric and metabolic changes, in response to a 12-week nutritional intervention program promoting the adoption of the MedDiet, and based on the SDT. Results showed that our nutritional intervention led to improvements in dietary, anthropometric and metabolic profile, that were generally more pronounced in men than in women. Our results indicate that both men and women increased their level of adherence to the MedDiet (Medscore) in response to the 12-week nutritional intervention and therefore both men and women improved general quality of their diet. This improvement in the level of adherence to the MedDiet also indicates that our nutritional intervention program based on the SDT appears to be appropriate for both men and women. Moreover, the significant association found in both men and women between perceived level of adherence to the 107 MedDiet and the actual Medscore calculated suggests that men and women had a similar understanding of the intervention and also the capability to assess the quality of their diet accurately after the end of the 12-week nutritional intervention, which represents relevant information in a context of nutritional education. Although men and women improved their dietary intakes as shown by the increase in the Medscore, differences between men and women were observed when examining individual components of the Medscore, which were concordant with changes observed in nutritional intakes in response to the intervention. Indeed, the more pronounced changes observed in men in some food groups, e.g., by greater decrease in red and processed meat and greater increase in fruit consumption were consistent with some differences between men and women observed in nutrient intakes such as the greater decreases in energy density, percentage of energy provided by lipids, saturated and trans fatty acids, and the greater increase in fiber intake in men than in women. Moreover, the significant decrease in energy density in men was concordant with the decrease in daily energy intake, as previous studies have reported that decreasing energy density of the diet leads to a spontaneous decrease in energy intake (27) . Similarly to our findings, results from a nutritional intervention, which promoted the traditional MedDiet over a period of 12 months among a Spanish population, reported a greater success in men than in women when considering the level of adherence to the MedDiet (12) . On the other hand, our results are different from other studies (13, 28) reporting greater dietary changes in women than in men. Several differences in the intervention design can explain that differences between men and women regarding changes in dietary intakes observed in response to our nutritional intervention program differ, for example, from the study of Bemelmans et al. (13). First, our intervention included group but also individual counselling sessions to individualise dietary objectives and strategies adopted and to support men and women to overcome barriers in the adoption of the MedDiet, whereas only group sessions were provided to men and women in the study of Bemelmans et al. (13). Second, our nutritional intervention aimed at promoting autonomy and competence in men and women towards the adoption of the MedDiet. Indeed, we did so by supporting them in their dietary changes and strategies to achieve these changes and by promoting the development of their skills and knowledge related to nutrition, which 108 contrasts with specific nutritional guidelines and daily intake explained at the beginning of the intervention in the study of Bemelmans et al. (13) . It can be argued that providing more details about dietary guidelines may reduce the possibility for autonomy and that a more passive role of subjects in a nutritional intervention could explain divergence in results obtained among studies. Globally, direct comparison of our results to those from the literature remains difficult because of major differences in the intervention design and statistical analyses among studies. Some baseline characteristics in men and women may have influenced the magnitude of dietary changes observed in response to our nutritional intervention. Accordingly, healthier diet at baseline of a dietary intervention has been previously reported to decrease the likelihood of observing significant dietary changes (12) . The fact that women in our study had globally dietary intakes of higher quality at baseline and which tended to be closer to the traditional MedDiet pattern than those of men could thus possibly explain, at least partially, differences between men and women observed in dietary changes. In the context of our nutritional intervention, it can be hypothesized that because men’ dietary intakes at baseline were generally further away from MedDiet principles, they could possibly identify more easily changes that could be made and modify their eating habits, especially in the context of individual counselling sessions where specific dietary objectives were settled. Accordingly, the fact that many differences between men and women observed were no longer significant once dietary changes were adjusted for the baseline value of the response variable brings support to this hypothesis. Our results underline the importance of considering the characterization of the dietary profile of men and women before the beginning of a nutritional intervention to properly respond to the clients’ needs and maximize potential improvements in dietary intakes during the intervention. However, because some differences between men and women in dietary changes were significant once adjusted for the baseline value of the response variable, it is suggested that differences between men and women regarding other factors than baseline dietary intakes, such as attitudes and beliefs towards health and nutrition, might have influenced their response to the nutritional intervention. Our hypothesis is in agreement with a previous study (29) reporting that health attitudes and beliefs are relevant predictors of adherence to health 109 recommendations. The use of mixed methods in which qualitative and quantitative data are combined would therefore warrant to be considered in the future to get more specific information about such factors in men and women. Although our nutritional intervention promoted healthy dietary changes with no focus on body weight, both men and women showed improvements in their anthropometric profile with significant decreases in BMI and waist circumference, in response to the 12-week nutritional intervention. Our results are concordant with previous studies, which found that a higher adherence to the MedDiet was associated with lower prevalence of overweight or obesity (30, 31) . The MedDiet is recognized to be highly satiating (31, 32) and our results suggest that dietary changes led to increased satiety. More specifically, increases in legumes, nuts and seeds and whole grain products intakes reported in both men and women possibly contributed to a decrease in energy density through increased water content and fiber intake (33) . Moreover, the decrease in red and processed meat intake can have led to replacement of animal proteins by vegetable proteins sources such as legumes, nuts and seeds, which contain satiating components such as proteins and fibers (34, 35). As for metabolic profile, our results showed more pronounced changes in metabolic variables in men than in women and these can possibly be explained by greater dietary changes observed in men, in response to the nutritional intervention. As suggested by Estruch et al. (1) , potential synergy among nutrient-rich foods included in the MedDiet might foster favourable changes in some pathways of cardiovascular risks. It is also possible that some sex-related characteristics such as the level of sex hormones may interact with the complex synergistic effect between food components, resulting in smaller beneficial impact of the MedDiet in women than in men. In support of this, we recently reported significant improvements in insulin homeostasis in men only, in response to an isoenergetic controlled experimental diet based on the traditional MedDiet where all foods and drinks were provided to the participants (7) . However, the absence of differences between men and women in metabolic changes once statistical adjustment was performed for the baseline value of the response variable underlines the importance of the metabolic status at the beginning of a nutritional intervention program. Indeed, results related to 110 metabolic changes suggest that an individual with more deteriorated metabolic variables before the beginning of a nutritional intervention could show greater health improvements in response to the intervention, which is concordant with the fact than men in our study had a more deteriorated metabolic profile at baseline and improved more in response to the intervention than women. We acknowledge that our results cannot be extrapolate to the whole population because we recruited men and women presenting risk factors for CVD and who had dietary intakes closer to recommendations of the Canada’s Food Guide recommendations than the general adult population in Canada (36). Moreover, although anthropometric and metabolic variables were measured, dietary intakes were self-reported. Therefore, the risk of misreporting dietary intakes cannot be excluded. Our study has also important strengths such as the fact that analyses were conducted distinctively in men and women according to dietary intakes, anthropometric and metabolic profile in the context of a nutritional intervention program. Also, our nutritional intervention based on the SDT appears to be acceptable for both men and women as similar attrition and attendance rate to the intervention as well as to its specific components (i.e. group meetings, individual sessions, follow-up phone calls) was observed among them. Although attrition rate found in our study was similar to those reported in the literature among nutritional interventions based on a motivational interviewing approach (37) , reasons for not attending to some sessions remain difficult to identify and might differ among men and women. It remains essential to consider the clinical implication related to attendance rate when developing a nutritional intervention. Indeed, the lack of flexibility in the schedule related to group meetings attendance must be considered in the development of interventions as it may require efforts for some people to attend pre-scheduled meetings and this might progressively generate fatigue with time. It is also possible that active participation in practical activities, for example the cooking lesson, may be perceived as requiring too much effort for some individuals. Nevertheless, our study underlines the potential of improvement in adherence to the MedDiet among a nonMediterranean population, more specifically in the context of an intervention during which men and women chose their own dietary objectives (i.e. based on their personal interest and motivations). In addition, our results bring information about differences between men and 111 women in potential health benefits obtained following a 12-week nutritional intervention program promoting the MedDiet, and thus support the relevance to consider gender in the development of nutritional intervention programs aimed at preventing chronic diseases. In conclusion, our results suggest that the nutritional intervention program promoting the adoption of the MedDiet and based on the SDT led to greater improvements in dietary intakes in men than in women, which appear to have contributed to beneficial anthropometric and metabolic changes, more particularly in men. However, our results also suggest that the more deteriorated metabolic profile found in men at baseline appears to explain to a large extent the fact that the improvements in CVD risk factors were more pronounced in men than in women in response to the intervention. FINANCIAL SUPPORT This research project was supported by the Canadian Institutes of Health Research (MOP 84568) and Heart and Stroke Foundation of Quebec (2007-180). Canadian Institutes of Health Research and Heart and Stroke Foundation of Quebec had no role in the study design, collection, analysis or interpretation of the data, writing the manuscript, or the decision to submit the paper for publication. V.L. is a recipient of a doctoral scholarship from the Fonds de recherche du Québec - Santé (FRQS). CONFLICT OF INTEREST Authors report no conflict of interest. AUTHORSHIP The authors’ contributions are as follow: V.L. was in charge of the analysis and interpretation of data and drafted the manuscript; A-M.H. and M-M.R. contributed to the 112 acquisition of data; C.B. contributed to the conception and design of the study as well as to the interpretation of data; L.C. and S.D. contributed to the conception and design of the study; S.L. (corresponding author) was responsible for the conception and design of the study and contributed to the interpretation of data. All of the authors have read and approved the final version of the manuscript submitted for publication. 113 REFERENCES 1. Estruch R, Ros E, Salas-Salvado J, Covas MI, Pharm D, Corella D, Aros F, GomezGracia E, Ruiz-Gutierrez V, Fiol M, Lapetra J, Lamuela-Raventos RM, Serra-Majem L, Pinto X, Basora J, Munoz MA, Sorli JV, Martinez JA & Martinez-Gonzalez MA (2013) Primary Prevention of Cardiovascular Disease with a Mediterranean Diet. N Engl J Med. 2. Beunza JJ, Toledo E, Hu FB, Bes-Rastrollo M, Serrano-Martinez M, Sanchez-Villegas A, Martinez JA & Martinez-Gonzalez MA (2010) Adherence to the Mediterranean diet, long-term weight change, and incident overweight or obesity: the Seguimiento Universidad de Navarra (SUN) cohort. Am J Clin Nutr 92, 1484-1493. 3. Romaguera D, Norat T, Mouw T, May AM, Bamia C, Slimani N, Travier N, Besson H, Luan J, Wareham N, Rinaldi S, Couto E, Clavel-Chapelon F, Boutron-Ruault MC, Cottet V, Palli D, Agnoli C, Panico S, Tumino R, Vineis P, Agudo A, Rodriguez L, Sanchez MJ, Amiano P, Barricarte A, Huerta JM, Key TJ, Spencer EA, Bueno-deMesquita HB, Buchner FL et al. (2009) Adherence to the Mediterranean diet is associated with lower abdominal adiposity in European men and women. J Nutr 139, 1728-1737. 4. Berger JS, Roncaglioni MC, Avanzini F, Pangrazzi I, Tognoni G & Brown DL (2006) Aspirin for the primary prevention of cardiovascular events in women and men: a sexspecific meta-analysis of randomized controlled trials. JAMA 295, 306-313. 5. Boersma E, Harrington RA, Moliterno DJ, White H, Theroux P, Van de Werf F, de Torbal A, Armstrong PW, Wallentin LC, Wilcox RG, Simes J, Califf RM, Topol EJ & Simoons ML (2002) Platelet glycoprotein IIb/IIIa inhibitors in acute coronary syndromes: a meta-analysis of all major randomised clinical trials. Lancet 359, 189198. 6. Canadian Institutes of Health Research-Institute of Gender and Health (2012) What a Difference Sex and Gender Make? Canada. Available at: http://www.cihrirsc.gc.ca/e/44734.html 7. Bedard A, Riverin M, Dodin S, Corneau L & Lemieux S (2012) Sex differences in the impact of the Mediterranean diet on cardiovascular risk profile. Br J Nutr 108, 14281434. 8. Weggemans RM, Zock PL, Urgert R & Katan MB (1999) Differences between men and women in the response of serum cholesterol to dietary changes. Eur J Clin Invest. 29, 827-834. 114 9. Li Z, Otvos JD, Lamon-Fava S, Carrasco WV, Lichtenstein AH, McNamara JR, Ordovas JM & Schaefer EJ (2003) Men and women differ in lipoprotein response to dietary saturated fat and cholesterol restriction. J Nutr 133, 3428-3433. 10. Bedard A, Tchernof A, Lamarche B, Corneau L, Dodin S & Lemieux S (2014) Effects of the traditional Mediterranean diet on adiponectin and leptin concentrations in men and premenopausal women: do sex differences exist? Eur J Clin Nutr 68, 561-566. 11. Knopp RH, Paramsothy P, Retzlaff BM, Fish B, Walden C, Dowdy A, Tsunehara C, Aikawa K & Cheung MC (2005) Gender differences in lipoprotein metabolism and dietary response: basis in hormonal differences and implications for cardiovascular disease. Curr.Atheroscler.Rep. 7, 472-479. 12. Zazpe I, Estruch R, Toledo E, Sanchez-Tainta A, Corella D, Bullo M, Fiol M, Iglesias P, Gomez-Gracia E, Aros F, Ros E, Schroder H, Serra-Majem L, Pinto X, LamuelaRaventos R, Ruiz-Gutierrez V & Martinez-Gonzalez MA (2010) Predictors of adherence to a Mediterranean-type diet in the PREDIMED trial. Eur J Nutr 49, 91-99. 13. Bemelmans WJ, Broer J, de Vries JH, Hulshof KF, May JF & Meyboom-De Jong B (2000) Impact of Mediterranean diet education versus posted leaflet on dietary habits and serum cholesterol in a high risk population for cardiovascular disease. Public Health Nutr 3, 273-283. 14. Welsh EM, Jeffery RW, Levy RL, Langer SL, Flood AP, Jaeb MA & Laqua PS (2012) Measuring perceived barriers to healthful eating in obese, treatment-seeking adults. J Nutr Educ Behav 44, 507-512. 15. Harmon G, Lefante J & Krousel-Wood M (2006) Overcoming barriers: the role of providers in improving patient adherence to antihypertensive medications. Current Opinion in Cardiology 21, 310-315. 16. Verstuyf J, Patrick H, Vansteenkiste M & Teixeira PJ (2012) Motivational dynamics of eating regulation: a self-determination theory perspective. Int J Behav Nutr Phys Act 9, 21. 17. Landgren BM, Collins A, Csemiczky G, Burger HG, Baksheev L & Robertson DM (2004) Menopause transition: Annual changes in serum hormonal patterns over the menstrual cycle in women during a nine-year period prior to menopause. J Clin Endocrinol. Metab. 89, 2763-2769. 18. Grundy SM, Cleeman JI, Merz CN, Brewer HB, Jr., Clark LT, Hunninghake DB, Pasternak RC, Smith SC, Jr. & Stone NJ (2004) Implications of recent clinical trials for the National Cholesterol Education Program Adult Treatment Panel III Guidelines. J Am Coll. Cardiol. 44, 720-732. 115 19. NCEP ATP III (2002) Third Report of the National Cholesterol Education Program (NCEP) Expert Panel on Detection, Evaluation, and Treatment of High Blood Cholesterol in Adults (Adult Treatment Panel III) final report. Circulation 106, 31433421. 20. International Diabetes Federation (2006) IDF worldwide definition of the metabolic syndrome. Available at: http://www.idf.org/webdata/docs/MetS_def_update2006.pdf (Accessed on 12 July 2013). 21. Goulet J, Lamarche B, Nadeau G & Lemieux S (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis. 170, 115-124. 22. Ryan RM & Deci EL (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol 55, 68-78. 23. Goulet J, Nadeau G, Lapointe A, Lamarche B & Lemieux S (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J 3, 13. 24. Lohman T, Roche A & Artorel R (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. 25. Friedewald WT, Levy RI & Fredrickson DS (1972) Estimation of the concentration of low-density lipoprotein cholesterol in plasma, without use of the preparative ultracentrifuge. Clin Chem 18, 499-502. 26. Dansinger ML, Gleason JA, Griffith JL, Selker HP & Schaefer EJ (2005) Comparison of the Atkins, Ornish, Weight Watchers, and Zone diets for weight loss and heart disease risk reduction: a randomized trial. JAMA 293, 43-53. 27. Rolls BJ, Roe LS & Meengs JS (2006) Reductions in portion size and energy density of foods are additive and lead to sustained decreases in energy intake. Am J Clin Nutr 83, 11-17. 28. Kristal AR, Hedderson MM, Patterson RE & Neuhouser M (2001) Predictors of selfinitiated, healthful dietary change. J Am Diet Assoc 101, 762-766. 29. Lynch DJ, Repka FJ, Nagel R, Birk T, Gohara A, Leighton RF, Walsh ME & Weaver M (2000) Prediction of dietary adherence in cholesterol reduction: Relative contribution of personality variables and health attitudes. Psychol Health 15, 821-828. 30. Panagiotakos DB, Pitsavos C & Stefanadis C (2006) Dietary patterns: a Mediterranean diet score and its relation to clinical and biological markers of cardiovascular disease risk. Nutr Metab Cardiovasc Dis 16, 559-568. 116 31. Schroder H, Marrugat J, Vila J, Covas MI & Elosua R (2004) Adherence to the traditional mediterranean diet is inversely associated with body mass index and obesity in a spanish population. J Nutr 134, 3355-3361. 32. Garaulet M & Perez de HF (2010) Behavioural therapy in the treatment of obesity (II): role of the Mediterranean diet. Nutr Hosp. 25, 9-17. 33. Rolls BJ, Ello-Martin JA & Tohill BC (2004) What can intervention studies tell us about the relationship between fruit and vegetable consumption and weight management? Nutr Rev 62, 1-17. 34. Goulet J, Lapointe A, Lamarche B & Lemieux S (2007) Effect of a nutritional intervention promoting the Mediterranean food pattern on anthropometric profile in healthy women from the Quebec city metropolitan area. Eur J Clin Nutr 61, 12931300. 35. Schroder H (2007) Protective mechanisms of the Mediterranean diet in obesity and type 2 diabetes. J Nutr Biochem 18, 149-160. 36. Garriguet D (2009) Diet quality in Canada. Health Rep 20, 41-52. 37. Martins RK & McNeil DW (2009) Review of Motivational Interviewing in promoting health behaviors. Clin.Psychol Rev. 29, 283-293. 117 )LJXUH'HVFULSWLRQRIWKHZHHNQXWULWLRQDOLQWHUYHQWLRQSURJUDPDQGPHDVXUHPHQWVSHUIRUPHGDWEDVHOLQHWLPH DQGDIWHU WKHHQGRIWKHLQWHUYHQWLRQWLPH ZHHNV Table 1. Baseline characteristics of men and women Men (n=64) Mean SD 41·0 7·9 30·8 4·4 26·7 4·5 106·1 10·2 3·6 0·7 1·1 0·2 5·1 1·0 1·9 0·9 5·3 0·5 Women (n=59) Mean SD 41·8 6·7 29·6* 6·0 39·2* 6·2 95·8* 11·5 3·6 0·7 1·4* 0·3 4·2* 0·9 1·5* 0·6 5·2 0·7 Age (years) Body mass index (kg/m2) Body fat (%) ¥ Waist circumference (cm) LDL-C (mmol/l) HDL-C (mmol/l) Total-C/HDL-C ratio Triacylglycerols (mmol/l) Fasting glucose (mmol/l) SD, Standard deviation. * Mean values were significantly different between men and women (P ≤ 0·05, Student's t-test). ¥ n = 52 for men and n = 48 for women because of missing values. For metabolic variables n = 63 for men and n = 58 for women because of missing values. 120 Table 2. Dietary intakes, Medscore and food group intakes at baseline and after the 12-week nutritional intervention program (Mean values and 95% confidence intervals) Men Variables Dietary intakes Energy intake (kJ) Energy density (kJ/g) £ % Carbohydrates Total dietary fibers (g) % Proteins % Lipids % MUFA % PUFA % SFA % Trans % Alcohol Mediterranean score and food groups Medscore (arbitrary units) Olives (portions/d) Rapeseed oil (portions/d) Vegetables (portions/d) Vegetable juices (portions/d) Legumes, nuts and seeds (portions/d) Whole grain products (portions/d) Refined grain products (portions/d) Milk and dairy products (portions/d) T=0 (n=64) 95% CI Women T=12 (n=57) 95% CI T=0 (n=59) 95% CI (n=51) T=12 95% CI 12 824 5·52 42·2 27·2 18·3 36·8 15·5 6·2 12·2 1·4 2·7 11887, 13761 5·27, 5·77 40·9, 43·5 24·8, 29·5 17·7, 19·0 35·6, 38·0 14·8, 16·2 5·9, 6·6 11·5, 12·9 1·3, 1·5 2·1, 3·3 11 581 5·06 44·1 32·8 18·4 34·6 15·1 6·8 10·1 1·1 2·9 10791, 12372 4·81, 5·31 42·5, 45·6 30·0, 35·7 17·6, 19·1 33·2, 36·0 14·3, 15·9 6·4, 7·2 9·4, 10·7 1·0, 1·2 2·2, 3·6 10 280* 5·06* 44·5* 25·6 17·8 35·1* 14·6¶ 5·9 11·8 1·3* 2·7 9657, 10904 4·90, 5·23 43·0, 46·0 23·9, 27·2 17·0, 18·5 33·9, 36·2 13·9, 15·3 5·5, 6·2 11·4, 12·2 1·2, 1·3 2·1, 3·2 9770 4·98 44·8 28·1 17·9 34·6 15·1 6·3 10·5 1·1 2·7 9150, 10389 4·77, 5·19 43·2, 46·3 26·0, 30·2 17·1, 18·7 33·1, 36·1 14·1, 16·0 5·9, 6·7 10·0, 11·1 1·0, 1·2 2·1, 3·3 22·7 1·1 0·2 3·8 0·3 1·3 3·2 3·3 3·1 21·6, 23·8 0·7, 1·4 0·1, 0·3 3·4, 4·3 0·2, 0·4 0·9, 1·6 2·8, 3·6 2·8, 3·7 2·6, 3·6 27·6 1·5 0·2 4·3 0·3 1·9 3·7 1·9 2·8 26·4, 28·9 1·2, 1·8 0·1, 0·3 3·8, 4·9 0·2, 0·4 1·6, 2·3 3·3, 4·1 1·6, 2·2 2·3, 3·3 24·1¶ 1·0 0·2 4·3 0·3 0·8* 2·3* 2·7¶ 2·6¶ 23·1, 25·0 0·7, 1·2 0·1, 0·2 3·9, 4·6 0·2, 0·4 0·7, 1·0 1·9, 2·8 2·3, 3·1 2·3, 2·9 27·2 1·6 0·2 4·3 0·2 1·2 2·9 1·9 2·4 25·8, 28·6 1·1, 2·1 0·1, 0·3 3·9, 4·8 0·1, 0·4 1·0, 1·4 2·5, 3·2 1·6, 2·3 2·1, 2·7 121 Table 2. Dietary intakes, Medscore and food group intakes at baseline and after the 12-week nutritional intervention program (continued) Men Variables T=0 (n=64) 95% CI Women T=12 (n=57) 95% CI T=0 (n=59) 95% CI Mediterranean score and food groups Fruits (portions/d) 1·7 1·4, 2·1 2·6 2·1, 3·2 2·5* Fruit juices (portions/d) 1·5 1·1, 1·8 1·3 1·0, 1·6 1·1¶ Poultry (portions/d) 0·9 0·7, 1·1 0·8 0·6, 0·9 0·7* Fish and seafood (portions/d) 0·6 0·5, 0·8 1·1 0·9, 1·3 0·5 Red meat/processed meat (portions/d) 1·7 1·4, 1·9 0·8 0·7, 0·9 1·1* Eggs (portions/d) 0·5 0·4, 0·5 0·5 0·4, 0·6 0·3* Sweets (portions/d) 2·0 0·8, 3·2 1·0 0·6, 1·5 1·3 * Mean value was significantly different from that for men at baseline (P ≤ 0·05, Student's t-test). ¶ Mean value was marginally significantly different from that for men at baseline (P ≤ 0·10, Student's t-test). £ Including energy-containing foods and drinks drinks. 122 2·1, 2·8 0·8, 1·4 0·6, 0·8 0·4, 0·7 1·0, 1·3 0·3, 0·4 1·0, 1·7 (n=51) T=12 95% CI 2·6 1·0 0·6 0·9 0·7 0·3 0·9 2·2, 3·0 0·7, 1·4 0·5, 0·7 0·7, 1·0 0·6, 0·8 0·2, 0·4 0·7, 1·2 Table 3. Changes in dietary intakes, Medscore and food group intakes in response to the 12-week nutritional intervention program Variables Δ 0-12 weeks Dietary intakes Energy intake (kJ) -1151 Energy density (kJ/g) £ * -0·54 % Carbohydrates 2·2 Total dietary fibers (g) 5·9 % Proteins 0·06 % Lipids -2·5 % MUFA -0·5 % PUFA 0·5 % SFA -2·2 % Trans * -0·3 % Alcohol 0·3 Mediterranean score and food groups Medscore (arbitrary units) 4·9 Olives (portions/d) 0·4 Rapeseed oil (portions/d) * § 0·02 Vegetables (portions/d) 0·6 Vegetable juices (portions/d) 0·02 Legumes, nuts and seeds 0·6 (portions/d) Men Women (n=57) % Change Men vs. women differences Men vs. women differences adjusted for baseline value P Mean (95% CI) Mean (95% CI) P Δ 0-12 weeks (n=51) % Change -9·0 -9·8 5·2 21·7 0·3 -6·8 -3·2 8·1 -18·0 -21·4 11·1 0·004 < 0·0001 0·008 < 0·0001 0·88 0·001 0·24 0·04 < 0·0001 < 0·0001 0·33 -607 -0·08 -0·05 2·6 0·2 -0·3 0·5 0·5 -1·2 -0·1 0·1 -5·9 -1·6 -0·1 10·2 1·1 -0·9 3·4 8·5 -10·2 -7·7 3·7 0·14 0·58 0·96 0·02 0·63 0·72 0·36 0·04 0·0002 0·03 0·61 -544 (-1660, 573) -0·1 (-0·2, -0·02) † 2·2 (-0·1, 4·6) 3·4 (0·4, 6·3) † -0·1 (-1·3, 1·0) -2·2 (-4·4, -0·02) † -1·0 (-2·4, 0·4) -0·04 (-0·7, 0·7) -1·0 (-1·9, -0·2) † -0·2 (-0·4, -0·02) † 0·1 (-0·6, 0·9) 821 (-123, 1765) -0·03 (-0·1, 0·04) 0·5 (-1·6, 2·6) 3·8 (0·9, 6·6) 0·2 (-0·8, 1·2) -0·8 (-2·8, 1·1) -0·3 (-1·5, 0·9) 0·3 (-0·2, 0·9) -0·8 (-1·5, -0·05) -0·09 (-0·2, 0·07) 0·1 (-0·6, 0·8) 21·6 36·4 10·0 15·8 6·7 < 0·0001 0·08 0·75 0·02 0·70 3·2 0·6 0·04 0·06 -0·02 13·3 60·0 20·0 1·4 -6·7 < 0·0001 0·02 0·54 0·85 0·78 1·7 (-0·3, 3·7) -0·2 (-0·8, 0·5) -0·02 (-0·2, 0·1) 0·6 (-0·2, 1·4) 0·04 (-0·1, 0·2) 0·8 (-0·9, 2·6) -0·1 (-0·6, 0·4) 0·006 (-0·1, 0·1) 0·2 (-0·4, 0·9) 0·05 (-0·1, 0·2) 46·2 0·0001 0·4 50·0 0·03 0·3 (-0·2, 0·7) 0·6 (0·2, 1·0) 123 Table 3. Changes in dietary intakes, Medscore and food group intakes in response to the 12-week nutritional intervention program (continued) Men vs. women Men vs. differences Men Women women adjusted for differences baseline value (n=57) (n=51) Δ 0-12 % Δ 0-12 % Variables P P Mean (95% CI) Mean (95% CI) weeks Change weeks Change Mediterranean score and food groups Whole grain products (portions/d) 0·5 15·6 0·03 0·5 21·7 0·02 -0·06 (-0·6, 0·5) 0·5 (0·01, 1·0) Refined grain products (portions/d) * § -1·3 -39·4 < 0·0001 -0·8 -29·6 0·0009 -0·5 (-1·1, 0·2) -0·2 (-0·6, 0·3) Milk and dairy products (portions/d) -0·2 -6·5 0·39 -0·1 -3·8 0·54 -0·05 (-0·7, 0·6) 0·2 (-0·3, 0·7) Fruits (portions/d) 1·0 58·8 0·0001 0·09 3·6 0·74 0·9 (0·2, 1·6) † 0·4 (-0·3, 1·1) Fruit juices (portions/d) -0·2 -13·3 0·29 -0·1 -9·1 0·50 -0·05 (-0·5, 0·4) 0·08 (-0·3, 0·5) Poultry (portions/d) -0·08 -8·9 0·27 -0·1 -14·5 0·20 0·02 (-0·2, 0·2) 0·1 (-0·04, 0·3) Fish and seafood (portions/d) 0·4 66·7 < 0·0001 0·3 60·0 0·0004 0·1 (-0·2, 0·3) 0·1 (-0·1, 0·4) Red meat/processed meat (portions/d) -0·9 -52·9 < 0·0001 -0·5 -45·5 < 0·0001 -0·4 (-0·7, -0·1) † -0·03 (-0·2, 0·2) Eggs (portions/d) -0·004 -0·8 0·93 -0·03 -10·0 0·52 0·03 (-0·1, 0·2) 0·1 (-0·01, 0·2) Sweets (portions/d) * § -1·0 -50·0 0·05 -0·4 -30·8 0·46 -0·6 (-2·1, 0·9) -0·03 (-0·6, 0·5) Δ 0-12 weeks, Change following the 12-week nutritional intervention program. * P ≤ 0·05, Significant interaction between gender and baseline value. † P ≤ 0·05, Significant differences in men vs. women between 0-12 weeks without adjustment for the baseline value. £ Including energy-containing foods and drinks drinks. § Analysis was performed on transformed values. 124 Table 4. Anthropometric and metabolic variables at baseline (time = 0) and after the 12-week nutritional intervention program (time = 12)* (Mean values and 95% confidence intervals) Men Variables T=0 (n=64) 95% CI (n=57) T=12 95% CI Women (n=59) T=0 95% CI (n=51) T=12 95% CI Body weight (kg) 96·6 92·7, 100,5 95·2 91·4, 99·0 77·9 73·5, 82·2 77·2 72·4, 82·0 Body mass index (kg/m2) 30·8 29·7, 31·9 30·2 29·2, 31·3 29·6 28·0, 31·2 29·4 27·7, 31·1 Body fat (%) † 26·7 25·4, 27·9 25·6 24·2, 26·9 39·2 37·4, 41·0 39·2 37·1, 41·2 Waist circumference (cm) 106·1 103·6, 108·7 104·2 101·7, 106·7 95·8 92·9, 98·8 94·5 91·0, 98·1 HDL-C (mmol/l) ‡ 1·1 1·1, 1·2 1·2 1·1, 1·3 1·4 1·4, 1·5 1·4 1·4, 1·5 LDL-C (mmol/l) ‡ 3·6 3·5, 3·8 3·7 3·5, 3·9 3·6 3·5, 3·8 3·6 3·4, 3·8 Apo-B (g/l) ‡ 1·2 1·1, 1·2 1·2 1·1, 1·2 1·1 1·1, 1·2 1·1 1·1, 1·2 Total-C/HDL-C ratio ‡ 5·1 4·8, 5·3 4·9 4·6, 5·1 4·2 3·9, 4·4 4·1 3·8, 4·3 Triacylglycerols (mmol/l) ‡ 1·9 1·7, 2·1 1·6 1·4, 1·8 1·5 1·3, 1·6 1·4 1·2, 1·5 Triacylglycerols/HDL-C ratio ‡ 1·8 1·5, 2·0 1·4 1·2, 1·6 1·1 1·0, 1·2 1·0 0·9, 1·1 Systolic blood pressure (mm Hg) ‡ 119·8 116·1, 123·4 119·3 116·5, 122·1 109·2 106·3, 112·1 109·5 106·2, 112·8 Diastolic blood pressure (mm Hg) ‡ 75·6 73·2, 78·0 72·4 70·2, 74·7 70·8 68·7, 72·8 68·9 66·6, 71·2 Fasting glucose (mmol/l) ‡ 5·3 5·1, 5·4 5·3 5·2, 5·4 5·2 5·0, 5·3 5·2 5·0, 5·4 Fasting insulin (pmol/l) ‡ 100·5 89·1, 111·8 98·9 87·2, 110·7 88·5 76·6, 100·5 88·2 76·9, 99·5 HDL-C, HDL-Cholesterol; LDL-C, LDL-Cholesterol; total-C, total cholesterol. * All anthropometric and metabolic variables were significantly different between men and women at baseline (time = 0), except for LDL-C, Apo-B, systolic and diastolic blood pressure, fasting glucose and insulin (P ≤ 0·05). † Men (n = 52) and women (n = 48) because of missing values. ‡ Metabolic variables men (n = 63) and women (n = 58) because of missing values. 125 Table 5. Changes in anthropometric and metabolic variables in response to the 12-week nutritional intervention program Men Women Men vs. women differences Men vs. women differences adjusted for baseline value (n=57) (n=51) Δ 0-12 % Δ 0-12 % Variables P P Mean (95% CI) Mean (95% CI) weeks Change weeks Change Body weight (kg) -1·0 -1·0 0·0003 -0·6 -0·8 0·06 -0·5 (-1·3, 0·3) -0·6 (-1·6, 0·3) Body mass index (kg/m2) -0·3 -1·0 0·0004 -0·2 -0·7 0·03 -0·1 (-0·4, 0·1) -0·1 (-0·4, 0·1) Body fat (%) ¥ -0·7 -2·6 0·003 -0·2 -0·5 0·31 -0·4 (-1·0, 0·2) -0·4 (-1·4, 0·6) Waist circumference (cm) -1·3 -1·2 0·01 -1·1 -1·1 0·04 -0·2 (-1·7, 1·3) 0·02 (-1·7, 1·7) HDL-C (mmol/l) 0·05 4·5 0·005 0·01 0·7 0·42 0·04 (-0·01, 0·08) 0·007 (-0·05, 0·06) LDL-C (mmol/l) -0·03 -0·8 0·62 -0·06 -1·7 0·43 0·02 (-0·2, 0·2) 0·05 (-0·1, 0·2) Apo-B (g/l) -0·02 -1·7 0·33 -0·01 -0·9 0·58 -0·007 (-0·05, 0·04) 0·002 (-0·04, 0·05) Total-C/HDL-C ratio -0·3 -5·9 < 0·0001 -0·1 -2·4 0·13 -0·2 (-0·4, -0·03) † -0·08 (-0·3, 0·1) Triacylglycerols (mmol/l) * § -0·3 -15·8 0·0002 -0·09 -6·0 0·20 -0·2 (-0·4, 0·03) 0·01 (-0·2, 0·2) Triacylglycerols/HDL-C ratio * § -0·3 -16·7 < 0·0001 -0·08 -7·3 0·26 -0·2 (-0·4, -0·04) † 0·03 (-0·1, 0·2) Systolic blood pressure (mm Hg) 1·0 0·8 0·41 0·4 0·4 0·74 0·6 (-3·0, 4·2) 3·9 (0·5, 7·4) Diastolic blood pressure (mm Hg) -2·4 -3·2 0·01 -1·6 -2·3 0·10 -0·8 (-3·3, 1·8) 0·6 (-1·9, 3·1) Fasting glucose (mmol/l) * § 0·04 0·8 0·56 0·04 0·8 0·50 -0·007 (-0·2, 0·2) 0·02 (-0·1, 0·2) Fasting insulin (pmol/l) -1·6 -1·6 0·61 0·4 0·5 0·91 -2·0 (-11·2, 7·1) 0·3 (-8·3, 8·8) Δ 0-12 weeks, Change following the 12-week nutritional intervention program; HDL-C, HDL-Cholesterol; LDL-C, LDL-Cholesterol; total-C, total cholesterol. * P ≤ 0·05, Significant interaction between gender and baseline value. † P ≤ 0·05, Significant differences in men vs. women between 0-12 weeks without adjustment for the baseline value. § Analysis was performed on transformed values. 126 CHAPITRE 5 : Différences relatives au genre dans les effets à long terme d’un programme d’intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne : changements dans les apports et comportements alimentaires, ainsi que dans les variables anthropométriques et métaboliques Vicky Leblanc, Catherine Bégin, Anne-Marie Hudon, Marie-Michelle Royer, Louise Corneau, Sylvie Dodin, Simone Lemieux Nutrition Journal, 2014 Nov 22;13 :107. 127 Gender differences in the long-term effects of a nutritional intervention program promoting the Mediterranean diet: Changes in dietary intakes, eating behaviors, anthropometric and metabolic variables Vicky Leblanc1, Catherine Bégin2, Anne-Marie Hudon1, Marie-Michelle Royer1, Louise Corneau1, Sylvie Dodin1,3, and Simone Lemieux1. 1 Institute of Nutrition and Functional Foods, Laval University, 2440 Hochelaga Blvd, Québec, Canada, G1V 0A6 2 School of Psychology, Laval University, Pavillon Félix-Antoine Savard, 2325 rue des Bibliothèques, Québec, Canada, G1V 0A6 3 Department of Obstetric and Gynaecology, Laval University, Pavillon Ferdinand- Vandry, 1050 Medicine Avenue, Québec, Canada, G1V 0A6 Address of correspondence: Simone Lemieux, Ph.D, RD. Institute of Nutrition and Functional Foods 2440 Hochelaga Blvd Laval University, Québec Québec, Canada, G1V 0A6 Phone: (418) 656-2131 ext.: 3637 Fax: (418) 656-5877 E-mail: [email protected] (can be published) Keywords : Gender differences, Mediterranean diet, Cardiovascular risk, long-term dietary changes. Abbreviations: MedDiet, Mediterranean diet; CVD, Cardiovascular diseases; SDT, Self-Determination Theory; C, Cholesterol; FSH, Follicle-stimulating hormone; Medscore, Mediterranean score; MI, Motivational interviewing; FFQ, Food frequency questionnaire; BMI, Body mass index; TFEQ, Three-Factor Eating Questionnaire. 129 RÉSUMÉ Cette étude visait à déterminer les différences de genre dans les effets d’une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne et basée sur la théorie de l’autodétermination sur les apports et comportements alimentaires, ainsi que sur les variables anthropométriques et métaboliques à long terme. Soixantequatre hommes et 59 femmes préménopausées à risque de maladies cardiovasculaires ont pris part à l’intervention de 12 semaines. Les apports alimentaires ont été évalués via un questionnaire de fréquence, à partir duquel un score méditerranéen a été calculé. Le Three-Factor Eating Questionnaire a permis d’évaluer les comportements alimentaires. Aucune différence de genre n’a été notée dans les changements du score méditerranéen à long terme. Les hommes ont diminué leur consommation de viandes rouges et augmenté leur consommation de fruits entiers de façon plus importante que les femmes. Une diminution plus prononcée de la susceptibilité habituelle à la désinhibition a été observée chez les hommes. Une interaction genre par temps a été notée pour la circonférence de la taille alors que des changements métaboliques (ratio C-total sur CHDL, triglycérides) plus importants ont été mesurés chez les hommes. Ces résultats suggèrent que l’intervention a engendré des bienfaits plus prononcés à long terme dans les apports alimentaires et sur le profil métabolique des hommes comparativement aux femmes. 131 ABSTRACT Long-term adherence to principles of the Mediterranean diet (MedDiet) following a nutritional intervention promoting the Mediterranean food pattern in Canadian men and women is not known. Moreover, gender differences in dietary and metabolic profile in such an intervention context has never been addressed. Objective was to determine gender differences in long-term effects of a 12-week nutritional intervention program promoting the adoption of the MedDiet and based on the Self-Determination Theory (SDT) on dietary intakes, eating behaviors, anthropometric and metabolic variables, in men and women presenting cardiovascular risk factors. Sixty-four men and 59 premenopausal women were recruited. The 12-week nutritional program used a motivational interviewing approach and included individual and group sessions. A food frequency questionnaire was administered to evaluate dietary intakes from which a Mediterranean score (Medscore) was derived and the Three-Factor Eating Questionnaire allowed assessment of eating behaviors. Measurements were performed at baseline and after the 12-week nutritional intervention, and then at 3 and 6-month post intervention. No gender difference was observed in changes in the Medscore during the nutritional intervention and follow-up. However, the Medscore returned towards baseline values during follow-up in men and women (P < 0.0001). Men reported larger decreases in red and processed meat and larger increases in whole fruit intakes than women (for both, P = 0.03). Men showed a greater decrease in habitual susceptibility to disinhibition than women (P =0.03 and P =0.04, respectively). A gender by time interaction was found for waist circumference, i.e. men had lower waist circumference at the end of the intervention as well as at follow-up than at baseline while women’s waist circumference decreased in response to the intervention only (P = 0.05). As for metabolic variables, changes observed in total-cholesterol (C) to HDL-C ratio, triglyceride levels and triglycerides to HDL-C ratio were more pronounced in men than in women after the intervention as well as at follow-up (P ≤ 0.01). Our results indicate that the 12-week nutritional intervention based on the SDT leads to more pronounced beneficial changes in long-term dietary intakes in men than in women and to greater improvements in metabolic profile in men. 133 INTRODUCTION Evidence of the benefits of the Mediterranean diet (MedDiet) on health is now well established in the literature. Indeed, the MedDiet is recognized as one of the best models of health food patterns providing protection against chronic diseases, such as cardiovascular diseases (CVD) and cancer (1, 2). Accordingly, high level of adherence to the MedDiet has been reported to be negatively associated with several cardiovascular risk factors although heterogeneity related to demographic characteristics (i.e., country, gender, socio-cultural status) has been observed (3). Changing dietary habits represents a major challenge for many people (4, 5) . In this regard, although adherence to the MedDiet is beneficial for CVD prevention (5, 6) , previous studies reported difficulties regarding maintenance of the MedDiet principles (5, 7) . Evidence suggests favourable diet adherence outcomes in the context of different intervention settings lasting over a 12-month period (8) and including sustained support to individuals in the long term (e.g., information, individual or group sessions) (9, 10) . These results therefore indicate the relevance of providing long-term support to individuals. However, according to actual public health priorities in Canada (11) , long- term nutritional support, which requires several professional and financial resources, remains unrealistic to address CVD prevention at a population level. In this context, nutritional interventions supporting autonomy and competency of individuals, in agreement with the Self-Determination Theory (SDT) which emphasizes the importance of motivation quality and self-determined forms of motivation towards behavior change (12) , are relevant. Beyond intervention modalities, a variety of individual factors have been proposed to influence the ability to maintain dietary changes. In fact, individual preferences in food selection, preparation and consumption, variables related to socioeconomic and education levels and lifestyle factors such as the degree of engagement in physical activity have been suggested to play a role in the ability to maintain dietary changes in the longer term (13, 14) . Moreover, previous studies have identified gender as a key determinant of food choices. This can be explained by differences between men and 135 women in attitudes, beliefs and motivation towards healthy eating and also in their awareness of diet and health issues (15-17) , which can possibly influence level of adherence to dietary recommendations. In the context of the MedDiet, a higher success in improving adherence to the MedDiet was observed among men than women after one year of follow-up in the PREDIMED trial, which includes Spanish men and women presenting high risk for CVD (9) . On the other hand, a study measuring the impact of a MedDiet education program in hypercholesterolemic men and women from the Netherlands showed that whereas women improved their dietary intakes in accordance with the education program and significantly decreased their total-cholesterol (C) levels, no such change was observed in men (5) . These differences between men and women suggest that the process of sustaining dietary changes following a nutritional intervention promoting the adoption of the MedDiet could be influenced by gender, whether or not individuals come from Mediterranean regions. The feasibility of adopting and maintaining the MedDiet has been reported in Canadian women (18), but no data are available for Canadian men. Evidence also indicates that the impact of adhering to dietary recommendations on anthropometric and metabolic profiles can be modulated by sex and gender differences. Indeed, metabolic changes in response to modification in dietary intakes can be explained in part by sex differences, which essentially refer to biological and physiological characteristics that distinguish males from females (19) , such as sex hormones. Accordingly, a study published by our team showed improvement in insulin homeostasis (i.e. insulin concentrations 2 hours after an oral administration of 75 g of glucose) in men but not in women, in response to a 4-week MedDiet provided in the context of a controlled study where all food and drinks were provided to participants in isoenergetic conditions (20). On the other hand, gender differences previously reported in eating behaviors (e.g., in dietary restraint and disinhibition levels) through its association with dietary intakes (22) (21) could influence, , the level of adherence to dietary recommendations in men and women and therefore could also influence long-term changes in anthropometric and metabolic variables. Overall, although the adoption of the MedDiet is recognized for its benefits on metabolic profile, the long-term adherence to principles of the MedDiet following a 136 nutritional intervention program promoting the Mediterranean food pattern in Canadian men and women is not known. Moreover, gender differences in dietary intakes, eating behaviors, anthropometric variables and metabolic profile in such an intervention context have never been addressed. The objective of this study was therefore to determine gender differences in long-term effects of a 12-week nutritional intervention program promoting the adoption of the MedDiet and based on the SDT on dietary intakes, eating behaviors, anthropometric and metabolic variables, in Canadian men and women presenting with risk factors for CVD. METHODOLOGY Participants This study was conducted among a sample of 64 men and 59 premenopausal women aged between 25 and 50 years old, and recruited through different media advertisements in the Québec City Metropolitan area, Canada. In women, a follicle-stimulating hormone (FSH) measurement was performed if needed (e.g., when women presented periods irregularities) to confirm the premenopausal status (FSH <20 IU/l) (23). Men and women had to present slightly elevated LDL-C concentrations (between 3.0 and 4.9 mmol/l) (24) or a total-C to HDL-C ratio ≥5.0, and at least one of the four following criteria of the metabolic syndrome (25) : 1) triglyceride concentrations ≥1.7 mmol/l; 2) fasting glycaemia between 6.1 et 6.9 mmol/l; 3) blood pressure concentrations ≥130/85 mm Hg; 4) waist circumference ≥80 cm in women and ≥94 cm in men (26) . Participants also had to have a stable body weight (±2.5 kg) for a minimum of three months prior to the beginning of the study and to be implicated in food purchases and/or preparation at home. We excluded men and women who had cardiovascular events and who used medication that could affect dependent variables under study. Pregnant women, smokers, participants with an alcoholism history or with a high Mediterranean score (Medscore >29, i.e. food pattern already highly concordant with the MedDiet) (6) were also excluded. All subjects voluntarily agreed to participate in the research project and written informed consent was obtained from all men and women prior to their 137 participation in the study. This study was approved by the Laval University Research Ethics Committee. Study Design The 12-week nutritional program was based on the Self-Determination Theory (SDT) and used a motivational interviewing (MI) approach. Briefly, the study was conducted in five phases (from January 2010 to November 2012) and the nutritional intervention included three group sessions (10–15 individuals / session), three individual sessions and four follow-up phone calls with a registered dietitian (Figure 1). Three registered dietitians were trained to provide a standardized intervention and participants always met with the same dietitian during individual sessions. The first group session was a lecture, provided by the same dietitian in all groups, and aimed at explaining principles of the traditional MedDiet. The second group session was a Mediterranean cooking lesson during which men and women had to cook a Mediterranean meal. Then, during the third group session participants had to share a Mediterranean potluck dinner aimed at discussing barriers in adopting dietary recommendations which occurred during the intervention. Individual counselling took place at weeks one, five and 10 and lasted between 45 minutes and one hour for each appointment. Individual follow-up phone calls took place at weeks three, six, nine and 12, and lasted for about 20–30 minutes for each phone call. The main objective of individual counselling and follow-up phone calls was to assess dietary changes and to determine progressive personal goals aimed at improving the adherence to MedDiet principles. Different tools congruent with the MI approach were used during the individual sessions to formulate dietary objectives while increasing self-determined motivation. Moreover, in accordance with the SDT (12), basic psychological needs (i.e. autonomy, competence and relatedness) were supported during the nutritional intervention via the MI approach in order to increase self-determined motivation. Briefly, the dietitian had a client-centered approach, put no pressure on participants about the dietary objectives to be chosen and no emphasis was put on body weight control. Men and women were encouraged to maintain dietary changes in an autonomous way at the end of the nutritional program and there was no additional contact with the dietitian after the end of the 12-week intervention. However, men and 138 women were invited to participate to the follow-up period for measurements of anthropometric and metabolic parameters and completion of questionnaires. This clinical trial was registered at www.clinicaltrials.gov as NCT01852721. Measurements of dependent variables All measurements were performed before (t =0) and after the 12-week nutritional intervention program (t =3 months), and then 3 and 6 months after the end of the nutritional intervention (t =6 months and t = 9 months, respectively). Dietary variables A validated food frequency questionnaire (FFQ) (27) was administered by a registered dietitian. The FFQ is based on typical foods available in Québec and contains 91 items and 33 subquestions. Participants were questioned about the frequency of intake of different foods and drinks during the last month and could report the frequency of these intakes in terms of day, week or month. As previously described (6) , the Medscore was calculated based on the FFQ and allowed to assess the level of adherence to the Mediterranean food pattern, which can vary between 0 and 44 points. Components of the Medscore are: grains (whole and refined); fruits (whole and juices); vegetables (whole and juices); legumes, nuts and seeds; olive oil (including olives); dairy products; fish (including seafoods); poultry; eggs; sweets and red meat/processed meat. Briefly, a high consumption of food groups promoted by the Mediterranean diet (bottom of the pyramid) (e.g., legumes) contributed to increase the Medscore, whereas a high consumption of food groups at the top of the Mediterranean pyramid (e.g., red meat) contributed to decrease the Medscore, as previously described (6) . Macronutrient and micronutrient intakes obtained from the FFQ were evaluated using the Nutrition Data System for Research (NDS-R, version 4.03_31) software. Anthropometric and metabolic profile Height was measured to the nearest millimeter (Seca 222 Mechanical Telescopic Stadiometer), body weight was measured to the nearest 0.1 kg (BWB-800S Digital 139 scale, Tanita), and body mass index (BMI) was then calculated according to standardized procedures (28). Waist circumference measure was also taken to the nearest millimeter according to standardized procedures (28) and body fat percentage was measured using the Tanita body-fat analyser, with the accuracy level being +/− 5% of the institutional standard of body composition analysis-Dual Energy X-ray Absorptiometry (DEXA) and repeatable to within +/− 1% variation when used under consistent conditions (Tanita-BC-418 body-fat analyser (Tanita Corp., Tokyo, Japan)) (29) . Blood samples were collected after a 12-hour overnight fast. Total-C, HDL-C and triglyceride concentrations in serum were measured using commercial reagents on a Modular P chemistry analyzer (with 0.8% and 1.7% of within and between assay precision, respectively) (Roche Diagnostics, Mannheim, Germany). Serum LDL-C concentrations were obtained by calculation using the Friedewald equation (30) . Plasma glucose concentrations were measured with the hexokinase enzymatic method (with 0.7% and <1.2% of within and between assay precision, respectively) and plasma insulin concentrations by electrochimiluminescence (with <2.0% and <2.8% of within and between assay precision, respectively) (Roche Diagnostics, Mannheim, Germany). Blood pressure was measured on the right arm and using an automated blood pressure monitor (BPM 300-BpTRU: Vital Signs Monitor) after 10 minutes rest in the sitting position and was computed as a mean of three readings which were highly correlated (systolic blood pressure: 0.85 ≥ r ≤0.91, P <0.0001; diastolic blood pressure: 0.84 ≥ r ≤0.85, P <0.0001). Eating behaviors Eating behaviors were assessed by the Three-Factor Eating Questionnaire (TFEQ) (31), a 51-item validated questionnaire which assesses three factors that refer to cognitions and behaviors associated with eating: dietary restraint (conscious control of food intake with concerns about shape and weight), disinhibition (overconsumption of food in response to a variety of stimuli associated with a loss of control on food intake) and hunger (food intake in response to feelings and perceptions of hunger). More specific subscales can also be derived from these three general eating behaviors restraint, habitual susceptibility to disinhibition, (32, 33) : rigid restraint, flexible emotional susceptibility to disinhibition, situational susceptibility to disinhibition, internal hunger, and external hunger. 140 Statistical analyses Dietary intakes, eating behaviors, anthropometric and metabolic variables measured at different time points are presented in tables as means ± standard deviations. When within gender changes are presented they are expressed as percentages of change from baseline values. The Student’s t-test allowed comparisons of baseline characteristics between men and women. The Chi-Square test was performed to compare the attrition rate between men and women. The PROC MIXED procedure, which allow the inclusion of participants with missing data at some time points (34) was also performed. MIXED procedures for repeated measurements were performed to determine gender, time and gender by time interactions effects on changes in dependent variables measured (delta values). Since three different dietitians were in charge of providing the intervention, the intervener effect was also tested by a MIXED procedure. Delta values were calculated as post nutritional intervention values (post-nutritional intervention minus prenutritional intervention values) and as follow-up values at 3-month (6 months minus pre-nutritional intervention values) and 6-month post intervention (9 months minus prenutritional intervention values), respectively. Using this approach, a significant time effect means that the magnitude of the change is varying with time while a nonsignificant time effect means that changes are maintained with time. Moreover, a significant gender by time interaction means that the trajectory of changes with time is not the same in men and women. The Lsmeans procedure, which can be defined as a linear combination (sum) of the estimated effects, e.g. means, from a linear model and based on the model used, allowed determining significant changes in outcomes over time within each gender. When significant gender by time interactions were observed, simple effects between times and gender were tested to determine precisely the location of the main interaction effect. Pairwise differences between and within gender were further tested with the Tukey-Kramer adjustment. Additional analyses were performed in order to determine if gender differences in changes in dietary intakes, eating behaviors, anthropometric and metabolic variables were still significant when accounting for the baseline value. For variables not normally distributed, a transformation was performed but these variables are presented as raw data in the tables. In order to determine sample size, we considered a difference of 35% in the change in Medscore as being clinically significant, based on results of a previous study from our 141 group (6). Therefore, a final sample size of 45 men and 45 women was needed to detect a gender difference of 35% in the change in Medscore with a power of 0.80 and alpha of 0.05, considering that standard deviation corresponds to 55% of the mean of the change in Medscore. The probability level for significance used for the interpretation of all statistical analyses was set at an alpha level of P ≤0.05. All analyses were performed using SAS statistical software (version 9.2, SAS Institute Inc., Cary, NC). RESULTS Table 1 shows characteristics of men and women at baseline in terms of their age, anthropometric variables, metabolic profile and the quality of their diet as represented by the Medscore. Men and women included in our study were of similar age, but men had higher BMI, waist circumference, total-C to HDL-C ratio and triglyceride levels than women, whereas women had higher percentage of body fat and HDL-C levels than men. As for global quality of the diet at baseline, women tended to have a higher Medscore than men. Of the 64 men and 59 premenopausal women included in our study at baseline, 89%, 78% and 69% of men and 86%, 78% and 75% of women completed the 12-week nutritional intervention program, and the 3-month and 6-month post intervention follow-up visits respectively, without significant gender differences in the attrition rate at any of the three visits. Moreover, men and women who withdrew from the study presented similar characteristics at baseline to those who completed the intervention until the end of the follow-up (not shown). Changes in dietary intakes Changes in dietary intakes in men and women are presented in Table 2. At the end of the intervention (t =3 months) as well as 3-month and 6-month post intervention (t =6 months and 9 months, respectively), changes from baseline in energy density and in percentage of energy intake from lipids and carbohydrates were larger in men than in women. For these variables, changes were maintained during follow-up as no significant time effect was observed. Changes observed in dietary fiber intake and in the percentage of energy intake from saturated fatty acids were also larger in men than in women. However, for those variables, the magnitude of change decreased with time 142 (time effects; P =0.008 and P =0.0002, respectively). Moreover, although significant changes in percentage of energy intake from polyunsaturated and trans fatty acids were observed in both men and women in response to the nutritional intervention, no gender differences were observed for these variables and they progressively returned towards baseline values during follow-up (time effects; P =0.004 and P =0.05 for percentage of energy intake from polyunsaturated and trans fatty acids, respectively). No gender by time interaction was observed for nutritional intakes, meaning that trajectories of changes during the follow-up were not significantly different between men and women. As for the Medscore (Table 3), although a significant increase was observed in men and women, no gender difference was found in changes measured at the end of the nutritional intervention and at follow-up visits. However, the Medscore progressively returned towards baseline values during the follow-up in men and women as shown by the significant time effect (P <0.0001). Similarly, for olive oil and olives, legumes, nuts and seeds, and fish and seafood intakes, the magnitude of change decreased with time (time effects; P =0.01, P <0.0001 and P =0.004, respectively) in both men and women. On the other hand, gender differences were observed in red and processed meat and whole fruit intakes, for which changes were larger in men than in women. The magnitude of change also decreased with time for red and processed meat intake as indicated by the significant time effect (P =0.0002). No gender by time interaction was observed for the Medscore and its components, meaning that trajectories of changes during the follow-up were the same in men and women. Moreover, the change in Medscore was not influenced by the dietitian in charge of the intervention as indicated by the analysis of variance (P =0.68). When dietary changes were adjusted for the baseline value of the response variable (Tables 2 and 3), gender differences remained significant for dietary fiber intake and percentage of energy intake from saturated fatty acids only. All other gender differences initially observed for dietary changes became non-significant after this adjustment. Moreover, significant gender differences were observed for legumes, nuts and seeds, whole grain products and egg intakes once adjusted for the baseline value, with greater increases observed for these variables in men than in women. 143 Changes in anthropometric and metabolic variables As shown in Table 4, whereas men had significantly lower waist circumference at the end of the intervention as well as 3-month and 6-month post intervention than at baseline, women’s waist circumference decreased in response to the intervention but returned towards baseline values during follow-up (gender by time interaction, P =0.05). No significant gender differences or time effects were reported for body weight and percentage of body fat. As for metabolic variables, changes observed in total-C to HDL-C ratio, triglyceride levels and triglycerides to HDL-C ratio were significantly more pronounced in men than in women at the end of the nutritional intervention as well as at the end of follow-up. Moreover, whereas changes in total-C to HDL-C ratio, triglyceride levels and triglycerides to HDL-C ratio were maintained during follow-up, the magnitude of change observed in HDL-C levels and diastolic blood pressure tended to vary with time (time effects; P =0.06 and P =0.07, respectively). Changes in eating behaviors Table 5 shows changes in eating behaviors in men and women in response to the 12week nutritional intervention and at 3-month and 6-month post intervention. Overall, men showed a significant greater decrease in habitual susceptibility to disinhibition than women and a trend for a more pronounced increase in dietary restraint in men than in women was observed. Moreover, changes reported in eating behaviors in men and women were all maintained through the end of the follow-up (no significant time effect). DISCUSSION Our study aimed to document gender differences in long-term effects of a 12-week nutritional intervention program promoting the adoption of the MedDiet and based on the SDT on dietary intakes, eating behaviors, anthropometric and metabolic variables, in men and women presenting risk factors for CVD. Overall, our results showed that most of the gender differences found in dietary intakes and metabolic profile could be explained by gender differences in changes occurring during the 12-week intervention 144 since similar levels of maintenance of changes were generally observed in men and women during the post-intervention period. No gender difference was observed in the change in adherence to the MedDiet measured at the end of the follow-up period. However, gender differences were observed for specific components of the MedDiet, for which more pronounced changes were found in men than in women. Those changes were also concordant with gender differences observed in changes in some nutrient intakes. For example, fruits are recognized for their high fiber content and accordingly, greater increases in fruit as well as in dietary fiber intakes were observed in men than in women. Similarly, greater decreases observed in red and processed meat consumption in men than in women are concordant with greater decreases in saturated fatty acids intake also observed in men. The fact that these dietary changes were more pronounced in men at the end of followup appears to be explained by the greater amplitude of change observed in dietary intakes in men than women during the 12-week nutritional intervention. In this regard, women had baseline dietary habits that were more concordant with principles of the MedDiet, which might explain why they did not improve as much as men, due to a ceiling effect (35) . This hypothesis is well supported by the fact that many gender differences in dietary changes were no longer significant once adjusted for the baseline value of the response variable. However, some differences between men and women remained significant despite this adjustment for the baseline value, suggesting that other factors than baseline diet’s characteristics might also explain why dietary changes in response to the 12-week nutritional intervention were not as important in women as in men. Accordingly, a previous study has shown that more men than women consider that not knowing how to take preventive action for CVD was a barrier to cardiovascular health (36) . In line with these previous observations, it is possible that our intervention was more efficient to overcome barriers more typically identified by men. In fact, our intervention aimed to support autonomy and competence, especially by improving nutrition knowledge and skills according to individuals’ needs in order to take action and apply relevant strategies related to dietary changes. In addition, although the literature provides a limited understanding of the contexts of help seeking in health prevention in men, it seems that self-reliance and autonomy remain important for them (37, 38) . Therefore, it can be speculated that men might feel more comfortable to choose 145 their own dietary objectives and strategies than women and that the nature of support offered in our program was more in congruence with men’s needs for the support of autonomy and competence in the context of food regulation, as suggested by their greater improvements in overall dietary intakes. In sum, individual characteristics and intervention components may have contributed to gender differences observed in the success of men and women in long-term dietary changes and would warrant to be further considered in the future. Our results suggest that men and women showed similar limits in maintaining dietary changes in the longer term. The fact that the study was conducted in a nonMediterranean country could explain some of the results obtained, as supported by Hoffman and Gerber (39) . In fact, when examining the trajectory of changes of the components of the MedDiet, it can be noticed that intakes of food group that returned towards baseline values are generally not considered as the most familiar foods for Quebecers (e.g., legumes and fish intakes) (40, 41) or represent a staple in the diet (e.g., red and processed meat intake) (42). A greater emphasis in terms of nutritional education (e.g., alternative choices for more traditional foods, nutritional value of unfamiliar foods) and culinary skills specifically related to those food groups during the intervention program might have contributed to a better maintenance of changes in the long-term. Moreover, a greater emphasis by the dietitian towards the development of a social network among participants during group sessions could have also been beneficial for men and women as indicated in the literature (43, 44) . In our study, no additional contact was provided after the end of the 12-week nutritional education program as we wanted to assess ability of men and women to maintain adherence to the MedDiet principles in an autonomous way. However, according to the literature, it is possible that success in long-term diet adherence could have been improved by offering a program of a lesser intensity but provided on a longer period of time (45). In addition to gender differences observed in dietary intakes, men and women were different with regard to eating behaviors. In fact, men showed a greater decrease in habitual susceptibility to disinhibition than women. Although the focus of the nutritional intervention program was not on changing eating behaviors, results suggest that more pronounced dietary changes observed in men in response to the intervention can have 146 led to changes in the regulation of their eating behaviors. Accordingly, we found that an increase in the Medscore was associated with lower levels of disinhibition in men (data not shown). Previous studies indicate that different components of the MedDiet seem to modulate the brain serotonin pathway (46, 47) , and findings support the association between dysregulation of the serotonergic systems and eating disorders (48). Moreover, a recent study reported that individuals with higher level of adherence to the MedDiet had lower score for binge eating disorder (49) . In line with our results, it can thus be hypothesized that adherence to the MedDiet pattern could have contributed to improvements in eating behaviors in men, in part through neurobiological mechanisms. In addition, as supported by the literature, the high satiating properties of the MedDiet (50, 51) may also have contributed to the beneficial impact of the MedDiet on men’s eating behaviors regulation. As for anthropometric profile, differences in trajectories of changes with time were observed between men and women for waist circumference. In agreement with a previous study (10) , improvements in the quality of dietary intakes could have been beneficial for anthropometric changes in men through a negative energy imbalance. In this regard, the fact that dietary intakes were self-reported and thus subjected to different form of bias including underreporting of energy intake which is more common in women than in men (52) might explain why we did not detect significant gender differences in the reduction of energy intake in response to the intervention. Furthermore, it is possible that some sex differences could also have contributed to differences observed in changes in waist circumference between men and women. Studies have shown that men are more likely than women to experience a preferential mobilization of abdominal fat in response to lifestyles changes (53, 54) . In addition, changes in eating behaviors observed in men can also have contributed to improve their anthropometric profile. Indeed, disinhibition has been reported as a strong predictor of body weight gain (55) , and in agreement our results indicate that men with greater decreases in disinhibition levels tended to have more important decreases in waist circumference and body weight at follow-up (data not shown). In accordance with the more important changes in dietary variables and waist circumference observed in men than in women in response to the intervention, more 147 pronounced decreases in risk factors for CVD were noted in men than in women and were maintained during follow-up. These results are supported by a review paper (56) reporting that a decrease in abdominal obesity is associated with improvements in risk factors for CVD. Globally, sustained metabolic changes observed in response to the intervention in men suggest that focusing on the quality of the diet can favour a decrease in daily energy intake and a decrease in waist circumference, and can thus be beneficial for optimal management of CVD risk factors, more particularly in men. This study has important clinical implications that need to be mentioned. The fact that changes in dietary intakes as well as in the anthropometric and metabolic profile observed during the 12-week nutritional intervention are determinant of overall longterm changes underlines the importance for health professionals to target efficient and adapted nutritional approaches. Moreover, a better response to our nutritional intervention program was observed in men than in women, which indicates the need to clearly identify facilitating factors and barriers in approaches favouring men and women’s active involvement in the process of adoption of healthy dietary changes. In this regard, consideration of qualitative data from focus group with men and women separately would be a promising avenue. As a perspective, it would be interesting to assess the impact of this nutritional intervention program in populations of men and women presenting less healthy dietary intakes before the nutritional intervention. Although the focus of the present study was to assess gender differences in response to an intervention promoting the Mediterranean diet, future studies could also add a control group to further document dietary and metabolic effects of similar nutritional interventions. Finally, considering the actual context of health prevention, it would also be relevant to assess outcomes from a similar nutritional education program but of a lower intensity (i.e. less time-consuming for individuals and requiring less financial resources) and using technologies such as the Web as part of the counselling sessions. Overall, these results indicate that the response to the 12-week nutritional intervention program based on the Self-Determination Theory leads to more pronounced beneficial changes on long-term dietary intakes in men than in women, contributing to greater improvements in metabolic profile in men. 148 COMPETING INTERESTS The authors declare that they have no competing interests. AUTHORS’ CONTRIBUTION The authors’ contributions are as follow: VL was in charge of the analysis and interpretation of data and drafted the manuscript; CB contributed to the conception and design of the study as well as to the interpretation of data; A-MH and M-MR contributed to the acquisition of data; LC and SD contributed to the conception and design of the study; SL (corresponding author) was responsible for the conception and design of the study and contributed to the interpretation of data. All of the authors have read and approved the final version of the manuscript submitted for publication. ACKNOWLEDGEMENTS This research project was supported by the Canadian Institutes of Health Research (MOP 84568) and Heart and Stroke Foundation of Quebec (2007–180). Canadian Institutes of Health Research and Heart and Stroke Foundation of Quebec had no role in the study design, collection, analysis or interpretation of the data, writing the manuscript, or the decision to submit the paper for publication. VL is a recipient of a doctoral scholarship from the Fonds de recherche du Québec - Santé (FRQS). 149 REFERENCES 1. Estruch R, Ros E, Salas-Salvadó J, Covas MI, Corella D, Arós F, Gómez-Gracia E, RuizGutiérrez V, Fiol M, Lapetra J, Lamuela-Raventos RM, Serra-Majem L, Pintó X, Basora J, Muñoz MA, Sorlí JV, Martínez JA & Martínez-González MA; PREDIMED Study Investigators (2013) Primary prevention of cardiovascular disease with a Mediterranean diet. N Engl J Med 368, 1279-90. 2. Sofi F, Macchi C, Abbate R, Gensini GF & Casini A (2014) Mediterranean diet and health status: an updated meta-analysis and a proposal for a literature-based adherence score. Public Health Nutr 17, 2769-82. 3. Grosso G, Mistretta A, Frigiola A, Gruttadauria S, Biondi A, Basile F, Vitaglione P, D’Orazio N & Galvano F (2014) Mediterranean diet and cardiovascular risk factors: a systematic review. Crit Rev Food Sci Nutr 54, 593–610. 4. Welsh EM, Jeffery RW, Levy RL, Langer SL, Flood AP, Jaeb MA & Laqua PS (2012) Measuring perceived barriers to healthful eating in obese, treatment-seeking adults. J Nutr Educ Behav 44, 507–512. 5. Bemelmans WJ, Broer J, de Vries JH, Hulshof KF, May JF & Meyboom-De Jong B (2000) Impact of Mediterranean diet education versus posted leaflet on dietary habits and serum cholesterol in a high risk population for cardiovascular disease. Public Health Nutr 3, 273–283. 6. Goulet J, Lamarche B, Nadeau G & Lemieux S (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis 170, 115–124. 7. Goulet J, Lapointe A, Lamarche B & Lemieux S (2007) Effect of a nutritional intervention promoting the Mediterranean food pattern on anthropometric profile in healthy women from the Quebec city metropolitan area. Eur J Clin Nutr 61, 1293–1300. 8. Desroches S, Lapointe A, Ratte S, Gravel K, Legare F & Turcotte S (2013) Interventions to enhance adherence to dietary advice for preventing and managing chronic diseases in adults. Cochrane Database Syst Rev 2, CD008722. 9. Zazpe I, Estruch R, Toledo E, Sánchez-Taínta A, Corella D, Bulló M, Fiol M, Iglesias P, Gómez-Gracia E, Arós F, Ros E, Schröder H, Serra-Majem L, Pintó X, LamuelaRaventós R, Ruiz-Gutiérrez V & Martínez-González MA (2010) Predictors of adherence to a Mediterranean-type diet in the PREDIMED trial. Eur J Nutr 49, 91–99. 10. Riebe D, Blissmer B, Greene G, Caldwell M, Ruggiero L, Stillwell KM & Nigg CR (2005) Long-term maintenance of exercise and healthy eating behaviors in overweight adults. Prev Med 40, 769–778. 11. Kendall P (2010) Investing in Prevention Improving Health and Creating Sustainability. Colombie-Britannique: Office of the Provincial Health Officer. 150 12. Ryan RM & Deci EL (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol 55, 68–78. 13. Kumanyika SK, Van Horn L, Bowen D, Perri MG, Rolls BJ, Czajkowski SM & Schron E (2000) Maintenance of dietary behavior change. Health Psychol 19, 42–56. 14. Hu EA, Toledo E, Diez-Espino J, Estruch R, Corella D, Salas-Salvado J, Vinyoles E, Gomez-Gracia E, Aros F, Fiol M, Lapetra J, Serra-Majem L, Pintó X, Portillo MP, Lamuela-Raventos RM, Ros E, Sorli JV & Martinez-Gonzalez MA (2013) Lifestyles and risk factors associated with adherence to the Mediterranean diet: a baseline assessment of the PREDIMED trial. PLoS One 8, e60166. 15. Hearty AP, McCarthy SN, Kearney JM & Gibney MJ (2007) Relationship between attitudes towards healthy eating and dietary behaviour, lifestyle and demographic factors in a representative sample of Irish adults. Appetite 48, 1–11. 16. Wardle J, Haase AM, Steptoe A, Nillapun M, Jonwutiwes K & Bellisle F (2004) Gender differences in food choice: the contribution of health beliefs and dieting. Ann Behav Med 27, 107–116. 17. Arganini CSA, Comitato R, Virgili F & Turrini A (2012) Gender differences in food choice and dietary intake in modern western societies. Public Health Soc Behav Health Prof. Jay Maddock (ed.). Available at: http://www.intechopen.com/books/public-healthsocial-and-behavioral-health/gender-differences-in-food-choice-and-dietary-intake-inmodern-western-societies. 18. Goulet J, Lamarche B & Lemieux S (2007) Factors influencing the dietary response to a nutritional intervention promoting the Mediterranean food pattern in healthy women from the Quebec City metropolitan area. Health Educ Res 22, 718–726. 19. Canadian Institutes of Health Research-Institute of Gender and Health (2012) What a Difference Sex and Gender Make? Canada. Available at: http://www.cihrirsc.gc.ca/e/44734.html 20. Bedard A, Riverin M, Dodin S, Corneau L & Lemieux S (2012) Sex differences in the impact of the Mediterranean diet on cardiovascular risk profile. Br J Nutr 108, 1428– 1434. 21. Provencher V, Drapeau V, Tremblay A, Despres JP & Lemieux S (2003) Eating behaviors and indexes of body composition in men and women from the Quebec family study. Obes Res 11, 783–792. 22. Goulet J, Provencher V, Piche ME, Lapointe A, John Weisnagel S, Nadeau A, Bergeron J & Lemieux S (2008) Relationship between eating behaviours and food and drink consumption in healthy postmenopausal women in a real-life context. Br J Nutr 100, 910–917. 23. Landgren BM, Collins A, Csemiczky G, Burger HG, Baksheev L & Robertson DM (2004) Menopause transition: Annual changes in serum hormonal patterns over the menstrual cycle in women during a nine-year period prior to menopause. J Clin Endocrinol Metab 89, 2763–2769. 151 24. Grundy SM, Cleeman JI, Merz CN, Brewer HB Jr, Clark LT, Hunninghake DB, Pasternak RC, Smith SC Jr & Stone NJ (2004) Implications of recent clinical trials for the National Cholesterol Education Program adult treatment panel III guidelines. J Am Coll Cardiol 44, 720–732. 25. NCEP ATP III (2002) Third report of the National Cholesterol Education Program (NCEP) expert panel on detection, evaluation, and treatment of high blood cholesterol in adults (adult treatment panel III) final report. Circulation 106, 3143–3421. 26. International Diabetes Federation (2006) IDF worldwide definition of the metabolic syndrome. Available at: http://wwwidforg/webdata/docs/MetS_def_update2006pdf (Accessed on 12 July 2013). 27. Goulet J, Nadeau G, Lapointe A, Lamarche B & Lemieux S (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J 3, 13. 28. Lohman T, Roche A & Artorel R (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. 29. Body Composition Analyzer BC-418 Instruction Manual. Tokyo, Japan: Tanita Corporation. Available at: http://www.tanita.com/en/bc-418/ (Accessed on 12 July 2013). 30. Friedewald WT, Levy RI & Fredrickson DS (1972) Estimation of the concentration of low-density lipoprotein cholesterol in plasma, without use of the preparative ultracentrifuge. Clin Chem 18, 499–502. 31. Stunkard AJ & Messick S (1985) The three-factor eating questionnaire to measure dietary restraint, disinhibition and hunger. J Psychosom Res 29, 71–83. 32. Westenhoefer J, Stunkard AJ & Pudel V (1999) Validation of the flexible and rigid control dimensions of dietary restraint. Int J Eat Disord 26, 53–64. 33. Bond MJ, McDowell AJ & Wilkinson JY (2001) The measurement of dietary restraint, disinhibition and hunger: an examination of the factor structure of the Three Factor Eating Questionnaire (TFEQ). Int J Obes Relat Metab Disord 25, 900–906. 34. Beunckens C, Molenberghs G & Kenward MG (2005) Direct likelihood analysis versus simple forms of imputation for missing data in randomized clinical trials. Clin Trials 2, 379–386. 35. Trouilloud D & Regnier J (2013) Therapeutic education among adults with type 2 diabetes: effects of a three-day intervention on perceived competence, self-management behaviours and glycaemic control. Glob Health Promot 20, 94–98. 36. Haidinger T, Zweimuller M, Stutz L, Demir D, Kaider A & Strametz-Juranek J (2012) Effect of gender on awareness of cardiovascular risk factors, preventive action taken, and barriers to cardiovascular health in a group of Austrian subjects. Gend Med 9, 94–102. 37. Addis ME & Mahalik JR (2003) Men, masculinity, and the contexts of help seeking. Am Psychol 58, 5–14. 152 38. Mroz LW, Chapman GE, Oliffe JL & Bottorff JL (2011) Men, food, and prostate cancer: gender influences on men’s diets. Am J Mens Health 5, 177–187. 39. Hoffman R & Gerber M (2013) Evaluating and adapting the Mediterranean diet for nonMediterranean populations: a critical appraisal. Nutr Rev 71, 573–584. 40. Mudryj AN, Yu N, Hartman TJ, Mitchell DC, Lawrence FR & Aukema HM (2012) Pulse consumption in Canadian adults influences nutrient intakes. Br J Nutr 108, S27–S36. 41. Lucas M, Asselin G, Plourde M, Cunnane SC, Dewailly E & Dodin S (2010) n-3 Fatty acid intake from marine food products among Quebecers: comparison to worldwide recommendations. Public Health Nutr 13, 63–70. 42. Downs SM & Willows ND (2008) Should Canadians eat according to the traditional Mediterranean diet pyramid or Canada’s food guide? Appl Physiol Nutr Metab 33, 527– 535. 43. Miller TA & Dimatteo MR (2013) Importance of family/social support and impact on adherence to diabetic therapy. Diabetes Metab Syndr Obes 6, 421–426. 44. Voils CI, Gierisch JM, Yancy WS Jr, Sandelowski M, Smith R, Bolton J & Strauss JL (2013) Differentiating behavior initiation and maintenance: theoretical framework and proof of concept. Health Educ Behav 41, 325-336. 45. Fjeldsoe B, Neuhaus M, Winkler E & Eakin E (2011) Systematic review of maintenance of behavior change following physical activity and dietary interventions. Health Psychol 30, 99–109. 46. Sanchez-Villegas A, Delgado-Rodriguez M, Alonso A, Schlatter J, Lahortiga F, Serra Majem L & Martinez-Gonzalez MA (2009) Association of the Mediterranean dietary pattern with the incidence of depression: the Seguimiento Universidad de Navarra/University of Navarra follow-up (SUN) cohort. Arch Gen Psychiatry 66, 1090– 1098. 47. Yannakoulia M, Panagiotakos DB, Pitsavos C, Tsetsekou E, Fappa E, Papageorgiou C & Stefanadis C (2008) Eating habits in relations to anxiety symptoms among apparently healthy adults. A pattern analysis from the ATTICA Study. Appetite 51, 519–525. 48. Bailer UF, Price JC, Meltzer CC, Mathis CA, Frank GK, Weissfeld L, McConaha CW, Henry SE, Brooks-Achenbach S, Barbarich NC & Kaye WH (2004) Altered 5-HT (2A) receptor binding after recovery from bulimia-type anorexia nervosa: relationships to harm avoidance and drive for thinness. Neuropsychopharmacology 29, 1143–1155. 49. Bertoli S, Spadafranca A, Bes-Rastrollo M, Martinez-Gonzalez MA, Ponissi V, Beggio V, Leone A & Battezzati A (2014) Adherence to the Mediterranean diet is inversely related to binge eating disorder in patients seeking a weight loss program. Clin Nutr 34, 107-114. 50. Garaulet M & de Perez HF (2010) Behavioural therapy in the treatment of obesity (II): role of the Mediterranean diet. Nutr Hosp 25, 9–17. 153 51. Schroder H, Marrugat J, Vila J, Covas MI & Elosua R (2004) Adherence to the traditional mediterranean diet is inversely associated with body mass index and obesity in a spanish population. J Nutr 134, 3355–3361. 52. Garriguet D (2008) Under-reporting of energy intake in the Canadian Community Health Survey. Health Rep 19, 37–45. 53. Lemieux S, Prud’homme D, Bouchard C, Tremblay A & Despres JP (1993) Sex differences in the relation of visceral adipose tissue accumulation to total body fatness. Am J Clin Nutr 58, 463–467. 54. Smith SR & Zachwieja JJ (1999) Visceral adipose tissue: a critical review of intervention strategies. Int J Obes Relat Metab Disord 23, 329–335. 55. Hays NP, Bathalon GP, McCrory MA, Roubenoff R, Lipman R & Roberts SB (2002) Eating behavior correlates of adult weight gain and obesity in healthy women aged 55–65 y. Am J Clin Nutr 75, 476–483. 56. Bastien M, Poirier P, Lemieux I & Despres JP (2014) Overview of epidemiology and contribution of obesity to cardiovascular disease. Prog Cardiovasc Dis 56, 369–381. 154 )LJXUH'HVFULSWLRQRIWKHZHHNQXWULWLRQDOLQWHUYHQWLRQSURJUDPDQGPHDVXUHPHQWVSHUIRUPHGDWEDVHOLQH7 DIWHUWKHHQGRIWKH LQWHUYHQWLRQ7 PRQWKVDQGWKHQDWPRQWKDQGPRQWKSRVWLQWHUYHQWLRQ7 PRQWKVDQG7 PRQWKVUHVSHFWLYHO\ Table 1. Characteristics of men and women at baseline Men (n = 64) Mean 22.7 41.0 30.8 26.7 106.1 3.6 1.1 5.1 1.9 5.3 SD 4.3 7.9 4.4 4.5 10.2 0.7 0.2 1.0 0.9 0.5 Women (n = 59) Mean 24.1 ¶ 41.8 29.6* 39.2* 95.8* 3.6 1.4* 4.2* 1.5* 5.2 SD 3.6 6.7 6.0 6.2 11.5 0.7 0.3 0.9 0.6 0.7 Medscore (arbitrary units) Age (years) Body mass index (kg/m2) Body fat (%) Waist circumference (cm) LDL-C (mmol/l) HDL-C (mmol/l) Total-C/HDL-C ratio Triglycerides (mmol/l) Fasting glucose (mmol/l) SD: Standard deviation. For percentage of body fat, n =52 men and n =48 women. For lipid-lipoprotein variables and fasting glucose, n =63 men and n =58 women. * Values significantly different between men and women (P ≤0.05, Student’s t-test procedure). ¶ Trend for a significant difference between men and women (P =0.06, Student’s t-test procedure). 156 Table 2. Changes in dietary intakes in men and women Men Variables Energy intake (kcal) Baseline T = 3 months T = 6 months T = 9 months Energy density (kcal/g) £ Baseline T = 3 months T = 6 months T = 9 months % Carbohydrates Baseline T = 3 months T = 6 months T = 9 months Total dietary fibers (g) Baseline T = 3 months T = 6 months T = 9 months Women Mean SD % Change vs. Mean Baseline SD 3065 2768 2757 2759 896 713 752 636 −9.7 * −10.0 * −10.0 * 2457 2335 2284 2329 571 527 497 470 1.32 1.21 1.25 1.26 0.24 0.23 0.21 0.21 −8.3 * −5.3 * −4.5 * 1.21 1.19 1.16 1.20 0.17 0.17 0.17 0.17 42.2 44.1 43.9 44.4 5.3 5.8 6.3 6.0 4.5 * 4.0 * 5.2 * 44.5 44.8 44.9 44.9 5.8 5.5 5.4 5.6 27.2 32.8 30.1 30.6 9.4 10.8 10.7 11.9 20.6 * 10.7 * 12.5 * 25.6 28.1 25.1 25.2 6.3 7.5 6.0 6.2 Gender % Change vs. effect Baseline P 0.38 −5.0 −7.0 ¶ −5.2 0.02 −1.7 −4.1 ¶ −0.8 0.03 0.7 0.9 0.9 0.003 9.8 * −2.0 −1.6 Time effect Gender x time interaction P 0.99 P 0.84 Gender effect adjusted for baseline value P 0.02 0.43 0.11 0.71 0.81 0.74 0.44 0.008 0.90 0.0005 157 Table 2. Changes in dietary intakes in men and women (continued) Men Variables % Proteins Baseline T = 3 months T = 6 months T = 9 months % Lipids Baseline T = 3 months T = 6 months T = 9 months % MUFA Baseline T = 3 months T = 6 months T = 9 months % PUFA Baseline T = 3 months T = 6 months T = 9 months 158 Women Mean SD % Change vs. Baseline Mean SD 18.3 18.4 18.0 17.9 2.5 2.8 3.0 2.6 0.5 −1.6 −2.2 17.8 17.9 17.6 17.1 2.8 2.9 2.3 2.6 36.8 34.6 34.8 35.1 4.8 5.3 5.2 4.9 −6.0 * −5.4 * −4.6 * 35.1 34.6 34.3 35.1 4.5 5.2 4.8 4.8 15.5 15.1 15.2 14.9 2.8 2.9 2.9 2.7 −2.6 −1.9 −3.9 * 14.6 15.1 14.5 15.1 2.7 3.4 2.4 3.3 6.2 6.8 6.4 6.5 1.5 1.6 1.5 1.5 9.7 * 3.2 4.8 5.9 6.3 5.8 5.9 1.4 1.4 1.1 1.2 Gender % Change vs. effect Baseline P 0.99 0.6 −1.1 −3.9 ¶ 0.01 −1.4 −2.3 0.0 0.07 3.4 −0.7 3.4 0.93 6.8 * −1.7 0.0 Time effect Gender x time interaction P 0.04 P 0.67 Gender effect adjusted for baseline value P 0.40 0.76 0.66 0.25 0.76 0.21 0.58 0.004 0.94 0.10 Table 2. Changes in dietary intakes in men and women (continued) Men Women Gender effect Gender Time Gender x time adjusted for effect interaction Variables % Change vs. % Change vs. effect baseline value Mean SD Mean SD Baseline Baseline P P P P % SFA 0.002 0.0002 0.67 0.004 Baseline 12.2 2.7 11.8 1.7 T = 3 months 10.1 2.4 −17.2 * 10.5 2.0 −11.0 * T = 6 months 10.6 2.4 −13.1 * 11.4 2.5 −3.4 T = 9 months 11.0 2.4 −9.8 * 11.5 2.1 −2.5 % Trans 0.13 0.05 0.33 0.73 Baseline 1.4 0.4 1.3 0.3 T = 3 months 1.1 0.4 −21.4 * 1.1 0.4 −15.4 * T = 6 months 1.2 0.5 −14.3 * 1.1 0.3 −15.4 T = 9 months 1.3 0.3 −7.1 * 1.1 0.3 −15.4 % Alcohol 0.63 0.14 0.76 0.62 Baseline 2.7 2.4 2.7 2.3 T = 3 months 2.9 2.6 7.4 2.7 2.1 0.0 T = 6 months 3.3 3.1 22.2 * 3.1 2.4 14.8 T = 9 months 2.6 2.4 −3.7 2.9 2.8 7.4 For T = 0, T = 3, T = 6 and T = 9 months, n =64, 57, 50, 44 men and n =59, 51, 46, 44 women, respectively. SD: Standard deviation. MUFA: Monounsaturated fatty acids; PUFA: Polyunsaturated fatty acids; SFA: Saturated fatty acids; Trans: Trans fatty acids. * P ≤0.05; Significant change within the same gender. ¶ P ≤0.10; Trend for a significant change within the same gender. £ Including caloric foods and drinks. 159 Table 3. Changes in Medscore and food groups in men and women Men Variables Medscore (arbitrary units) Baseline T = 3 months T = 6 months T = 9 months Olives (portions/d) Baseline T = 3 months T = 6 months T = 9 months Whole fruits (portions/d) Baseline T = 3 months T = 6 months T = 9 months Whole vegetables (portions/d) Baseline T = 3 months T = 6 months T = 9 months 160 Mean SD Women % Change vs. Baseline Mean SD Gender Time effect effect % Change vs. Baseline P P 0.25 < 0.0001 22.7 27.6 25.4 24.6 4.3 4.7 4.8 4.6 21.6 * 11.9 * 8.4 * 24.1 27.2 25.8 24.9 3.6 4.9 4.2 5.1 12.9 * 7.1 * 3.3 1.1 1.5 1.4 1.1 1.4 1.1 1.6 0.8 36.4 ¶ 27.3 0.0 1.0 1.6 1.0 1.2 0.9 1.7 0.8 1.4 60.0 * 0.0 20.0 1.7 2.6 2.1 2.1 1.4 2.0 1.4 1.6 52.9 * 23.5 * 23.5 * 2.5 2.6 2.6 2.6 1.5 1.4 1.4 1.3 4.0 4.0 4.0 3.8 4.3 4.1 3.7 1.9 2.1 1.9 1.6 13.2 * 7.9 −2.6 4.3 4.3 4.0 4.0 1.4 1.7 1.4 2.0 0.0 −7.0 −7.0 P 0.42 Gender effect adjusted for baseline value P 0.70 Gender x time interaction 0.77 0.01 0.15 0.96 0.04 0.18 0.22 0.68 0.13 0.08 0.76 0.62 Table 3. Changes in Medscore and food groups in men and women (continued) Men Variables Legumes, nuts and seeds (portions/d) † Baseline T=3 months T=6 months T=9 months Whole grain products (portions/d) Baseline T=3 months T=6 months T=9 months Refined grain products (portions/d) Baseline T=3 months T=6 months T=9 months Milk and dairy products (portions/d) Baseline T=3 months T=6 months T=9 months Mean 1.3 1.9 1.6 1.5 3.2 3.7 3.8 3.9 3.3 1.9 2.5 2.2 3.1 2.8 2.7 2.7 SD 1.3 1.2 1.0 1.1 1.7 1.4 2.3 2.1 1.8 1.1 1.9 1.5 2.1 1.8 1.7 1.1 Women % Change vs. Baseline 46.2 * 23.1 15.4 15.6 * 18.8 * 21.9 * -42.4 * -24.2 * -33.3 * -9.7 -12.9 -12.9 Mean 0.8 1.2 0.9 0.9 2.3 2.9 2.8 2.7 2.7 1.9 1.8 2.1 2.6 2.4 2.6 2.6 SD 0.6 0.6 0.5 0.5 1.6 1.3 1.4 1.3 1.6 1.3 1.0 1.2 1.1 1.0 1.4 1.2 Time effect Gender x time interaction P P Gender effect adjusted for baseline value P 0.16 < 0.0001 0.57 0.002 0.59 0.86 0.36 0.005 0.54 0.48 0.07 0.51 0.62 0.54 0.74 0.60 Gender % Change vs. effect Baseline P 50.0 * 12.5 12.5 26.1 * 21.7 ¶ 17.4 -29.6 * -33.3 * -22.2 * -7.7 0.0 0.0 161 Table 3. Changes in Medscore and food groups in men and women (continued) Men Variables Poultry (portions/w) Baseline T=3 months T=6 months T=9 months Fish and seafood (portions/w) Baseline T=3 months T=6 months T=9 months Red meat/processed meat (portions/w) Baseline T=3 months T=6 months T=9 months Eggs (portions/w) Baseline T=3 months T=6 months T=9 months 162 Mean 6.4 5.3 4.5 5.0 4.5 7.5 6.8 6.2 SD 4.7 3.8 3.6 3.3 3.5 5.6 5.1 3.7 Women % Change vs. Baseline -17.2 -29.7 * -21.9 66.7 * 51.1 * 37.8 * Mean 4.8 4.0 3.9 4.0 3.8 6.2 5.5 4.8 SD 2.9 2.5 2.0 2.7 2.8 4.0 3.3 3.2 Time effect Gender x time interaction P 0.24 P 0.83 Gender effect adjusted for baseline value P 0.12 0.44 0.004 0.95 0.16 0.03 0.0002 0.14 0.83 0.21 0.35 0.51 0.01 Gender % Change vs. effect Baseline P 0.94 -16.7 -18.8 ¶ -16.7 63.2 * 44.7 * 26.3 11.6 5.6 7.8 7.1 6.6 3.8 6.0 5.3 -51.7 * -32.8 * -38.8 * 8.0 4.8 5.7 5.8 4.7 3.1 3.5 3.5 -40.0 * -28.8 * -27.5 * 3.2 3.3 3.8 3.7 2.7 2.6 3.5 3.0 3.1 18.8 ¶ 15.6 2.3 2.1 2.2 2.1 1.7 1.7 1.7 1.9 -8.7 -4.3 -8.7 Table 3. Changes in Medscore and food groups in men and women (continued) Men Women Gender effect Gender x Gender Time adjusted for time effect baseline Variables % Change vs. % Change vs. effect interaction Mean SD Mean SD value Baseline Baseline P P P P Sweets (portions/w) † 0.95 0.47 0.25 0.23 Baseline 13.8 33.4 9.2 9.1 T=3 months 7.3 12.3 -47.1 * 6.4 6.0 -30.4 T=6 months 9.3 14.3 -32.6 6.5 5.5 -29.3 T=9 months 7.6 5.9 -44.9 8.6 9.3 -6.5 T=9 months 7.6 5.9 -44.9 8.6 9.3 -6.5 For T=0, T=3, T=6 and T=9 months, n = 64, 57, 50, 44 men and n = 59, 51, 46, 44 women, respectively. SD: Standard deviation; d: day; w: week. * P ≤ 0.05; Significant change within the same gender. ¶ P ≤ 0.10; Trend for a significant change within the same gender. † Analysis was performed on transformed values. 163 Table 4. Changes in anthropometric and metabolic variables in men and women Men Variables Body weight (kg) Baseline T = 3 months T = 6 months T = 9 months Body fat (%) Baseline T = 3 months T = 6 months T = 9 months Waist circumference (cm) Baseline T = 3 months T = 6 months T = 9 months HDL-C (mmol/l) Baseline T = 3 months T = 6 months T = 9 months 164 Mean SD 96.6 95.2 94.5 94.2 15.5 14.4 12.4 13.3 26.7 25.6 26.2 25.6 4.5 4.6 5.3 5.0 Women % Change vs. Baseline Mean SD % Change vs. Baseline −1.4 * −2.2 * −2.5 * 77.9 77.2 78.1 77.8 16.2 17.1 17.5 17.5 −0.9 ¶ 0.3 −0.1 −4.1 * −1.9 * −4.1 * 39.2 39.2 38.9 38.4 6.2 6.6 6.5 6.4 0.0 −0.8 −2.0 106.1 104.2 103.4 103.1 10.2 9.5 8.9 9.9 −1.8 * −2.5 * −2.8 * 95.8 94.5 95.0 95.9 11.5 12.6 12.6 12.5 −1.4 * −0.8 0.1 1.15 1.19 1.20 1.22 0.22 0.25 0.25 0.24 3.5 * 4.3 * 6.1 * 1.44 1.44 1.41 1.46 0.30 0.28 0.28 0.31 0.0 −2.1 1.4 * Gender effect Time effect P 0.13 P 0.71 Gender x time interaction P 0.67 0.12 0.86 0.82 0.10 0.39 0.05 0.12 0.06 0.50 Table 4. Changes in anthropometric and metabolic variables in men and women (continued) Variables LDL-C (mmol/l) Baseline T = 3 months T = 6 months T = 9 months Total-C/HDL-C ratio Baseline T = 3 months T = 6 months T = 9 months Triglycerides (mmol/l) Baseline T = 3 months T = 6 months T = 9 months Triglycerides/HDL-C ratio Baseline T = 3 months T = 6 months T = 9 months Men % Change vs. Baseline Mean Women % Change vs. SD Baseline Mean SD 3.64 3.70 3.61 3.58 0.69 0.64 0.65 0.71 1.6 −0.8 ¶ −1.6 3.65 3.60 3.71 3.73 0.69 0.62 0.76 0.66 −1.4 1.6 2.2 5.08 4.87 4.80 4.60 1.01 0.99 0.97 0.85 −4.1 * −5.5 * −9.4 * 4.16 4.06 4.22 4.13 0.86 0.84 0.79 0.78 −2.4 1.4 −0.7 1.89 1.60 1.64 1.61 0.85 0.66 0.70 0.98 −15.3 * −13.2 * −14.8 * 1.50 1.36 1.46 1.42 0.58 0.45 0.51 0.52 −9.3 −2.7 −5.3 1.77 1.44 1.49 1.47 0.99 0.76 0.86 1.39 −18.6 * −15.8 * −16.9 * 1.10 0.99 1.07 1.02 0.49 0.42 0.44 0.42 −10.0 −2.7 −7.3 Gender effect P 0.22 Time effect P 0.86 Gender x time interaction P 0.15 0.0007 0.18 0.25 0.03 0.09 0.97 0.02 0.14 0.98 165 Table 4. Changes in anthropometric and metabolic variables in men and women (continued) Variables Systolic blood pressure (mm Hg) Baseline T = 3 months T = 6 months T = 9 months Diastolic blood pressure (mm Hg) Baseline T = 3 months T = 6 months T = 9 months Fasting glucose (mmol/l) Baseline T = 3 months T = 6 months T = 9 months 166 Mean 119.78 119.28 118.53 120.36 SD 14.60 10.63 11.50 10.02 Men % Change vs. Baseline −0.4 −1.0 0.5 ¶ Mean 109.22 109.51 111.17 109.26 Women % Change vs. SD Baseline 11.24 11.72 11.61 8.96 Gender effect P Time effect P Gender x time interaction P 0.76 0.79 0.27 0.52 0.07 0.90 0.97 0.39 0.84 0.3 1.8 0.04 75.59 72.40 73.97 72.32 9.47 8.48 8.97 7.95 −4.2 * −2.1 −4.3 * 70.76 68.94 70.19 69.04 7.92 8.17 9.15 6.96 −2.6 −0.8 −2.4 5.27 5.28 5.30 5.38 0.55 0.41 0.43 0.52 0.2 0.6 2.1 ¶ 5.16 5.21 5.29 5.17 0.69 0.68 1.19 0.59 1.0 2.5 0.2 Table 4. Changes in anthropometric and metabolic variables in men and women (continued) Men Variables Mean SD % Change vs. Baseline Women Mean SD % Change vs. Baseline Gender effect Time effect Gender x time interaction P P P Fasting insulin 0.99 0.41 0.05 (pmol/l) 100.48 Baseline 44.99 88.53 45.36 T = 3 months 98.95 44.34 −1.5 88.22 40.27 −0.4 T = 6 months 98.70 50.04 −1.8 83.11 36.47 −6.1 T = 9 months 85.77 34.17 −14.6 84.25 38.16 −4.8 For T = 0, T = 3, T = 6 and T = 9 months, n =64, 57, 50, 44 men and n =59, 51, 46, 44 women, respectively. For percentage of body fat, T = 0, 3, 6 and 9 months: n =52, 47, 50, 45 men and n =48, 41, 44, 43 women, respectively. For lipid-lipoprotein variables, T = 0, 3, 6 and 9 months: n =63, 56, 48, 41 (n =40 LDL-C) men and n =58, 51, 44, 44 women. For fasting glucose and insulin, T = 0, 3, 6 and 9 months: n =64, 57, 50, 44 men and n =58, 51, 44, 44 women. SD: Standard deviation. * P ≤0.05; Significant change within the same gender. ¶ P ≤0.10; Trend for a significant change within the same gender. 167 Table 5. Changes in eating behaviors in men and women Men Variables Dietary restraint Baseline T = 3 months T = 6 months T = 9 months Flexible restraint Baseline T = 3 months T = 6 months T = 9 months Rigid restraint Baseline T = 3 months T = 6 months T = 9 months Disinhibition Baseline T = 3 months T = 6 months T = 9 months 168 Mean SD 5.9 7.4 8.0 8.4 3.2 3.9 4.7 5.2 1.9 2.4 2.7 3.0 Women % Change vs. Baseline Mean SD 25.4 * 35.6 * 42.4 * 6.9 7.6 7.3 7.4 4.1 3.9 3.3 3.5 1.4 1.5 1.7 1.9 26.3 * 42.1 * 57.9 * 2.4 2.8 2.8 2.8 1.6 1.6 1.4 1.5 1.7 1.8 2.2 2.2 1.3 1.5 1.9 1.8 5.9 29.4 * 29.4 * 1.8 1.9 1.8 1.9 1.7 1.6 1.4 1.5 6.0 4.9 4.9 4.8 2.8 2.3 2.2 2.2 −18.3 * −18.3 * −20.0 * 6.2 5.3 5.3 5.4 2.8 3.0 2.6 3.0 Gender % Change vs. effect Baseline P 0.07 10.1 ¶ 5.8 7.2 ¶ 0.10 16.7 16.7 ¶ 16.7 0.43 5.6 0.0 5.6 0.11 −14.5 ¶ −14.5 −12.9 P 0.88 Gender x time interaction P 0.83 0.41 0.55 0.88 0.19 0.58 0.42 Time effect Table 5. Changes in eating behaviors in men and women (continued) Men Variables Habitual susceptibility to disinhibition Baseline T = 3 months T = 6 months T = 9 months Situational susceptibility to disinhibition Baseline T = 3 months T = 6 months T = 9 months Emotional susceptibility to disinhibition Baseline T = 3 months T = 6 months T = 9 months Hunger Baseline T = 3 months T = 6 months T = 9 months Mean 0.7 0.4 0.4 0.2 3.0 2.3 2.3 2.2 SD 1.0 0.8 0.6 0.4 1.4 1.3 1.5 1.5 Women % Change vs. Baseline −42.9 * −42.9 * −71.4 * −23.3 * −23.3 * −26.7 * Mean 0.7 0.6 0.4 0.4 2.5 2.0 2.1 2.1 SD 1.0 1.0 0.8 0.8 1.5 1.5 1.4 1.6 P Gender x time interaction P 0.03 0.75 0.39 0.09 0.77 0.80 0.23 0.22 0.75 0.32 0.81 0.64 Gender % Change vs. effect Baseline P Time effect −14.3 −42.9 −42.9 −20.0 ¶ −16.0 −16.0 0.7 0.7 0.7 0.7 1.0 1.0 0.9 1.0 0.0 0.0 0.0 1.6 1.2 1.2 1.2 1.2 1.2 1.2 1.2 −25.0 * −25.0 −25.0 4.8 3.3 3.5 3.4 3.0 2.4 2.7 3.0 −31.3 * −27.1 * −29.2 * 4.2 3.0 3.0 3.2 2.8 2.7 2.5 2.8 −28.6 * −28.6 * −23.8 169 Table 5. Changes in eating behaviors in men and women (continued) Men Gender x Gender Time time effect Variables % Change vs. % Change vs. effect interaction Mean SD Mean SD Baseline Baseline P P P Internal hunger 0.53 0.68 0.35 Baseline 1.9 1.8 1.6 1.6 T = 3 months 1.2 1.4 −36.8 * 0.9 1.4 −43.8 * T = 6 months 1.3 1.5 −31.6 * 1.0 1.6 −37.5 ¶ T = 9 months 1.2 1.7 −36.8 * 1.1 1.6 −31.3 External hunger 0.57 0.66 0.12 Baseline 1.9 1.5 1.8 1.4 T = 3 months 1.1 1.3 −42.1 * 1.4 1.3 −22.2 T = 6 months 1.4 1.4 −26.3 ¶ 1.1 1.1 −38.9 * T = 9 months 1.4 1.4 −26.3 * 1.4 1.2 −22.2 For T = 0, T = 3, T = 6 and T = 9 months, n =63, 57, 49, 44 men and n =59, 50, 45, 44 women, respectively. In men, T = 0: flexible restraint and internal hunger, n =60 and external hunger, n =62; T = 3 months: dietary restraint, flexible restraint and rigid restraint, disinhibition and habitual susceptibility to disinhibition, internal and external hunger, n =56; T = 6 months: flexible restraint and external hunger, n =48; T = 9 months: habitual susceptibility to disinhibition and external hunger, n =43. In women, T = 0: flexible restraint, habitual susceptibility to disinhibition, internal and external hunger, n =58 and rigid restraint, n =57; T = 3 months: flexible restraint and internal and external hunger, n =49 and rigid restraint, n =48; T = 6 months: flexible restraint and habitual susceptibility to disinhibition, n =43 and rigid restraint and external hunger, n =44; T = 9 months: rigid restraint, n =43. SD: Standard deviation. * P ≤0.05; Significant change within the same gender. ¶ P ≤0.10; Trend for a significant change within the same gender. 170 Women CHAPITRE 6 : Effets d’un programme d’intervention nutritionnelle basé sur la théorie de l’autodétermination et visant l’adoption de l’alimentation méditerranéenne: différences relatives au genre dans la motivation autodéterminée et l’adhésion à l’alimentation méditerranéenne Vicky Leblanc, Catherine Bégin, Anne-Marie Hudon, Marie-Michelle Royer, Louise Corneau, Sylvie Dodin, Simone Lemieux Accepté à Health Psychology Open, 2015 (accepté le 9 septembre 2015) 171 Effects of a nutritional intervention program based on the Self-Determination Theory and promoting the Mediterranean diet: Gender differences in eating-related motivation and adherence to the Mediterranean diet Vicky Leblanc1, Catherine Bégin2, Anne-Marie Hudon1, Marie-Michelle Royer1, Louise Corneau1, Sylvie Dodin1,3 and Simone Lemieux1. 1 Institute of Nutrition and Functional Foods, Laval University, 2440 Hochelaga Blvd, Québec, Canada, G1V 0A6 2 School of Psychology, Laval University, Pavillon Félix-Antoine Savard, 2325 rue des Bibliothèques, Québec, Canada, G1V 0A6 3 Department of Obstetric and Gynaecology, Laval University, Pavillon Ferdinand-Vandry, 1050 Medicine Avenue, Québec, Canada, G1V 0A6 Address of correspondence: Simone Lemieux, Ph.D, RD. Institute of Nutrition and Functional Foods 2440 Hochelaga Blvd Laval University, Québec Québec, Canada, G1V 0A6 Phone: (418) 656-2131 ext.: 3637 Fax: (418) 656-5877 E-mail: [email protected] (can be published) Keywords : Gender, Theory, Eating, Eating Behaviour, Education, Health Promotion. Abbreviations: SDT, Self-Determination Theory; MI, Motivational interviewing; CVD, Cardiovascular diseases; MedDiet, Mediterranean diet; FSH, Follicle-stimulating hormone; Medscore, Mediterranean score; SDI, Self-determination index; FFQ, Food frequency questionnaire; BMI, Body mass index. 173 RÉSUMÉ Cette étude avait pour objectif de déterminer les différences de genre quant à l’impact d’une intervention nutritionnelle basée sur la théorie de l’autodétermination et visant l’adoption de l’alimentation méditerranéenne sur les changements de motivation autodéterminée et d’adhésion à l’alimentation méditerranéenne. Soixante-quatre hommes et 59 femmes préménopausées ont pris part à l’intervention nutritionnelle de 12 semaines basée sur la théorie de l’autodétermination. L’échelle de régulation du comportement alimentaire a permis d’évaluer la motivation autodéterminée spécifique au contexte alimentaire. Un score méditerranéen a été calculé à partir d’un questionnaire de fréquence alimentaire. Les mesures ont été effectuées avant et après l’intervention de 12 semaines, ainsi qu’à 6 et 9 mois. Des changements de motivation autodéterminée plus prononcés chez les hommes que chez les femmes ont été observés en réponse à l’intervention ainsi qu’à la fin du suivi, avec une diminution de l’ampleur du changement dans le temps chez les hommes et les femmes. Une association positive entre les changements de motivation autodéterminée et le score méditerranéen a été notée en réponse à l’intervention et au suivi chez les hommes seulement. Globalement, l’intervention nutritionnelle semble avoir été plus efficace auprès des hommes que des femmes considérant que les changements de motivation autodéterminée étaient associés à l’augmentation de l’adhésion à l’alimentation méditerranéenne chez les hommes seulement. 175 ABSTRACT No previous study examined the impact of motivation quality on adherence to healthy eating recommendations using a gender perspective. Our objective was to determine gender differences on the impact of a nutritional intervention based on the Self-Determination Theory and promoting the Mediterranean diet (MedDiet) on changes in eating-related selfdetermined motivation and adherence to the MedDiet. Sixty-four men and 59 premenopausal women presenting risk factors for cardiovascular disease were recruited in a 12-week nutritional intervention program based on the Self-Determination Theory. The Regulation of Eating Behavior Scale allowed assessment of eating-related self-determined motivation. A food frequency questionnaire allowed calculation of a Mediterranean score. Measurements were performed at baseline, after the 12-week intervention, and at 6 and 9 months. Changes in eating-related self-determined motivation were larger in men than in women in response to the intervention and at follow-up, but the magnitude of change decreased with time in both genders. Changes in eating-related self-determined motivation were positively associated with changes in the MedDiet adherence in response to the intervention and at follow-up in men only. Overall, our nutritional program seems to fit better men than women as changes in eating-related self-determined motivation were associated to increases in adherence to the MedDiet in men only. 177 INTRODUCTION A better understanding of the motivation to engage in health behaviors is essential. Up to now the focus has mainly been on the quantitative dimension of motivation (1) . Deci and Ryan with the Self-Determination Theory (SDT) emphasize the importance of motivation quality (2, 3) . In fact, this theory proposes that the regulation of a behavior may take many forms that correspond to different behavioral regulatory styles according to motivation differing by their self-determination level, and which can be differentiated along a continuum. Moreover, according to the SDT, different self-determined regulatory styles are associated with various consequences. In fact, self-determined forms of motivation are associated with positive consequences and least self-determined forms of motivation with more negative consequences. Another key postulate from the SDT addresses the processes that facilitate internalization of nonself-determined regulatory styles towards more selfdetermined regulatory styles (2, 3) if supportive conditions are in place, i.e., a context that fosters satisfaction of three basic psychological needs which are autonomy, competence, and relatedness. With regard to the regulation of eating behaviors, previous studies showed that behaviors regulated by self-determined motivation promote adoption of healthy eating behaviors and long-term maintenance of healthy eating habits (4, 5) , and could also be a protective factor against social pressures unfavourable to healthy eating behaviors (4, 6). Evidence suggests that a person will be more likely to develop and maintain more selfdetermined motivation in a context that is autonomy-supportive (7, 8) . Autonomy support refers to eliciting and acknowledging a person’s perspectives and values, supporting initiatives, offering options and providing relevant information while minimizing persuasion and control (9) . Development of autonomy-supportive nutritional approaches aimed to promote self-determined motivation seems promising in the context of prevention of cardiovascular diseases (CVD) since sustained healthy dietary changes can improve many risk factors. Benefits of the Mediterranean diet (MedDiet) on health is well established in the literature 179 and the MedDiet is now recognized as one of the best models of food patterns providing protection against chronic diseases, such as CVD (10, 11) . Although feasibility to adopt the MedDiet principles among non-Mediterranean population has been previously reported, maintenance of dietary changes remains a challenge on the long term (12, 13) and might be improved by considering motivational factors related to eating regulation. It has been reported that differences between men and women exist with respect to eating habits (14, 15) . Therefore, gender differences in motivational factors related to eating regulation need to be examined and considered within nutritional approaches to improve their effectiveness. In this sense, gender differences in the level of eating-related selfdetermined motivation were previously reported, with women reporting higher level of self-determined motivation than men (16) . However, potential differences between men and women related to changes in self-determined motivation in response to a nutritional intervention based on the SDT remain unknown. Only few studies examined self-determined motivation in a dietary context. More importantly, none has focused on gender differences in the impact of a nutritional intervention aimed at increasing self-determined motivation. The objective of this study was therefore to determine gender differences in short and longer-term effects of a 12-week nutritional intervention program promoting the adoption of the MedDiet and based on the SDT on changes in eating-related self-determined motivation and in adherence to the MedDiet. 180 METHODOLOGY Participants This study was conducted among a sample of 64 men and 59 premenopausal women aged between 25 and 50 years old, and recruited through different media advertisements in the Québec City Metropolitan area, Canada. In women, a follicle-stimulating hormone (FSH) measurement was performed if needed (e.g., when women presented periods irregularities) to confirm the premenopausal status (FSH < 20 IU/L) (17) . Men and women had to present slightly elevated LDL-C concentrations, i.e. between 3.0 and 4.9 mmol/L (18) or a total-C to HDL-C ratio ≥ 5, and at least one of the four following criteria of the metabolic syndrome (19) : 1) triglyceride concentrations ≥ 1.7 mmol/L; 2) fasting glycaemia between 6.1 and 6.9 mmol/L; 3) blood pressure measurements ≥ 130/85 mm Hg; 4) waist circumference ≥ 80 cm in women and ≥ 94 cm in men (20). Participants also had to have a stable body weight ( 2.5 kg) for a minimum of three months prior to the beginning of the study and to be involved in food purchases and/or preparation at home. Men and women who had cardiovascular events and used medication that could affect dependent variables under study, i.e., hypertension, dyslipidemia and diabetes were excluded. Pregnant women, smokers, participants with an alcoholism history or with a high Mediterranean score (Medscore > 29, i.e. food pattern already highly concordant with the MedDiet) (13) were also excluded. All subjects voluntarily agreed to participate in the research project and written informed consent was obtained from all men and women prior to their participation in the study. This study was approved by the Laval University Research Ethics Committee. Previous publications using data from those participants examined gender differences in dietary, anthropometric and metabolic changes (21, 22) , but did not assess motivational mechanism through which those changes occurred following a nutritional intervention based on SDT within a gender perspective. 181 Study Design The 12-week nutritional program was based on the Self-Determination Theory (SDT). This theory relies on the quality of the motivation that regulates behaviors and lies on a continuum from lower to higher self-determined motivation forms (extending from amotivation to intrinsic motivation) (3) (Figure 1). Dietitians who provided the intervention used a motivational interviewing (MI) approach. MI is a practical set of intervention strategies well-developed and field-tested in the context of clinical interventions (9) and is largely consistent with SDT premises on motivation and lasting behavior change. MI has been used to test SDT constructs (Vansteenkiste and Sheldon, 2006; Patrick and Williams, 2012). The study was conducted into small groups (from January 2010 to November 2012) and the nutritional intervention included three group sessions, three individual sessions and four follow-up phone calls with a registered dietitian (Figure 2). Three registered dietitians were trained to provide a standardized intervention and participants always met with the same dietitian during individual sessions. The first group session was a lecture, always provided by the same dietitian and aiming at explaining principles of the traditional MedDiet (length: 2.5 hours, n = 13-25 participants/group). At week four, men and women actively participated in a 3-hour Mediterranean cooking lesson during which they had to cook a Mediterranean meal (n = 8-14 participants/group). At week eight, they shared a 3hour Mediterranean potluck dinner aimed at discussing barriers met in adopting dietary recommendations since the beginning of the intervention (n = 5-12 participants/group). Face-to-face individual counselling took place at weeks one, five and 10 and lasted between 45 minutes and one hour for each appointment. Individual follow-up phone calls took place at weeks three, six, nine and 12, and each lasted for about 20-30 minutes. The main objective of face-to-face individual counselling and follow-up phone calls was to assess dietary changes and to determine, with an autonomy-supportive climate, progressive personal goals with potential and realistic strategies aimed at improving the adherence to MedDiet principles. Different tools congruent with the SDT tenets were used during these sessions to formulate dietary objectives while increasing self-determined motivation. More precisely, the decisional balance allowed assessment of pros and cons of keeping dietary habits stable as well as pros and cons of changing dietary habits. The action plan was used 182 to determine concrete dietary objectives, i.e. the starting point for the change, frequency of adoption of the behavior, perceived benefits from the behavior change, main strategies considered to achieve the change, actions planned to overcome barriers and potential people who would support them into their process of dietary changes. In accordance with the SDT (3) , basic psychological needs (i.e. autonomy, competence and relatedness) were supported during the nutritional intervention in order to increase self-determined motivation. The dietitian had a client-centered approach and put no pressure on participants about the type of dietary objectives to be chosen. In addition, no emphasis was put on body weight control. Men and women were encouraged to maintain dietary changes in an autonomous way at the end of the nutritional program and there was no additional contact with the dietitian after the end of the 12-week intervention. Measurements of Dependent Variables All measurements were performed before (t = 0) and after the 12-week nutritional intervention program (t = 3 months), and then 3 and 6 months after the end of the nutritional intervention (t = 6 months and t = 9 months, respectively). Motivational variables The Regulation of eating behaviors scale (4) is a 24-item validated questionnaire that assesses self-determined motivation for the regulation of eating behaviors. Items included in this questionnaire (4 items per self-determined regulatory styles) assess intrinsic motivation (e.g., “I like to find new ways to create meals that are good for my health”), different self-determined regulatory styles which are integrated (e.g., “Eating healthy is an integral part of my life”), identified (e.g., “I believe it will eventually allow me to feel better”), introjected (e.g., “I feel I must absolutely be thin”) and external (e.g., “Other people close to me insist that I do”), and amotivation (e.g., “I don’t know why I bother”). Evaluation of the internal consistency of the subscales revealed to be adequate (Cronbach’s 183 alphas ranged from 0.79 to 0.91). Each item is measured on a 7-point Likert scale, which allows calculation of the self-determination index (SDI) (23), specific to eating regulation. Health Care Climate The Health Care Climate Questionnaire is a 15-item validated questionnaire (24) which assesses clients’ perception of the degree to which their practitioner is autonomysupportive. In our study, the word “practitioner” was replaced by the word “dietitian”. Cronbach alpha reliability for the 15 items of this questionnaire has consistently been above 0.90. This scale includes three dimensions considered essential for an optimally supportive health care context, which reflect autonomy support (e.g., “I feel that the dietitian has provided me choices and options”), involvement (e.g., “The dietitian handles peoples’ emotions very well”) and structure (e.g., “The dietitian has made sure I understand the links between foods and health and which dietary changes I can do to improve my diet”). Each item is measured on a 7-points scale (from disagree to strongly agree) and allows calculation of a global score (range 15-105), with a higher average score representing a higher level of perceived autonomy support. Dietary Variables A validated food frequency questionnaire (FFQ) (25) was administered by a registered dietitian. The FFQ is based on typical foods available in Québec and contains 91 items and 33 subquestions. Participants were questioned about the frequency of intake of different foods and drinks during the last month and could report the frequency of these intakes in terms of day, week or month. As previously described (13) , the Medscore was calculated based on the FFQ and allowed to assess the level of adherence to the Mediterranean food pattern, which could vary between 0 and 44 points. Components of the Medscore are: grains (whole and refined); fruits (whole and juices); vegetables (whole and juices); legumes, nuts and seeds; olive oil (including olives); dairy products; fish (including seafoods); poultry; eggs; sweets and red meat/processed meat. Briefly, a high consumption of food groups promoted by the Mediterranean diet (bottom of the pyramid) (e.g., legumes) contributed to increase the Medscore, whereas a high consumption of food groups at the top 184 of the Mediterranean pyramid (e.g., red meat) contributed to decrease the Medscore, as previously described (13). Anthropometric Profile According to standardized procedures (26) height was measured to the nearest millimeter with a stadiometer (Seca 222 Mechanical Telescopic Stadiometer), body weight was measured to the nearest 0.1 kg on a calibrated balance (BWB-800S Digital scale, Tanita), and body mass index (BMI) was then calculated. Waist circumference measure was also taken to the nearest millimeter according to standardized procedures (26). Statistical Analyses All analyses were performed using SAS statistical software (version 9.2, SAS Institute Inc., Cary, NC). The Student’s t-test allowed comparisons of baseline characteristics, and also the health-care climate, between men and women. Motivational variables measured are presented as means standard deviations for the baseline value but otherwise as changes standard deviations. MIXED models for repeated measurements, which allows the inclusion of participants with missing data at some time points (27) , were performed to determine gender, time and gender by time interactions effects on changes in dependent variables measured (delta values). Delta values were calculated as post nutritional intervention values (post-nutritional intervention minus pre-nutritional intervention values) and as follow-up values at t = 6 months (6 months minus pre-nutritional intervention values) and at t = 9 months (9 months minus pre-nutritional intervention values), respectively. Using this approach, a significant time effect means that the magnitude of the change is varying with time while a non-significant time effect means that changes are maintained with time. Moreover, a significant gender by time interaction means that the trajectory of changes with time is not the same in men and women. The Lsmeans procedure, which can be defined as a linear combination (sum) of the estimated effects, e.g. means, from a linear model and based on the model used, allowed determining significant 185 changes in outcomes over time within each gender. Pairwise differences between and within gender were further tested with the Tukey-Kramer adjustment. Pearson correlation analyses were performed to examine associations between eating-related SDI, adherence to the Medscore and BMI, in men and women separately. Afterwards, covariance analyses (Lsmean procedure) were performed to determine whether an interaction between gender and changes in eating-related SDI explains changes in the Medscore, and whether or not this relation remains the same after controlling for baseline eating-related SDI. For variables not normally distributed, a transformation was performed but these variables are presented as raw data in the tables. For determination of sample size, we considered a difference of 35% in the change in Medscore as being clinically significant, based on previous results (13). Therefore a final sample size of 45 men and 45 women was needed to detect a difference of 35% in the change in Medscore between men and women with a power of 0.80 and alpha of 0.05, considering that standard deviation corresponds to 55% of the mean of the change in Medscore. The probability level for significance used for the interpretation of all statistical analyses was set at a level of P 0.05. RESULTS Table 1 shows characteristics of men and women at baseline. Men and women were about the same age, but men had higher BMI, waist circumference, total-C to HDL-C ratio and triglyceride levels than women, whereas women had higher HDL-C levels than men. Of the 64 men and 59 premenopausal women included in our study at baseline, 89%, 78% and 69% of men and 86%, 78% and 75% of women completed assessments at the end of the 12-week nutritional intervention program (t = 3 months), and at t = 6 months and t = 9 months post intervention follow-up visits respectively, without significant gender differences in the attrition rate at any of the three visits. Moreover, men and women who withdrew from the study presented similar characteristics at baseline to those who completed the intervention until the end of the follow-up (not shown). 186 Level of perceived autonomy support from the dietitian No gender difference was observed for the health care climate measured at the end of the nutritional intervention, i.e., men and women similarly perceived that their dietitian was autonomy-supportive during the 12-week nutritional intervention program (98.0 ± 8.5 in men and 97.6 ± 8.9 in women; t-test, P = 0.81). Changes in eating-related self-determined motivation and in adherence to the MedDiet Changes in eating-related SDI and its different subscales of regulatory styles in men and women are presented in Table 2. Changes observed in eating-related SDI were larger in men than in women in response to the 12-week nutritional intervention and at follow-up (gender effect, P = 0.04). Similarly, a trend for larger changes was observed in integrated regulatory style in men than in women in response to the intervention and at follow-up (gender effect, P = 0.08). However, for these variables, the magnitude of change decreased with time (time effects, P = 0.0002 for eating-related SDI and P = 0.008 for integrated regulation). Significant changes in intrinsic motivation were observed in both men and women in response to the intervention, but no gender difference was observed. Moreover, this variable tended to return towards baseline values during follow-up (time effect, P = 0.08). Although significant decreases in amotivation were observed in response to the nutritional intervention in men only, no gender difference was observed, and this variable progressively returned towards baseline values during follow-up in both men and women (time effect, P = 0.002). No gender by time interaction was observed for changes in eatingrelated SDI nor its different subscales, meaning that trajectories of changes during the follow-up were not significantly different between men and women. When changes in eating-related SDI and its subscales of regulatory styles were adjusted for the baseline value of the response variable, significant gender differences and trend for gender differences initially observed all became non-significant. As for changes in adherence to the MedDiet, a significant increase was observed in the Medscore in men and women in response to the nutritional intervention and at follow-up (22.7 ± 4.3, 27.6 ± 4.7, 25.4 ± 4.8, 24.6 ± 4.6 units in men and 24.1 ± 3.6, 27.2 ± 4.9, 25.8 ± 187 4.2, 24.9 ± 5.1 units in women, at baseline, after the 12-week nutritional intervention, at t = 6 months and t = 9 months, respectively), but without gender differences (gender effect, P = 0.25). However, the Medscore progressively returned towards baseline values during the follow-up in men and women with a significant time effect (time effect, P < 0.0001). Moreover, no gender by time interaction was observed for the Medscore, meaning that trajectories of changes during the follow-up were the same in men and women (gender by time interaction, P = 0.42). Regarding changes in BMI, significant decreases were observed in both men and women after the end of the nutritional intervention and at follow-up (30.8 ± 4.4, 30.2 ± 4.0, 30.1 ± 3.5, 30.0 ± 3.8 kg/m2 in men and 29.6 ± 6.0, 29.4 ± 6.0, 29.7 ± 6.2, 29.6 ± 6.3 kg/m2 in women, at baseline, t = 3 months, t = 6 months and t = 9 months, respectively), but no gender differences were found (gender effect, P = 0.18). Pattern of associations between eating-related SDI and adherence to the MedDiet according to gender, in response to the 12-week intervention and at follow-up In men, a significant and positive association was found between changes in eating-related SDI and changes in the Medscore in response to the intervention (r = 0.41, P = 0.002), as well as between changes observed in these variables at t = 9 months (r = 0.39, P = 0.009) (Table 3). Also, a trend for a negative association between changes in eating-related SDI and changes in BMI (r = -0.26, P = 0.06) was observed in response to the intervention in men, and this negative association was significant for changes measured at t = 9 months (r = -0.33, P = 0.03). In women, no association was observed between changes in eatingrelated SDI and changes in the Medscore measured either at the end of the intervention (r = -0.08, P = 0.57) or at follow-up (r = -0.03, P = 0.84) (Table 3). Moreover, although no association was found between changes in eating-related SDI and changes in BMI in response to the intervention in women, a significant and negative association was observed between changes in these variables measured at t = 9 months (r = -0.40, P = 0.007). Additional analyses were performed to further document the differences observed between men and women in the association between changes in SDI and changes in the Medscore. Accordingly, a significant interaction was observed between gender and changes in eatingrelated SDI in the determination of changes in the Medscore in response to the intervention 188 (interaction, P = 0.02). In order to verify if higher baseline level of eating-related SDI found in women would contribute to explain this interaction (i.e, differences between men and women in the association between changes in SDI and changes in the Medscore), baseline level of eating-related SDI was added to the model of covariance. It was found that the interaction between gender and changes in eating-related SDI in the determination of changes in the Medscore remains significant despite adjustment for baseline level of eatingrelated SDI in response to the intervention (interaction, P = 0.03). At t = 9 months, no significant interaction (interaction, P = 0.12) was found between gender and changes in eating-related SDI in the determination of changes in the Medscore. DISCUSSION The aim of our study was to determine gender differences in the impact of a nutritional intervention program based on the SDT and promoting the MedDiet on eating-related motivation and adherence to the MedDiet. Results indicate that men and women perceived the motivational approach as autonomy-supportive in a similar manner although it led to larger increases in self-determined motivation in men than in women. Moreover, increases in eating-related self-determined motivation were associated with increases in adherence to the MedDiet in men only. Changes observed in eating-related self-determined motivation evolved in a similar direction in men and women as no gender by time interaction was observed. However, larger increases in eating-related self-determined motivation were observed in men than in women in response to the 12-week intervention and at follow-up. The SDT posits that a context fostering satisfaction of autonomy, competence, and relatedness is essential in promoting self-determined motivation (2, 3). Accordingly, different aspects of our nutritional intervention aimed at promoting satisfaction of these psychological needs. More precisely, competence of men and women was promoted by the Mediterranean cooking lesson, the Mediterranean potluck dinner and by nutritional information and practical tools discussed during individual and group sessions. The need for relatedness was fostered by the 189 development of a relationship based on trust, consideration and collaboration between the dietitian and the participant, by the group cohesion promoted between participants during group sessions and also by the consideration of important others in the action plan for dietary changes. Then, autonomy was supported when individuals had to determine their personal dietary objectives, the best strategies regarding the objectives and the key factors to overcome barriers. Moreover, recipes and nutritional tools were not automatically provided to individuals but rather given according to individuals’ needs. In regard to the impact of our intervention in men and women, factors that can explain why women did not increase their level of eating-related self-determined motivation as much as men, such as level of eating-related self-determined motivation at baseline, need to be considered. Indeed, as women reported higher level of eating-related self-determined motivation than men at baseline, room for improvement in motivation could have been more limited for women than men. In this regard, the adjustment for the baseline value of the response variable indicated that if a similar level of eating-related self-determined motivation at baseline had been observed in men and women, no significant gender difference would have been found in changes in eating-related self-determined motivation. In addition, despite the fact that men and women perceived the intervention as similarly autonomy-supportive, it can be hypothesized that gender differences exist in the level of need satisfaction for autonomy, competence and relatedness specific to the dietary context. However, to our knowledge, no validated questionnaire allows assessment of the satisfaction of the psychological needs specific to the dietary context. Moreover, a better understanding of the impact of the health care climate in men and women on changes in eating-related self-determined motivation could be achieved in future studies by assessing perceived level of satisfaction of the psychological needs at different time-points of an intervention. Indeed, data from a recent qualitative study in the field of physical activity reported that satisfaction of the needs for competence and relatedness were essential during the phase of adoption of the exercise behavior while satisfaction of autonomy had more impact in the maintenance phase (28) . Those results suggest that stages of development of these needs might differ and should be considered in order to facilitate internalization of nonself-determined regulatory styles towards more self-determined regulatory styles. In 190 addition, the idea of monitoring people on a daily basis using an ecological momentary assessment technique could be interesting as previous studies reported within-person fluctuations in psychological need satisfaction (Verstuyf et al., 2013). The fact that eating-related self-determined motivation returned toward baseline values in both men and women underlines the difficulty to maintain motivation changes. Despite twelve weeks of intervention aimed to internalize motivational factors related to the adoption of a diet of better quality, the transition between the end of the intervention program and the follow-up period, and the complete absence of support during the followup seem to represent critical points to consider. Moreover, intrinsic motivation, i.e. highest level of eating-related self-determined motivation and which refers to undertaking an activity for its inherent interest and enjoyment, might be more difficult to maintain than other types of motivation (9, 29) . This can partly be explained by the fact that the delay to internalize intrinsic motivation might have been insufficient. It is also possible that attempts to maintain dietary intakes were directed more to other outcomes such as to improve health condition or decrease body weight, which could have thwarted the intrinsic motivation towards changing dietary habits per se (e.g. for the interest and pleasure of eating or preparing food according to the MedDiet) (29) . Although the magnitude of the changes in eating-related self-determined motivation also decreased with time among men, level of motivation remained significantly higher than at baseline, suggesting a non-negligible impact from the nutritional intervention program on motivational factors. In addition, previous results demonstrate that our intervention based on a motivational approach had a beneficial impact on the adoption of healthy dietary intakes and risk factors for CVD such as waist circumference and lipid profile, more particularly in men (26, 27). To our knowledge, assessment of the influence of changes in motivation on changes in the adherence to the MedDiet according to gender is a novelty in the literature. We found that an increase in eating-related self-determined motivation was associated with an increase in the adherence to the MedDiet in response to the 12-week intervention as well as at followup, in men but not in women. Moreover, additional analyses revealed that differences found between men and women in the association between changes in motivation and changes in 191 adherence to the MedDiet may not be explained by gender differences in the level of eating-related self-determined motivation at baseline. This suggests that other genderrelated factors are involved to explain these differences in the pattern of associations between eating-related self-determined motivation and adherence to the MedDiet. Those factors may be related to eating-related attitudes, behaviors and norms, societal role and responsibilities attributed to men and women (30, 31) . Although these factors were not specifically assessed in our study, some components of the nutritional intervention program may have better suited men than women. Previous studies indicate that men are more ambivalent than women towards healthy eating choices (32, 33) therefore supporting our hypothesis that tools used in our intervention and aimed at increasing eating-related selfdetermined motivation such as the decisional balance might have been more beneficial for men than women. As no previous study assessed gender differences in changes in eating-related selfdetermined motivation, several hypotheses remain to be verified in the future regarding basic psychological needs for autonomy, competence and relatedness in the dietary context and potential moderators in the association between changes in motivation and changes in dietary intakes to allow a better understanding of the influence of the quality of the motivation in the context of healthy eating in both men and women. The fact that men and women recruited in our study were middle-aged adults and presented specific characteristics regarding CVD risk limits the generalization of our results to the whole population. Moreover, although missing data could contribute to overestimate changes found at follow-up in self-determined motivation in men and women, gender differences observed are unlikely to be influenced by this possible bias since the attrition rate was the same in men and women. Nevertheless, this study has important strengths and clinical implications that need to be mentioned. Our nutritional education program was developed based on the Self-Determination theory, which facilitated and guided our methods of intervention. Moreover, this study design allowed the assessment of long-term impact of a nutritional intervention, during which individuals were actively involved in the process of dietary changes followed by a 6-month period with no additional support provided which can be more representative of a real-life setting. 192 Overall, although both men and women increased their adherence to the MedDiet in response to the nutritional intervention, results indicate that the nutritional intervention program aimed at promoting eating-related self-determined motivation in order to improve the quality of the diet seems to fit better men than women as changes in eating-related selfdetermined motivation were associated with increases in adherence to the MedDiet in men only. FINANCIAL SUPPORT This research project was supported by the Canadian Institutes of Health Research (MOP 84568) and Heart and Stroke Foundation of Quebec (2007-180). Canadian Institutes of Health Research and Heart and Stroke Foundation of Quebec had no role in the study design, collection, analysis or interpretation of the data, writing the manuscript, or the decision to submit the paper for publication. The first author is a recipient of a doctoral scholarship from the Fonds de recherche du Québec - Santé (FRQS). AUTHORSHIP The authors’ contributions are as follow: V.L. was in charge of the analysis and interpretation of data and drafted the manuscript; C.B. contributed to the conception and design of the study as well as to the interpretation of data; A-M.H. and M-M.R. contributed to the acquisition of data; L.C. and S.D. contributed to the conception and design of the study; S.L. (corresponding author) was responsible for the conception and design of the study and contributed to the interpretation of data. All of the authors have read and approved the final version of the manuscript submitted for publication. CONFLICT OF INTEREST Authors report no conflict of interest. 193 REFERENCES 1. Silva MN, Markland D, Minderico CS, Vieira PN, Castro MM, Coutinho SR, Santos TC, Matos MG, Sardinha LB & Teixeira PJ (2008) A randomized controlled trial to evaluate self-determination theory for exercise adherence and weight control: rationale and intervention description. BMC Public Health 8, 234. 2. Deci EL & Ryan RM (1985) Intrinsic motivation and self-determination in human behavior. New York, NY: Plenum. 3. Ryan RM & Deci EL (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol 55, 68-78. 4. Pelletier LG, Dion SC, Slovinec-D'Angel M & Reid R (2004) Why Do You Regulate What You Eat? Relationships Between Forms of Regulation, Eating Behaviors, Sustained Dietary Behavior Change, and Psychological Adjustment. Motivation and Emotion 28, 245-277. 5. Williams GC, Minicucci DS, Kouides RW, Levesque CS, Chirkov VI, Ryan RM & Deci EL (2002) Self-determination, smoking, diet and health. Health Educ Res. 17, 512-521. 6. Mask L & Blanchard CM (2011) The protective role of general self-determination against 'thin ideal' media exposure on women's body image and eating-related concerns. J Health Psychol 16, 489-499. 7. Resnicow K & McMaster F (2012) Motivational Interviewing: moving from why to how with autonomy support. Int J Behav Nutr Phys Act 9, 19. 8. Vansteenkiste M & Sheldon KM (2006) There's nothing more practical than a good theory: integrating motivational interviewing and self-determination theory. Br J Clin Psychol 45, 63-82. 9. Vansteenkiste M, Soenens B & Vandereycken W (2005) Motivation to change in eating disorder patients: a conceptual clarification on the basis of self-determination theory. Int J Eat Disord 37, 207-219. 10. Martins RK & McNeil DW (2009) Review of Motivational Interviewing in promoting health behaviors. Clin.Psychol Rev. 29, 283-293. 11. Patrick H & Williams GC (2012) Self-determination theory: its application to health behavior and complementarity with motivational interviewing. Int J Behav Nutr Phys Act 9, 18. 194 12. Teixeira PJ, Palmeira AL & Vansteenkiste M (2012) The role of self-determination theory and motivational interviewing in behavioral nutrition, physical activity, and health: an introduction to the IJBNPA special series. Int J Behav Nutr Phys Act 9, 17. 13. Deci EL, Eghrari H, Patrick BC & Leone DR (1994) Facilitating internalization: the self-determination theory perspective. J Pers. 62, 119-142. 14. Williams GC, McGregor HA, Sharp D, Levesque C, Kouides RW, Ryan RM & Deci EL (2006) Testing a self-determination theory intervention for motivating tobacco cessation: supporting autonomy and competence in a clinical trial. Health.Psychol 25, 91-101. 15. Estruch R, Ros E, Salas-Salvado J, Covas MI, Pharm D, Corella D, Aros F, GomezGracia E, Ruiz-Gutierrez V, Fiol M, Lapetra J, Lamuela-Raventos RM, Serra-Majem L, Pinto X, Basora J, Munoz MA, Sorli JV, Martinez JA & Martinez-Gonzalez MA (2013) Primary Prevention of Cardiovascular Disease with a Mediterranean Diet. N Engl J Med. 368, 1279-1290. 16. Sofi F, Macchi C, Abbate R, Gensini GF & Casini A (2014) Mediterranean diet and health status: an updated meta-analysis and a proposal for a literature-based adherence score. Public Health Nutr 17, 2769-2782. 17. Bemelmans WJ, Broer J, de Vries JH, Hulshof KF, May JF & Meyboom-De Jong B (2000) Impact of Mediterranean diet education versus posted leaflet on dietary habits and serum cholesterol in a high risk population for cardiovascular disease. Public Health Nutr 3, 273-283. 18. Goulet J, Lamarche B, Nadeau G & Lemieux S (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis. 170, 115-124. 19. Wardle J, Haase AM, Steptoe A, Nillapun M, Jonwutiwes K & Bellisle F (2004) Gender differences in food choice: the contribution of health beliefs and dieting. Ann Behav Med 27, 107-116. 20. Arganini CSA, Comitato R, Virgili F & Turrini A (2012) Gender differences in food choice and dietary intake in modern western societies. Public Health Soc Behav Health Prof. Jay Maddock (ed.). Available at: http://www.intechopen.com/books/public-health-social-and-behavioral-health/genderdifferences-in-food-choice-and-dietary-intake-in-modern-western-societies. 21. Leblanc V, Begin C, Corneau L, Dodin S & Lemieux S (2015) Gender differences in dietary intakes: what is the contribution of motivational variables? J Hum Nutr Diet 28, 37-46. 195 22. Landgren BM, Collins A, Csemiczky G, Burger HG, Baksheev L & Robertson DM (2004) Menopause transition: Annual changes in serum hormonal patterns over the menstrual cycle in women during a nine-year period prior to menopause. J Clin Endocrinol. Metab. 89, 2763-2769. 23. Grundy SM, Cleeman JI, Merz CN, Brewer HB, Jr., Clark LT, Hunninghake DB, Pasternak RC, Smith SC, Jr. & Stone NJ (2004) Implications of recent clinical trials for the National Cholesterol Education Program Adult Treatment Panel III Guidelines. J Am Coll. Cardiol. 44, 720-732. 24. NCEP ATP III (2002) Third Report of the National Cholesterol Education Program (NCEP) Expert Panel on Detection, Evaluation, and Treatment of High Blood Cholesterol in Adults (Adult Treatment Panel III) final report. Circulation 106, 31433421. 25. International Diabetes Federation (2006) IDF worldwide definition of the metabolic syndrome. Available at: http://www.idf.org/webdata/docs/MetS_def_update2006.pdf (Accessed on 12 July 2013). 26. Leblanc V, Hudon A-M, Royer M-M, Corneau L, Dodin S, Bégin C & Lemieux S (2015) Differences between men and women in dietary intakes and metabolic profile in response to a 12-week nutritional intervention promoting the Mediterranean diet. Nutritional Science 4(e13), 1-11. 27. Leblanc V, Begin C, Hudon AM, Royer MM, Corneau L, Dodin S & Lemieux S (2014) Gender differences in the long-term effects of a nutritional intervention program promoting the Mediterranean diet: changes in dietary intakes, eating behaviors, anthropometric and metabolic variables. Nutr J 13, 107. 28. Vallerand RJ (1997) Toward a hierarchical model of intrinsic and extrinsic motivation. In Advances in Experimental Social Psychology, ed. M.P. Zanna, pp. 271-360. New York, NY: Academic Press. 29. Williams GC & Deci EL (2001) Activating patients for smoking cessation through physician autonomy support. Med. Care 39, 813-823. 30. Goulet J, Nadeau G, Lapointe A, Lamarche B & Lemieux S (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J 3, 13. 31. Lohman T, Roche A & Artorel R (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. 32. Beunckens C, Molenberghs G & Kenward MG (2005) Direct likelihood analysis versus simple forms of imputation for missing data in randomized clinical trials. Clin Trials 2, 379-386. 196 33. Kinnafick FE, Thogersen-Ntoumani C & Duda JL (2014) Physical activity adoption to adherence, lapse, and dropout: a self-determination theory perspective. Qual Health Res 24, 706-718. 34. Verstuyf J, Patrick H, Vansteenkiste M & Teixeira PJ (2012) Motivational dynamics of eating regulation: a self-determination theory perspective. Int J Behav Nutr Phys Act 9, 21. 35. Canadian Institutes of Health Research-Institute of Gender and Health (2012) What a Difference Sex and Gender Make? Canada. Available at: http://www.cihrirsc.gc.ca/e/44734.html 36. Wang WC & Worsley A (2014) Healthy eating norms and food consumption. Eur J Clin Nutr 68, 592-601. 37. Sparks P, Conner M, James R, Shepherd R & Povey R (2001) Ambivalence about health-related behaviours: an exploration in the domain of food choice. Br J Health Psychol 6, 53-68. 38. Povey R, Wellens B & Conner M (2001) Attitudes towards following meat, vegetarian and vegan diets: an examination of the role of ambivalence. Appetite 37, 15-26. 39. Hearty AP, McCarthy SN, Kearney JM & Gibney MJ (2007) Relationship between attitudes towards healthy eating and dietary behaviour, lifestyle and demographic factors in a representative sample of Irish adults. Appetite 48, 1-11. 197 ([WULQVLF 0RWLYDWLRQ $PRWLYDWLRQ 1RQ 5HJXODWLRQ ([WHUQDO 5HJXODWLRQ ,QWURMHFWHG 5HJXODWLRQ 1RQVHOI'HWHUPLQHG0RWLYDWLRQ ,QWULQVLF 0RWLYDWLRQ ,GHQWLILHG 5HJXODWLRQ ,QWHJUDWHG 5HJXODWLRQ ,QWULQVLF 5HJXODWLRQ 6HOI'HWHUPLQHG0RWLYDWLRQ )LJXUH&RQWLQXXPRIWKH6HOI'HWHUPLQHG0RWLYDWLRQDGDSWHGIURP5\DQDQG'HFL )LJXUH'HVFULSWLRQRIWKHZHHNQXWULWLRQDOLQWHUYHQWLRQSURJUDPDQGPHDVXUHPHQWVSHUIRUPHGDWEDVHOLQH7 DIWHUWKHHQGRI WKH LQWHUYHQWLRQ 7 PRQWKV DQG WKHQ DW PRQWK DQG PRQWK SRVW LQWHUYHQWLRQ 7 PRQWKV DQG 7 PRQWKV UHVSHFWLYHO\ Table 1. Characteristics of men and women at baseline Men (n =64) Women (n =59) Mean SD Mean SD Age (years) 41.0 7.9 41.8 6.7 2 Body mass index (kg/m ) 30.8 4.4 29.6* 6.0 Waist circumference (cm) 106.1 10.2 95.8* 11.5 Total cholesterol (C) (mmol/L) 5.7 0.8 5.8 0.8 LDL-C (mmol/L) 3.6 0.7 3.6 0.7 HDL-C (mmol/L) 1.1 0.2 1.4* 0.3 Total-C/HDL-C ratio 5.1 1.0 4.2* 0.9 Triglycerides (mmol/L) 1.9 0.9 1.5* 0.6 Fasting glucose (mmol/L) 5.3 0.5 5.2 0.7 * Mean values were significantly different between men and women (P ≤ 0.05, Student's t test). Measurements of blood lipids and glucose levels were performed in 63 men and in 58 women. 201 Table 2. Changes in the eating-related self-determination index and its specific forms of regulation in men and women in response to the 12-week nutritional intervention program and at follow-up Men Variables Intrinsic motivation Baseline § Δ 0-3 months Δ 0-6 months Δ 0-9 months Integrated regulation Baseline § Δ 0-3 months Δ 0-6 months Δ 0-9 months Identified regulation Baseline Δ 0-3 months Δ 0-6 months Δ 0-9 months Introjected regulation Baseline Δ 0-3 months Δ 0-6 months Δ 0-9 months 202 Mean 5.27 0.37 * 0.36 * 0.22 ¶ 4.88 0.57 * 0.61 * 0.44 * 6.23 0.08 0.15 -0.13 2.35 -0.04 0.005 -0.06 Women SD 1.05 0.86 0.82 0.90 1.18 0.96 1.03 1.28 0.70 0.96 1.03 1.28 1.01 0.65 0.90 0.73 Mean 5.78 0.28 * 0.27 ¶ 0.18 5.32 0.28 * 0.37 * 0.11 6.33 -0.08 -0.13 -0.11 2.30 -0.06 0.07 0.18 SD Gender differences adjusted for baseline value Gender differences Time effect Gender x time interaction P P P P 0.49 0.08 0.93 0.40 0.08 0.008 0.95 0.48 0.33 0.14 0.14 0.57 0.55 0.17 0.39 0.68 0.87 0.86 0.75 0.70 1.04 0.81 0.71 0.71 0.64 0.52 0.73 0.53 0.93 0.75 0.78 0.76 Table 2. Changes in the eating-related self-determination index and its specific forms of regulation in men and women in response to the 12-week nutritional intervention program and at follow-up (continued) Men Women Gender Gender x Gender Time differences time differences effect adjusted for Variables interaction Mean SD Mean SD baseline value P P P External regulation 0.23 0.0454 0.86 Baseline § 1.95 1.05 1.63 0.72 Δ 0-3 months -0.16 0.72 -0.04 0.60 Δ 0-6 months -0.10 0.83 0.04 0.73 Δ 0-9 months -0.03 0.83 0.17 0.70 Amotivation 0.10 0.002 0.70 Baseline 1.38 0.49 1.22 0.42 Δ 0-3 months -0.15 * 0.52 0.01 0.42 Δ 0-6 months -0.19 * 0.52 -0.09 0.44 Δ 0-9 months -0.09 0.58 0.09 0.41 Eating related selfdetermination index 0.04 0.0002 0.97 Baseline § 21.33 6.43 25.08 6.58 Δ 0-3 months 3.17 * 5.83 1.43 ¶ 4.20 Δ 0-6 months 3.31 * 5.66 1.56 ¶ 4.48 Δ 0-9 months 1.85 * 6.89 -0.13 3.96 SD, Standard deviation. Δ 0-3 months, Changes from baseline to the end of the 12-week nutritional intervention; Δ 0-6 months, Changes from baseline to 3-month post intervention; Δ 0-9 months, Changes from baseline to 6-month post intervention. § Mean value significantly different between men and women (P ≤ 0.05, Student's t test). P 0.45 0.43 0.49 203 * P ≤0.05; Significant change within the same gender. ¶ P ≤0.10; Trend for a significant change within the same gender. In men, for T = 0, Δ 0-3 months, Δ 0-6 months and Δ 0-9 months, n =63, 56, 49 and 44, except for integrated regulation (n =62, 55, 48 and 43 respectively). In women, for intrinsic motivation (n=59, 49,44 and 44); integrated regulation (n =59, 49, 43 and 43); identified regulation (n =58, 49, 43 and 43); introjected regulation (n =59, 50, 44 and 44); external regulation (n =59, 49, 43 and 44); amotivation (n =59, 50, 44 and 44); Eating related self-determination index (n =59, 50, 44 and 44). 204 Table 3. Associations between changes in eating-related self-determined motivation and changes in the Medscore and in BMI in men and women Δ Eating-related SDI (0-3 months) Men (n =56) Δ Eating-related SDI (0-9 months) Women (n =50) Men (n =44) Women (n =44) r P r P r P r P Δ Medscore (0-3 months) 0.41 0.002 -0.08 0.57 - - - - Δ Medscore (0-9 months) - - - - 0.39 0.009 -0.03 0.84 -0.26 0.0562 -0.22 0.13 - - - - 0.03 -0.40 0.007 Δ BMI (0-3 months) Δ BMI (0-9 months) -0.33 Δ 0-3 months, Changes from baseline to the end of the 12-week nutritional intervention; Δ 0-9 months, Changes from baseline to 6-month post intervention. Eating-related SDI, eating-related self-determination index. For Δ Medscore (0-9 months) in women, n =43. 205 CHAPITRE 7 : Changements de la qualité de vie liée à la santé suivant une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne : évaluation des différences de genre chez des hommes et des femmes présentant des facteurs de risque cardiovasculaire Vicky Leblanc, Catherine Bégin, Louise Corneau, Sylvie Dodin, Simone Lemieux Soumis à Journal of Nutrition Education and Behavior, 2015 (soumis le 24 mai 2015) 207 Changes in health-related quality of life following a nutritional intervention promoting the Mediterranean diet: examination of gender differences in men and women presenting risk factors for cardiovascular disease Vicky Leblanc1, Catherine Bégin2, Louise Corneau1, Sylvie Dodin1,3, and Simone Lemieux1. 1 Institute of Nutrition and Functional Foods, Laval University, 2440 Hochelaga Blvd, Québec, Canada, G1V 0A6 2 School of Psychology, Laval University, Pavillon Félix-Antoine Savard, 2325 rue des Bibliothèques, Québec, Canada, G1V 0A6 3 Department of Obstetric and Gynaecology, Laval University, Pavillon Ferdinand-Vandry, 1050 Medicine Avenue, Québec, Canada, G1V 0A6 Address of correspondence: Simone Lemieux, Ph.D, RD. Institute of Nutrition and Functional Foods 2440 Hochelaga Blvd Laval University, Québec Québec, Canada, G1V 0A6 Phone: (418) 656-2131 ext.: 3637 Fax: (418) 656-5877 E-mail: [email protected] (can be published) Keywords : Gender differences, Mediterranean diet, Self-determined motivation, Cardiovascular risk, Health-related quality of life. Abbreviations: HRQOL, Health-related quality of life; CVD, Cardiovascular diseases; MedDiet, Mediterranean diet; SDT, Self-Determination Theory; MI, Motivational interviewing; FFQ, Food frequency questionnaire; Medscore, Mediterranean score; SDI, Self-determination index. 209 RÉSUMÉ Cette étude avait pour objectif de déterminer les différences de genre dans les changements liés à la perception de la qualité de vie suivant une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne et basée sur la théorie de l’autodétermination, et à identifier les facteurs prédisant ces changements chez les hommes et les femmes. Soixante-quatre hommes et 59 femmes préménopausées à risque de maladies cardiovasculaires ont pris part à l’intervention de 12 semaines. Le questionnaire SF-36 a été complété afin d’évaluer la qualité de vie. Aucune différence de genre n’a été observée quant à la perception de la qualité de vie en réponse à l’intervention et au suivi. Le niveau de qualité de vie observé à trois mois suivant la fin de l’intervention était significativement plus élevé qu’au départ chez les hommes et les femmes. Une augmentation de la motivation autodéterminée spécifique au contexte alimentaire prédisait l’amélioration de la qualité de vie chez les hommes, alors que chez les femmes, une qualité de vie élevée au départ prédisait une amélioration moindre. Malgré les changements semblables liés à la qualité de vie chez les hommes et les femmes, les facteurs prédisant ces changements différeraient selon le genre. 211 ABSTRACT Few studies have assessed how improvement in the quality of the diet without a focus on weight control is related to health-related quality of life (HRQOL). This study aimed at determining gender differences in changes in perceived HRQOL following a 12-week nutritional intervention program promoting the Mediterranean diet and based on the SelfDetermination Theory, and to identify factors predicting these changes, in men and women separately. A sample of 64 men and 59 premenopausal women presenting risk factors for cardiovascular disease were recruited in the Quebec City metropolitan area, Canada. HRQOL was assessed with the SF-36 Health Survey. All measurements were performed before and after the 12-week nutritional intervention program, and then 3 and 6 months after the end of the nutritional intervention (6 and 9-month follow-up, respectively). No gender difference was observed for changes in the global HRQOL. A significant time effect was found for both men and women in the global HRQOL score (P = 0.006), more specifically with higher scores at 6-month follow-up compared to baseline (P = 0.01). Increases in eating-related self-determined motivation predicted improvements in global HRQOL (ß = 0.54, r2 = 0.10, P = 0.03) at 6-month follow-up in men. In women, level of perceived HRQOL at baseline predicted changes in HRQOL (ß = -0.17, r2 = 0.11, P = 0.03) at 6-month follow-up. Similar changes in perceived HRQOL were found in men and women in response to our nutritional intervention, but factors predicting those changes were not the same in men and women. 213 INTRODUCTION Evidence supports the undermining effect of chronic diseases and related risk factors on level of perceived health-related quality of life (HRQOL) (1, 2) . In this regard, changing eating habits is an essential aspect in the prevention of chronic diseases, more particularly cardiovascular diseases (CVD) (3, 4). The Mediterranean diet (MedDiet) is recognized as one of the best models of healthy eating providing protection against chronic diseases, such as CVD (5, 6) . According to a cross-sectional study among the Spanish population, adherence to the MedDiet was associated with higher level of perceived HRQOL (7) . Among non- Mediterranean populations, although health benefits following the adoption of the MedDiet principles have been reported (8, 9) , the impact of adhering to this food pattern on HRQOL has never been assessed. In the context of lifestyle interventions, benefit of weight loss on HRQOL changes has been considerably explored in the literature (10, 11) , but to our knowledge, HRQOL changes in response to dietary modifications, without a focus on weight control, remains unknown. Moreover, as self-determined motivation has been previously associated with healthier (12) dietary intakes , it could be suggested that nutritional interventions supporting individuals’ autonomy and competency in their dietary changes, may contribute to beneficial HRQOL changes. Finally, considering the differences found in the level of perceived HRQOL between Canadian men and women, with men reporting better HRQOL than women (13) , and also the existence of gender differences in eating habits eating behaviors (14, 15) and (16) , assessment of HRQOL changes in response to a nutritional intervention is relevant but has to be evaluated using a gender approach. The objective of this study was therefore to determine gender differences in changes in the level of perceived HRQOL following a 12-week nutritional intervention program promoting the MedDiet and based on the Self-Determination Theory, and to identify factors predicting these changes, among Canadian men and women presenting risk factors for CVD. 215 METHODOLOGY Recruitment of participants and Study design This study was conducted among a sample of 64 men and 59 premenopausal women aged between 25 and 50 years old, presenting risk factors for cardiovascular disease, and were recruited through different media advertisements in the Quebec City Metropolitan area, Canada. Further details related to participants’ recruitment have been reported previously (17) . All subjects voluntarily agreed to participate in the research project and written informed consent was obtained from all men and women prior to their participation in the study. This study was approved by the Laval University Research Ethics Committee. The 12-week nutritional program was based on the Self-Determination Theory (SDT) and used a motivational interviewing (MI) approach. Details about the nutritional intervention have been reported elsewhere (17) but briefly, the study was conducted into small groups (from January 2010 to November 2012) and the nutritional intervention program included three group sessions, three individual sessions and four follow-up phone calls with a registered dietitian (Figure 1). This clinical trial was registered at www.clinicaltrials.gov as NCT01852721. Measurements of Dependent Variables All measurements were performed before (t = 0) and after the 12-week nutritional intervention program (t = 3 months), and then 3 and 6 months after the end of the nutritional intervention (6 and 9-month follow-up, respectively). 216 Health-related quality of life Health-related quality of life (HRQOL) was assessed with the Medical Outcomes Study 36item Short Form (SF-36v2 Standard, Canada (French) Version 2.0) Health Survey (18). This questionnaire assesses eight different domains. Physical functioning (10 items) measures limitations in physical activities (e.g., climbing stairs); physical (4 items) and emotional (3 items) role domains assess problems with work or other daily activities because of physical health or emotional problems; bodily pain (2 items) examines limitations as a result of pain; vitality (4 items) assesses energy and tiredness; social functioning (2 items) measures the effect of physical and emotional health on normal social activities; mental health (5 items) assesses happiness, nervousness and depression; and general health perceptions domain (5 items) assesses personal health and the expectation of changes in health. All domains are scored on a scale from 0 to 100, where 100 represents the highest level of HRQOL. Summary scores for a physical and mental components were aggregated from z-score transformations of the eight domains and transformed to a mean of 50 with a standard deviation of 10 (19). Dietary Variables A validated food frequency questionnaire (FFQ) (20) was administered by a registered dietitian. The FFQ is based on typical foods available in Quebec and contains 91 items and 33 subquestions. Participants were questioned about the frequency of intake of different foods and drinks during the last month and could report the frequency of these intakes in terms of day, week or month. As previously described (8) , a Mediterranean score (Medscore) was calculated based on the FFQ and allowed to assess the level of adherence to the Mediterranean food pattern, which can vary between 0 and 44 points. Components of the Medscore are: grains (whole and refined); fruits (whole and juices); vegetables (whole and juices); legumes, nuts and seeds; olive oil (including olives); dairy products; fish (including seafoods); poultry; eggs; sweets and red meat/processed meat. A high consumption of food groups promoted by the Mediterranean diet (bottom of the pyramid) (e.g., legumes) contributed to increase the Medscore, whereas a high consumption of food groups at the top of the Mediterranean pyramid (e.g., red meat) contributed to decrease the Medscore, as previously described (8). 217 Motivational variables The Regulation of Eating Behaviors Scale (12) is a 24-item validated questionnaire that assesses self-determined motivation for the regulation of eating behaviors. Items included in this questionnaire (4 items per self-determined regulatory styles) assess intrinsic motivation (e.g., “I like to find new ways to create meals that are good for my health”), different self-determined regulatory styles which are integrated (e.g., “Eating healthy is an integral part of my life”), identified (e.g., “I believe it will eventually allow me to feel better”), introjected (e.g., “I feel I must absolutely be thin”) and external (e.g., “Other people close to me insist that I do”), and amotivation (e.g., “I don’t know why I bother”) (21) . Each item was measured on a 7-point Likert scale, which allowed calculation of the eating-related self-determination index (SDI) (22). Anthropometric Profile Body weight was measured to the nearest 0.1 kg while height and waist circumference were measured to the nearest millimeter, according to standardized procedures (23) . Statistical Analyses All analyses were performed using SAS statistical software (version 9.2, SAS Institute Inc., Cary, NC). Variables are presented in tables as means with standard deviations. MIXED models for repeated measurements, which allow the inclusion of participants with missing data at some time points (24), were performed to determine gender, time and gender by time interaction effects on dependent variables measured. When significant gender by time interactions were observed, simple effects between times and gender were tested to determine precisely the location of the main interaction effect. Pairwise differences between and within gender were further tested with the Tukey-Kramer adjustment. Pearson correlation allowed testing the associations between changes in key variables under study and changes in level of perceived HRQOL in men and women. Key variables identified were the Medscore (indicator of adherence to dietary recommendations promoted through 218 the intervention), eating-related SDI (indicator of motivational mechanism through which behavioral changes should occur according to our theoretical framework) and body weight (which has been repeatedly identified as a predictor of HRQOL and which is likely to decrease in response to a satiating diet such as the MedDiet, even if there is no focus on weight in the intervention. Then, multiple regression analyses were performed in men and women separately to determine the respective contribution of variables associated with changes in perceived HRQOL using a stepwise model procedure. For those analyses, level of HRQOL at baseline was also entered into the model. For variables not normally distributed, a transformation was performed but these variables are presented as raw data in the tables. The probability level for significance used for the interpretation of all statistical analyses was set at a level of P 0.05. RESULTS Characteristics of men and women at baseline have been reported previously (17) . In sum, men and women were about the same age, but men had higher body weight and waist circumference and a more deteriorated metabolic profile than women. Moreover, diet quality as represented by the Medscore was similar in men and women at baseline. Level of perceived HRQOL in men and women at baseline Table 1 shows level of perceived HRQOL in men and women at baseline. No significant gender difference was observed in the global HRQOL score and neither in the eight different domains nor in the two summary scales (physical component and mental component). Changes in perceived HRQOL in men and women, in response to the nutritional intervention and at follow-up Changes in perceived HRQOL in men and women are presented in Table 2. No gender difference was observed for changes in the global HRQOL score and for its eight different domains as well as for the two summary scales (physical component and mental 219 component). However, a significant time effect was found for both men and women in the global HRQOL score (P = 0.006), more specifically with significant increases at 3 months after the end of the nutritional intervention (6-month follow-up) (P = 0.01). Similarly, a significant time effect was observed in vitality (P = 0.03), with scores significantly higher at 6-month follow-up compared to baseline (P = 0.05). A significant time effect was also noted for physical functioning (P = 0.0003), with scores significantly higher at 6-month follow-up compared to baseline (P = 0.01). As for general health, a trend for a gender by time interaction was observed (P = 0.08), with scores significantly higher at 6-month follow-up compared to baseline in both genders but which tend to be larger in men than in women. As for the two summary scales, a significant time effect was observed in the mental component only (P = 0.03). Factors predicting changes in HRQOL at 6-month follow-up, according to gender As most of the changes in HRQOL reached significance at 6-month follow-up, correlation analysis was performed between changes in key variables (i.e., changes in the Medscore, eating-related SDI and body weight) and changes in the global HRQOL score from baseline to 6-month follow-up (3 months after the end of the intervention). As shown in Table 3, changes in the Medscore and changes in eating-related SDI were significantly and positively associated with changes in the global HRQOL score in men only (P = 0.05 and P = 0.03, respectively). In women, no significant correlation was observed between changes in key variables and changes in global HRQOL. In both genders, no association was found between changes in body weight and changes in HRQOL. Regression analyses revealed that increases in eating-related SDI predicted improvements in global HRQOL (ß = 0.54, r2 = 0.10, P = 0.03) at 6-month follow-up, over and above level of perceived HRQOL at baseline, in men. In women, only the level of perceived HRQOL at baseline was found to be a significant predictor of changes in HRQOL in women, i.e., a greater level of perceived HRQOL at baseline predicted less improvement in global HRQOL (ß = -0.17, r2 = 0.11, P = 0.03) at 6-month follow-up. 220 DISCUSSION The aim of our study was to document changes in the level of perceived HRQOL following a 12-week nutritional intervention program promoting the MedDiet and based on the SelfDetermination Theory, and to identify significant predictors related to these changes, in men and women distinctively. The intervention led to perception of a better HRQOL overall and to improvement in different domains of HRQOL, i.e. vitality, physical functioning and general health, in both men and women. Although men and women showed similar changes related to perceived HRQOL, we found that factors predicting those changes were not the same in men and women. No gender difference was found in perceived level of HRQOL and its different domains at baseline and neither following the nutritional intervention. Despite similar changes in HRQOL in both genders, we wanted to determine if factors contributing to those changes were similar in men and women as gender differences in determinants of HRQOL have been previously reported in the context of CVD (25, 26) . Contrary to other studies (10, 11) , decreases in body weight observed in our study were not associated with improvement in HRQOL. We found that greater increases in eating-related self-determined motivation, i.e. internalization of motivational factors related to the adoption of healthy eating, predicted improvement in overall HRQOL in men. Moreover, despite a positive univariate association between a greater adherence to the MedDiet and improvement in HRQOL, an increase in adherence to the MedDiet was not an independent predictor of HRQOL in men. Our results suggest that the process of change in eating-related self-determined motivation, rather than dietary changes per se, led to improvement in global HRQOL in men. The SelfDetermination Theory postulates that satisfaction of the needs for autonomy, competency and relatedness fosters the development of self-determined motivation and favour wellbeing (21) . Accordingly, our intervention was based on Self-Determination Theory and aimed to support individuals’ needs for autonomy, competency and relatedness regarding the regulation of eating, in order to promote eating-related self-determined motivation, which has been found to predict improvement in HRQOL in men. Similar findings have 221 been observed regarding self-determined motivation and quality of life in studies promoting physical activity (27, 28) . Our results thus underline the importance to consider motivational factors in the context of a nutritional approach targeting men. In women, level of HRQOL at baseline was the only significant predictor related to global HRQOL, with a greater level of HRQOL at baseline leading to more limited improvement in global HRQOL. These results suggest that assessment of characteristics related to HRQOL before the beginning of the intervention seems relevant to determine the potential of improvement in HRQOL following a nutritional intervention in women. It is important to underline that this association between baseline HRQOL and changes in HRQOL was not observed in men, suggesting that a higher level of HRQOL at baseline would not act as a barrier to improvement in men. Nevertheless, questions remain regarding other factors related to our nutritional intervention that could not be captured in the present study and that could have influenced changes observed in HRQOL in women. Although our findings cannot be extrapolated to the general Canadian population, originality of this paper arises from the fact that the impact of nutritional interventions on changes in HRQOL has rarely been assessed without focusing on weight control. Although positive changes in HRQOL were observed in response to our nutritional intervention and could represent meaningful information for health professionals, interpretation of our findings as regard to clinical implications remains limited as no consensus seems to exist regarding what is a clinically meaningful change in HRQOL (29) . Despite the fact that improvement in CVD risk factors should remain the cornerstone in the development of nutritional approaches in the context of CVD prevention, HRQOL should be assessed as it can provide additional health-related information about the clients. Although it is usually suggested that changes in dietary habits can favor an improvement in HRQOL, it also has to be kept in mind that an improvement in HRQOL can in turn favour a better adherence to dietary recommendations, as previously reported (30, 31). In conclusion, despite similar beneficial changes in perceived HRQOL in men and women in response to our nutritional intervention program, gender differences were found in factors predicting those changes. These results suggest that a gender approach should be 222 used when aiming at improving HRQOL through intervention modalities. ACKNOWLEDGEMENTS This research project was supported by the Canadian Institutes of Health Research (MOP 84568) and Heart and Stroke Foundation of Quebec (2007-180). Canadian Institutes of Health Research and Heart and Stroke Foundation of Quebec had no role in the study design, collection, analysis or interpretation of the data, writing the manuscript, or the decision to submit the paper for publication. V.L. is a recipient of a doctoral scholarship from the Fonds de recherche du Québec - Santé (FRQS). AUTHORSHIP The authors’ contributions are as follow: V.L. was in charge of the analysis and interpretation of data and drafted the manuscript; C.B. contributed to the conception and design of the study as well as to the interpretation of data; L.C. and S.D. contributed to the conception and design of the study; S.L. (corresponding author) was responsible for the conception and design of the study and contributed to the interpretation of data. All of the authors have read and approved the final version of the manuscript submitted for publication. CONFLICT OF INTEREST Authors report no conflict of interest. 223 REFERENCES 1. Garster NC, Palta M, Sweitzer NK, Kaplan RM & Fryback DG (2009) Measuring health-related quality of life in population-based studies of coronary heart disease: comparing six generic indexes and a disease-specific proxy score. Qual Life Res 18, 1239-1247. 2. Maddigan SL, Feeny DH & Johnson JA (2005) Health-related quality of life deficits associated with diabetes and comorbidities in a Canadian National Population Health Survey. Qual Life Res 14, 1311-1320. 3. Finks SW, Airee A, Chow SL, Macaulay TE, Moranville MP, Rogers KC & Trujillo TC (2012) Key articles of dietary interventions that influence cardiovascular mortality. Pharmacotherapy 32, e54-87. 4. NCEP ATP III (2002) Third report of the National Cholesterol Education Program (NCEP) expert panel on detection, evaluation, and treatment of high blood cholesterol in adults (adult treatment panel III) final report. Circulation 106, 3143–3421. 5. Estruch R, Ros E, Salas-Salvado J, Covas MI, Pharm D, Corella D, Aros F, GomezGracia E, Ruiz-Gutierrez V, Fiol M, Lapetra J, Lamuela-Raventos RM, Serra-Majem L, Pinto X, Basora J, Munoz MA, Sorli JV, Martinez JA & Martinez-Gonzalez MA (2013) Primary Prevention of Cardiovascular Disease with a Mediterranean Diet. N Engl J Med. 6. Sofi F, Abbate R, Gensini GF & Casini A (2010) Accruing evidence on benefits of adherence to the Mediterranean diet on health: an updated systematic review and metaanalysis. Am J Clin Nutr 92, 1189-1196. 7. Munoz MA, Fito M, Marrugat J, Covas MI & Schroder H (2009) Adherence to the Mediterranean diet is associated with better mental and physical health. Br.J Nutr 101, 1821-1827. 8. Goulet J, Lamarche B, Nadeau G & Lemieux S (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis. 170, 115-124. 9. Bemelmans WJ, Broer J, de Vries JH, Hulshof KF, May JF & Meyboom-De Jong B (2000) Impact of Mediterranean diet education versus posted leaflet on dietary habits and serum cholesterol in a high risk population for cardiovascular disease. Public Health Nutr 3, 273-283. 10. Ross KM, Milsom VA, Rickel KA, Debraganza N, Gibbons LM, Murawski ME & Perri MG (2009) The contributions of weight loss and increased physical fitness to improvements in health-related quality of life. Eat Behav 10, 84-88. 224 11. Yancy WS, Jr., Almirall D, Maciejewski ML, Kolotkin RL, McDuffie JR & Westman EC (2009) Effects of two weight-loss diets on health-related quality of life. Qual Life Res 18, 281-289. 12. Pelletier LG, Dion SC, Slovinec-D'Angel M & Reid R (2004) Why Do You Regulate What You Eat? Relationships Between Forms of Regulation, Eating Behaviors, Sustained Dietary Behavior Change, and Psychological Adjustment. Motivation and Emotion 28, 245-277. 13. Hopman WM, Towheed T, Anastassiades T, Tenenhouse A, Poliquin S, Berger C, Joseph L, Brown JP, Murray TM, Adachi JD, Hanley DA & Papadimitropoulos E (2000) Canadian normative data for the SF-36 health survey. Canadian Multicentre Osteoporosis Study Research Group. CMAJ 163, 265-271. 14. Wardle J, Haase AM, Steptoe A, Nillapun M, Jonwutiwes K & Bellisle F (2004) Gender differences in food choice: the contribution of health beliefs and dieting. Ann Behav Med 27, 107-116. 15. Arganini CSA, Comitato R, Virgili F & Turrini A (2012) Gender differences in food choice and dietary intake in modern western societies. Public Health Soc Behav Health Prof. Jay Maddock (ed.). Available at: http://www.intechopen.com/books/publichealth-social-and-behavioral-health/gender-differences-in-food-choice-and-dietaryintake-in-modern-western-societies. 16. Provencher V, Drapeau V, Tremblay A, Despres JP & Lemieux S (2003) Eating behaviors and indexes of body composition in men and women from the Quebec family study. Obes Res 11, 783-792. 17. Leblanc V, Hudon A-M, Royer M-M, Corneau L, Dodin S, Bégin C & Lemieux S (2015) Differences between men and women in dietary intakes and metabolic profile in response to a 12-week nutritional intervention promoting the Mediterranean diet. Nutritional Science 4(e13), 1-11. 18. Ware JE, Jr. (2000) SF-36 health survey update. Spine (Phila Pa 1976) 25, 3130-3139. 19. Ware JE & Kosinski M (2001) Interpreting SF-36 summary health measures: a response. Qual Life Res 10, 405-413; discussion 415-420. 20. Goulet J, Nadeau G, Lapointe A, Lamarche B & Lemieux S (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J 3, 13. 21. Ryan RM & Deci EL (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol 55, 68-78. 22. Vallerand RJ (1997) Toward a hierarchical model of intrinsic and extrinsic motivation. In Advances in Experimental Social Psychology, ed. M.P. Zanna, pp. 271-360. New York, NY: Academic Press. 225 23. Lohman T, Roche A & Artorel R (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. 24. Beunckens C, Molenberghs G & Kenward MG (2005) Direct likelihood analysis versus simple forms of imputation for missing data in randomized clinical trials. Clin Trials 2, 379-386. 25. Duenas M, Ramirez C, Arana R & Failde I (2011) Gender differences and determinants of health related quality of life in coronary patients: a follow-up study. BMC Cardiovasc Disord 11, 24. 26. Emery CF, Frid DJ, Engebretson TO, Alonzo AA, Fish A, Ferketich AK, Reynolds NR, Dujardin JP, Homan JE & Stern SL (2004) Gender differences in quality of life among cardiac patients. Psychosom Med 66, 190-197. 27. Riiser K, Ommundsen Y, Smastuen MC, Londal K, Misvaer N & Helseth S (2014) The relationship between fitness and health-related quality of life and the mediating role of self-determined motivation in overweight adolescents. Scand J Public Health 42, 766-772. 28. Rahman RJ, Hudson J, Thogersen-Ntoumani C & Doust JH (2015) Motivational processes and well-being in cardiac rehabilitation: a self-determination theory perspective. Psychol Health Med, 1-12. 29. Martinez-Gonzalez MA, Lopez-Fontana C, Varo JJ, Sanchez-Villegas A & Martinez JA (2005) Validation of the Spanish version of the physical activity questionnaire used in the Nurses' Health Study and the Health Professionals' Follow-up Study. Public Health Nutr 8, 920-927. 30. Warkentin LM, Das D, Majumdar SR, Johnson JA & Padwal RS (2014) The effect of weight loss on health-related quality of life: systematic review and meta-analysis of randomized trials. Obes Rev 15, 169-182. 31. Carson TL, Hidalgo B, Ard JD & Affuso O (2014) Dietary interventions and quality of life: a systematic review of the literature. J Nutr Educ Behav 46, 90-101. 226 )LJXUH'HVFULSWLRQRIWKHZHHNQXWULWLRQDOLQWHUYHQWLRQSURJUDPDQGPHDVXUHPHQWVSHUIRUPHGDWEDVHOLQH7 DIWHUWKHHQGRI WKH LQWHUYHQWLRQ 7 PRQWKV DQG WKHQ DW DQG PRQWK IROORZXS PRQWKV DQG PRQWKV DIWHU WKH HQG RI WKH LQWHUYHQWLRQUHVSHFWLYHO\ Table 1. Characteristics of health-related quality of life in men and women at baseline Physical functioning Role functioning: Physical Bodily pain General health Vitality Social functioning Role functioning: Emotional Mental health Global health-related quality of life score Physical component scale Mental component scale SD : Standard deviation. 228 Men Baseline n = 64 91.7 86.8 78.9 70.2 58.9 85.9 82.4 68.1 77.9 52.6 44.9 SD 9.8 17.2 18.6 16.5 14.6 17.3 21.6 9.7 10.6 6.0 7.8 Women Baseline SD n = 59 89.7 11.2 85.7 18.4 76.1 21.9 72.6 16.6 57.7 12.8 81.4 19.3 83.1 19.4 67.5 11.5 76.7 11.0 52.1 7.7 44.4 7.8 Table 2. Changes in health-related quality of life in men and women in response to the 12-week nutritional intervention program (T=3 months), and at 6 and 9-month follow-up Men Variables Physical functioning Baseline T=3 months T=6 months T=9 months Role functioning: Physical Baseline T=3 months T=6 months T=9 months Bodily pain Baseline T=3 months T=6 months T=9 months General health Baseline T=3 months T=6 months T=9 months Mean 91.7 93.1 94.1 * 94.7 * 86.8 84.5 88.5 86.0 78.9 80.5 81.4 82.4 70.2 74.6 * 75.7 * 74.5 Women SD 9.8 9.9 7.5 5.9 17.2 21.5 18.0 19.7 18.6 22.0 18.0 20.1 16.5 18.2 16.9 18.4 Mean 89.7 90.2 92.5 * 91.4 * 85.7 84.4 86.1 81.7 76.1 79.2 79.9 77.2 72.6 73.2 * 72.6 * 73.8 Gender differences Time effect SD Gender x time interaction P P P 0.19 < 0.0001 0.88 0.47 0.07 0.86 0.29 0.46 0.82 0.77 0.01 0.08 11.2 13.5 11.5 15.9 18.4 17.7 19.1 21.4 21.9 21.4 18.3 21.5 16.6 16.0 15.2 16.3 229 Table 2. Changes in health-related quality of life in men and women in response to the 12-week nutritional intervention program (T=3 months), and at the 6 and 9-month follow-up (continued) Men Women Gender x time Gender differences Time effect interaction Variables Mean SD Mean SD P P P Vitality Baseline T=3 months T=6 months T=9 months Social functioning Baseline T=3 months T=6 months T=9 months Role functioning: Emotional Baseline T=3 months T=6 months T=9 months Mental health Baseline T=3 months T=6 months T=9 months 230 58.9 61.1 63.4 * 62.0 85.9 86.8 89.3 88.7 82.4 83.3 85.5 83.1 68.1 69.0 70.2 70.3 14.6 13.2 12.0 14.5 17.3 19.7 14.9 17.4 21.6 21.3 21.0 21.7 9.7 10.2 9.8 11.1 57.7 60.7 59.2 * 58.0 81.4 84.9 86.4 83.2 83.1 84.0 84.3 79.2 67.5 67.6 69.1 65.0 0.32 0.03 0.46 0.24 0.07 0.80 0.64 0.16 0.90 0.24 0.29 0.13 12.8 13.5 13.6 14.5 19.3 20.1 18.0 20.2 19.4 20.4 18.2 24.1 11.5 12.4 11.1 14.0 Table 2. Changes in health-related quality of life in men and women in response to the 12-week nutritional intervention program (T=3 months), and at the 6 and 9-month follow-up (continued) Men Women Gender x time Gender differences Time effect interaction Variables Mean SD Mean SD P P P 0.36 0.01 0.74 Global quality of life score Baseline 77.9 10.6 76.7 11.0 T=3 months 79.0 12.2 78.1 12.9 T=6 months 81.0 * 11.6 78.8 * 11.4 T=9 months 80.2 12.0 76.2 14.6 Physical component scale 0.60 0.12 0.91 Baseline 52.6 6.0 52.1 7.7 T=3 months 53.3 7.3 52.6 7.2 T=6 months 54.0 5.3 53.1 7.2 T=9 months 53.9 6.0 52.9 8.4 Mental component scale 0.39 0.03 0.67 Baseline 44.9 7.8 44.4 7.8 T=3 months 45.6 7.7 45.3 8.0 T=6 months 46.6 7.6 45.6 7.6 T=9 months 46.0 ¶ 8.6 43.3 ¶ 9.5 Proc Mixed procedure performed with n= 63, 57, 49 and 44 men and n= 59, 49, 44 and 44 women, at baseline (t= 0), 3, 6 and 9 months respectively. T=3 months : end of the intervention; T=6 months : 3 months after the end of the intervention; T=9 months : 6 months after the end of the intervention. SD: Standard déviation. * Mean value significantly different than baseline value according to gender at P ≤ 0.05. ¶ Trend for a significant decrease compared to the mean value at 6 months (3-month post intervention) at P = 0.08. 231 Table 3. Associations between changes in the Medscore, eating-related self-determined motivation and body weight and changes in global HRQOL in men and women from baseline to 6-month follow-up* Δ Medscore Δ Eating-related SDI Δ Body weight r P r P r P Δ Global HRQOL in men 0.28 0.05 0.31 0.03 -0.007 0.96 Δ Global HRQOL in women -0.10 0.50 0.08 0.63 0.20 0.18 * 6-month follow-up : 3 months after the end of the intervention. Pearson correlation performed with n= 49 men and n= 44 women. Δ: Changes from baseline (t=0) to 3-month post intervention. 232 CHAPITRE 8 : Conclusion générale 233 Malgré une diminution du taux de mortalité lié aux MCV dans la population canadienne dans les dernières décennies (Agence de la santé publique du Canada, 2015), plusieurs individus sont encore touchés par ces maladies, ce qui soutient le besoin de continuer à déployer des efforts en prévention. L’adoption de saines habitudes alimentaires constitue un aspect primordial dans la prévention des MCV et l’alimentation méditerranéenne est reconnue comme une référence à cet égard, notamment en raison de ses bienfaits sur la santé cardiovasculaire. Dans un contexte de changement des habitudes et comportements alimentaires, la motivation est reconnue comme un facteur déterminant, mais peu d’études ont évalué l’importance de la qualité de la motivation dans les changements alimentaires jusqu’à maintenant. À cet égard, la théorie de l’autodétermination soutient que le maintien d’un comportement est le résultat du niveau de motivation autodéterminée d’un individu (Deci & Ryan, 1985; Ryan & Deci, 2000). Des études ont d’ailleurs démontré qu’un comportement régulé via une motivation autodéterminée prédispose au maintien de saines habitudes alimentaires à long terme (Pelletier et al., 2004; Williams et al., 1996). D’autre part, des différences relatives au genre sont rapportées à l’égard des habitudes et comportements alimentaires, ce qui supporte la nécessité de considérer les hommes et les femmes distinctement dans le contexte d’une intervention nutritionnelle. Considérant le potentiel de l’alimentation méditerranéenne dans la prévention de MCV, mais également la difficulté pour certains individus à adhérer aux recommandations alimentaires, il s’avérait impératif d’examiner les différences entre les hommes et les femmes quant à l’impact de facteurs liés à la motivation dans la réponse à une intervention nutritionnelle visant l’adoption de l’alimentation méditerranéenne. Dans le cadre de cette thèse, notre principal objectif visait à déterminer les différences entre les hommes et les femmes dans leur réponse à un programme d’éducation en nutrition de 12 semaines visant l’adoption d’une alimentation de type méditerranéen et basé sur la théorie de l’autodétermination, plus spécifiquement dans les changements alimentaires, anthropométriques, métaboliques et liés à la qualité de vie. Globalement, nos travaux ont démontré que le programme d’éducation en nutrition basé sur une approche motivationnelle a contribué à l’amélioration des apports alimentaires et à la diminution de facteurs de risque cardiovasculaire, plus particulièrement chez les hommes. De plus, le fait que les niveaux 235 d’activité physique soient demeurés stables tout au long de l’intervention à la fois chez les hommes et les femmes permet de confirmer l’impact positif de notre intervention nutritionnelle sur la diminution des facteurs de risque cardiovasculaire, via une amélioration des apports alimentaires. Dans un premier temps, nos résultats ont permis de caractériser les hommes et les femmes selon leur profil motivationnel, ainsi que leurs apports et comportements alimentaires avant le début de l’intervention nutritionnelle. Tel que présumé, les femmes démontraient un niveau de motivation autodéterminée plus élevé que les hommes, sans compter que leur motivation était associée à une alimentation plus saine et à un profil anthropométrique plus favorable, ce qui n’était pas le cas chez les hommes. Nos résultats observés chez les femmes concordent avec les travaux de Pelletier et al. rapportant qu’une motivation autodéterminée plus élevée est associée à des apports et comportements alimentaires prédisposant à une régulation plus saine du poids chez les femmes (Pelletier et al., 2004). Le fait de constater que les hommes et les femmes ne présentent pas le même niveau de motivation autodéterminée au départ suggère que leurs facteurs de motivation à l’égard de l’alimentation ne sont pas les mêmes, ce qui confirme la pertinence d’évaluer la qualité de la motivation et de considérer les différentes caractéristiques des individus, dont le genre, dès le début d’une démarche nutritionnelle, afin de mieux répondre à leurs besoins. À notre connaissance, aucune étude ne semble avoir examiné la relation entre la motivation autodéterminée à l’égard de l’alimentation et la qualité de l’alimentation selon le genre jusqu’à maintenant, ce qui ne permet pas de comparer nos résultats à la littérature. Cependant, on peut supposer que l’implication plus importante des femmes dans la préparation des repas rapportée dans notre étude pourrait en partie expliquer le niveau de motivation autodéterminée plus élevé chez ces dernières. En effet, les femmes demeurent les personnes principalement en charge de la préparation des repas pour la famille avec environ le double du temps consacré à cette tâche en comparaison avec les hommes (Blake et al., 2009; Murcott, 2000). Certains auteurs suggèrent toutefois une diminution de l’écart entre les hommes et les femmes quant au rôle attribué pour la préparation des repas, avec 20% des couples mariés affirmant partager la responsabilité de cuisiner pour la famille 236 (Blake et al., 2009; Murcott, 2000). Ces données amènent à penser que les rôles et responsabilités attribués aux hommes et aux femmes dans la société sont en processus de changement, et que le portrait quant aux facteurs de motivation pourrait aussi changer advenant le cas où l’implication des hommes augmentait dans le contexte de l’alimentation. Nos travaux ont démontré que les hommes et les femmes augmentaient de façon similaire leur adhésion à l’alimentation méditerranéenne en réponse à l’intervention nutritionnelle, mais avec une amélioration plus prononcée de certaines composantes alimentaires, ce qui confirme notre hypothèse de départ. Des limites semblables ont été observées chez les hommes et les femmes face au maintien des changements alimentaires après l’intervention nutritionnelle de 12 semaines. En parallèle, le programme d’éducation en nutrition qui visait à promouvoir la motivation autodéterminée a mené à une amélioration globale plus importante de la motivation autodéterminée chez les hommes que chez les femmes, avec un retour vers les valeurs de départ au cours de la période de suivi chez les hommes et les femmes. Par ailleurs, dans le cadre de notre intervention, une augmentation de la motivation autodéterminée était associée à une meilleure adhésion à l’alimentation méditerranéenne chez les hommes seulement. Le fait que les femmes présentaient une alimentation se rapprochant davantage des principes de l’alimentation méditerranéenne avant l’intervention peut expliquer en partie l’amélioration plus limitée de certains changements alimentaires spécifiques en comparaison avec les hommes, en réponse à l’intervention. Nos observations concordent avec les travaux de Zazpe et al. qui ont démontré un meilleur succès de leur intervention en termes de changements alimentaires auprès des hommes qu’auprès des femmes (Zazpe et al., 2010). Par contre, la présence de différences entre les hommes et les femmes demeure malgré l’ajustement pour les valeurs de départ, ce qui indique que d’autres facteurs liés au genre sont impliqués dans le potentiel des changements alimentaires en réponse à l’intervention. 237 Considérant que le programme d’éducation en nutrition a mené à une augmentation plus importante de la motivation autodéterminée chez les hommes que chez les femmes, et qu’une association entre les changements de motivation et les changements dans l’adhésion à l’alimentation méditerranéenne a été observée chez les hommes seulement, on peut émettre l’hypothèse selon laquelle des aspects de l’intervention ont été plus appropriés afin d’améliorer la qualité de l’alimentation chez les hommes. D’abord, l’intervention était basée sur une approche motivationnelle visant essentiellement à soutenir la satisfaction des besoins d’autonomie, de compétence et du sentiment d’attachement des hommes et des femmes. En ce sens, certaines études évoquent l’importance pour les hommes de se sentir autonomes dans leur démarche dans un contexte de prévention de MCV (Addis & Mahalik, 2003; Mroz et al., 2011). D’autre part, il est possible que les hommes aient davantage bénéficié de certains outils utilisés via l’approche motivationnelle dans leur processus de changement. En effet, des évidences soutiennent que les hommes seraient plus ambivalents que les femmes à l’égard des choix alimentaires sains (Povey et al., 2001; Sparks et al., 2001) et seraient plus nombreux à ne pas savoir comment prendre action afin de maintenir un bon état de santé (Haidinger et al., 2012). Dans le contexte de l’intervention, la balance décisionnelle, soit un outil visant à résoudre l’ambivalence face au changement par l’exploration des avantages et désavantages perçus au changement, constituait un outil utilisé lors de la première rencontre individuelle. La balance décisionnelle pouvait être réutlisée aux rencontres subséquentes selon les besoins spécifiques des individus, par exemple en présence d’ambivalence. Les hommes et les femmes devaient également compléter un plan d’action afin de formuler en détails leurs objectifs de changements alimentaires ainsi que les stratégies favorables potentielles pour y parvenir, soit un autre outil du programme d’intervention. Le plan d’action fut utilisé tout au long de l’intervention, avec le soutien nécessaire de la part de la nutritionniste. En définitive, il est probable que l’approche en soi ainsi que les outils d’intervention utilisés se soient avérés plus appropriés pour les hommes et favorables aux changements alimentaires. L’amélioration plus limitée de la motivation autodéterminée chez les femmes s’explique possiblement en raison de leur niveau de motivation plus élevé au départ. Il est ainsi probable que l’impact de l’approche motivationnelle visant à soutenir la satisfaction des 238 besoins psychologiques ait été plus limité chez les femmes, ce qui ne peut toutefois pas être affirmé avec certitude. Afin de mieux comprendre les changements de motivation observés chez les hommes et les femmes, il aurait été intéressant de pouvoir évaluer la satisfaction des besoins d’autonomie, de compétence et du sentiment d’attachement non seulement avant l’intervention, mais également suite à l’intervention. Pour ce faire, il serait approprié de développer un questionnaire permettant d’évaluer la satisfaction de ces besoins dans le contexte spécifique de l’alimentation. La disponibilité d’un tel questionnaire aurait permis d’interpréter plus clairement l’impact de l’intervention sur les changements de motivation et les changements alimentaires. Nos résultats permettent de confirmer partiellement notre hypothèse de départ qui suggérait que les hommes et les femmes qui amélioreraient leur niveau de motivation autodéterminée augmenteraient davantage leur niveau d’adhésion à l’alimentation méditerranéenne. Il demeure difficile d’expliquer l’absence d’association chez les femmes à cet égard, mais il semble que le niveau de motivation autodéterminée plus élevé au départ ne permette pas d’expliquer ces résultats. Néanmoins, il est possible que les facteurs de motivation aient été plus conscients et plus clairement identifiés dès le départ chez les femmes, ce qui pourrait expliquer la présence d’une amélioration de leur adhésion à l’alimentation méditerranéenne en réponse à l’intervention, indépendamment des changements de motivation. En appui à ces propos, nos travaux ont permis de constater que les femmes ayant un niveau de motivation autodéterminée plus élevé au départ présentaient une meilleure adhésion aux principes de l’alimentation méditerranéenne à la fin de l’intervention nutritionnelle. À cet égard, certaines stratégies post-motivationnelles visant à faciliter le passage de l’intention à l’action des personnes déjà motivées à agir, par exemple l’élaboration d’un plan d’action, sont proposées dans la littérature (Godin, 2012), ce qui soutient l’idée que les femmes peuvent tout de même avoir tiré profit du programme d’éducation en nutrition pour modifier leurs habitudes alimentaires. De plus, il est à noter que certains facteurs modérateurs pourraient influencer l’efficacité de l’activation des intentions, notamment les habitudes (Godin, 2012). D’autre part, le contexte familial pourrait s’avérer un autre facteur important ayant pu limiter l’impact des changements de motivation autodéterminée dans la mise en action, c’est-à-dire dans l’adoption de changements alimentaires sains. Plus 239 spécifiquement, selon certains auteurs les femmes sont plus susceptibles de sacrifier leurs habitudes alimentaires afin de satisfaire les préférences alimentaires de leur famille (Sarkadi & Rosenqvist, 2002). De plus, des travaux menés dans le contexte de la prise en charge du diabète suggèrent que les femmes soutiennent leur conjoint dans les changements alimentaires effectués alors que les hommes démontrent un soutien moindre envers leur conjointe à cet égard (Wong et al., 2005; Sandberg et al., 2006). Enfin, les femmes déplorent davantage le manque de soutien et la présence de pression de la part de la famille concernant l’alimentation. Ces données amènent à penser que le contexte familial pourrait exercer une influence plus importante sur les habitudes alimentaires des femmes que des hommes. Dans le cadre de notre étude, plusieurs facteurs peuvent être mis en cause et avoir brouillé l’association entre les changements de motivation autodéterminée et les changements dans l’adhésion à l’alimentation méditerranéenne chez les femmes, notamment le contexte familial. Considérant que les femmes de notre étude étaient davantage en charge de l’achat et de la préparation des aliments comparativement aux hommes, il est possible que ces dernières aient accordé une importance plus grande que les hommes à l’acceptabilité de l’alimentation méditerranéenne par les autres membres de la famille, et que cela ait pu contrecarrer les effets des changements de motivation dans l’amélioration de l’alimentation et possiblement limiter l’ampleur des changements alimentaires notés chez les femmes. Il serait intéressant dans des études futures d’examiner plus spécifiquement l’impact de diverses variables modératrices et médiatrices, par exemple le concept de l’habitude et le contexte familial, afin de clarifier si certains facteurs permettent d’expliquer qu’une augmentation de la motivation autodéterminée ne se traduit pas directement par une amélioration de la qualité de l’alimentation chez les femmes. Nos observations permettent de mettre en lumière les difficultés éprouvées par les hommes et les femmes à maintenir les changements alimentaires une fois l’intervention terminée. Plusieurs éléments peuvent être mis en cause afin d’expliquer le retour vers les valeurs de départ de certaines composantes de l’alimentation méditerranéenne. Il est possible que certains changements alimentaires aient été difficiles à maintenir en raison du fait qu’ils consistaient soit à intégrer des aliments qui étaient peu familiers, soit à diminuer la consommation d’aliments qui occupaient une place importante dans leur alimentation au 240 départ. D’autre part, la transition entre la fin du programme d’éducation en nutrition intensif de 12 semaines et la période de suivi, où aucun contact supplémentaire n’avait lieu entre l’intervenant et les participants, a pu être perçue comme trop drastique et aussi avoir contribué à limiter le maintien des changements alimentaires. Outre ces aspects d’ordre individuel, certains facteurs environnementaux propres au contexte québécois peuvent avoir influencé la capacité des hommes et des femmes à maintenir l’adhésion à l’alimentation méditerranéenne, comme par exemple la disponibilité et l’accessibilité plus limitées d’aliments fréquemment consommés traditionnellement dans les pays méditerranéens. Quoiqu’il en soit, à la fin de la période de suivi, le niveau d’adhésion à l’alimentation méditerranéenne était plus élevé qu’au départ chez les hommes, ce qui permet de confirmer l’impact positif de l’intervention nutritionnelle sur l’amélioration de la qualité de l’alimentation, plus particulièrement chez les hommes. D’ailleurs, les changements anthropométriques et métaboliques observés permettent d’appuyer les effets plus importants de l’intervention nutritionnelle dans l’adoption de l’alimentation méditerranéenne chez les hommes. Cependant, aucune différence liée au genre n’a été notée en ce qui a trait au changement dans la perception du niveau de qualité de vie relative à la santé, ce qui confirme partiellement notre hypothèse de départ, qui suggérait que les hommes bénéficieraient davantage du programme d’éducation en nutrition visant l’adoption d’une alimentation de type méditerranéen par une amélioration plus importante de leur profil métabolique et de leur niveau de qualité de vie. Nos résultats amènent à penser que les changements physiologiques observés découlent des effets rassasiants attribués à l’alimentation méditerranéenne (Schroder et al., 2004), mais aussi possiblement des changements notés dans les comportements alimentaires des hommes puisque ceux ayant le plus diminué leur niveau de désinhibition avaient tendance à avoir davantage diminué leur poids corporel. Enfin, sans pouvoir définir leur contribution exacte, il est probable qu’une partie de nos résultats s’expliquent par la présence de différences sexuelles. Plus précisément, des études soutiennent qu’en réponse à des changements dans les habitudes de vie, les hommes sont plus susceptibles que les femmes de diminuer leur circonférence de la taille, via une mobilisation préférentielle du tissu adipeux abdominal (Lemieux et al., 1993; Smith & Zachwieja, 1999). Par ailleurs, il est bien établi dans la 241 littérature qu’une diminution du tissu adipeux abdominal contribue à l’amélioration de certains facteurs de risque liés aux MCV (Bastien et al., 2014). Ces travaux concordent avec nos résultats observés chez les hommes, ce qui souligne l’importance de considérer le sexe, au-delà des différences relatives au genre, dans le contexte de la régulation des apports alimentaires et de l’impact potentiel d’une intervention nutritionnelle sur la santé cardiovasculaire. Concernant plus spécifiquement les hommes, plusieurs évidences indiquent que ces derniers constituent une population difficile à rejoindre dans le contexte d’une démarche visant l’amélioration des comportements et habitudes alimentaires, et ce, malgré le fait qu’ils présentent une prévalence de MCV plus élevée que les femmes (Taylor et al., 2013). La littérature soutient la pertinence de s’intéresser plus particulièrement aux intérêts des hommes dans le but de développer des interventions nutritionnelles adaptées à leurs besoins. Dans cet ordre d’idées, nos résultats permettent de confirmer la faisabilité pour les hommes d’adhérer aux principes de l’alimentation méditerranéenne dans le contexte québécois. De telles données ont été précédemment rapportées chez les femmes (Goulet et al., 2003), mais la faisabilité d’adopter l’alimentation méditerranéenne chez les hommes québécois demeurait non documentée jusqu’maintenant. De plus, le recours à l’entretien motivationnel dans le contexte d’une intervention nutritionnelle développée selon les construits de la théorie de l’autodétermination semble une approche clinique prometteuse, plus particulièrement auprès des hommes. Cette hypothèse est d’ailleurs soutenue par les travaux de Maindal et al. rapportant qu’un programme d’intervention nutritionnelle mené auprès de personnes diabétiques et visant à favoriser la motivation autodéterminée, le sentiment de compétence et l’expérimentation à travers des rencontres individuelles et de groupe, s’avère plus bénéfique aux hommes qu’aux femmes (Maindal et al., 2011). En termes de perspectives futures de recherche, nos travaux soulignent la pertinence de s’intéresser plus particulièrement au type, mais également à la durée du soutien offert au cours d’une intervention nutritionnelle visant des changements alimentaires durables à la fois chez les hommes et chez les femmes. La théorie de l’autodétermination postule que le succès d’un changement de comportement ainsi que le maintien du comportement à long 242 terme est prédit en partie par la qualité de l’environnement social d’une personne (Deci et al., 1994). À ce sujet, certaines études indiquent que les individus démontrent une régulation davantage autodéterminée lorsque les personnes importantes dans leur environnement social, par exemple les parents, le conjoint ou les amis, soutiennent la satisfaction de leurs besoins psychologiques fondamentaux (Gorin et al., 2014; Pelletier & Dion, 2007; Williams et al., 2004). D’ailleurs, certaines évidences indiquent que le soutien à l’autonomie provenant d’une personne significative pourrait augmenter l’engagement au changement et les probabilités de rester impliqué dans un processus de changement de comportement (Gorin et al., 2014; Miller et al., 1995). Une étude de Steptoe et al. abonde dans le même sens en indiquant que le soutien social perçu de la part de la famille, d’amis et de collègues avant une intervention prédit l’augmentation de la consommation de fruits et de légumes lors du suivi à 12 mois (Steptoe et al., 2004). Dans le cadre d’études futures, il pourrait s’avérer profitable d’impliquer les personnes significatives dans la démarche nutritionnelle dès le départ, en plus d’offrir le soutien d’une nutritionniste. Cette stratégie permettrait d’outiller la personne significative afin que celle-ci soit en mesure de continuer à épauler l’individu une fois l’intervention terminée. Cette forme de soutien pourrait également être envisagée en pratique clinique dans l’optique de changements durables requérant peu de ressources professionnelles. D’autre part, l’impact d’une intervention moins intense mais prolongée, les effets d’une transition plus progressive entre la fin de l’intervention et la période de suivi, et le potentiel de la création d’un réseau de soutien social en lien avec l’adoption d’une saine alimentation et la prévention de la santé cardiovasculaire mériteraient aussi d’être explorés davantage, et selon le genre. Au-delà du soutien offert à l’individu, d’autres aspects sont susceptibles de favoriser le maintien des changements alimentaires et l’amélioration de la santé chez les hommes et les femmes. Afin d’améliorer l’efficacité des interventions nutritionnelles, dans le contexte de société actuelle où les ressources sont limitées, il est primordial de raffiner nos cibles d’intervention auprès des individus. Pour ce faire, il serait pertinent dans un premier temps de recueillir des données de nature qualitative afin de mieux identifier les barrières et facteurs facilitants liés aux changements alimentaires, plus particulièrement pour le maintien à long terme, et selon le genre. Par ailleurs, on peut penser que les interventions 243 globales, c’est-à-dire celles qui permettent de modifier plusieurs habitudes de vie au cours d’une même intervention, par exemple en intégrant la composante d’activité physique aux changements alimentaires, pourraient accroître l’impact sur la santé. De plus, certaines études suggèrent de favoriser les interventions de groupe puisqu’elles permettent d’offrir un soutien adéquat et exigent moins de ressources financières et humaines qu’un suivi individuel (Endevelt et al., 2015; Yank et al., 2013). Enfin, les diverses technologies telles que le Web et le téléphone cellulaire devraient être davantage exploitées puisqu’elles constituent des outils permettant d’offrir un soutien prolongé aux individus à moindre coût, et qui peuvent également optimiser les communications entre les membres d’un même réseau social. D’un autre côté, puisque les déterminants d’une saine alimentation relèvent d’une part de l’individu, mais aussi du contexte de vie dans lequel celui-ci évolue, tout porte à croire que des efforts doivent continuer à être investis en santé publique afin d’améliorer la disponibilité et l’accessibilité à des aliments sains, pour ainsi optimiser les impacts des interventions nutritionnelles et favoriser le maintien de leurs effets à long terme. Certaines implications pour la pratique clinique en nutrition découlent des travaux présentés dans cette thèse. Nos travaux ont permis de démontrer qu’une intervention nutritionnelle non restrictive, non axée sur la perte de poids et adaptée aux besoins et préférences des hommes et des femmes engendre des impacts positifs sur la qualité de l’alimentation et certains facteurs de risque associés aux MCV. Toutefois, nos résultats ont démontré que les hommes et les femmes répondaient différemment au programme d’éducation en nutrition de 12 semaines, ce qui soutient la pertinence de considérer le genre et le sexe dans le développement des interventions nutritionnelles. Dans un autre ordre d’idées, afin de soutenir les hommes et les femmes dans l’adoption de saines habitudes alimentaires à long terme, il semble souhaitable d’opter pour des approches nutritionnelles qui accordent non seulement une importance à l’amélioration des apports alimentaires, mais également à la régulation de comportements alimentaires sains et au niveau de qualité de vie relative à la santé. Le choix d’une intervention nutritionnelle soutenant la motivation autodéterminée et visant l’adoption des principes de l’alimentation méditerranéenne semble concorder avec cette vision. 244 Une des principales forces se rapportant à l’intervention nutritionnelle développée pour ce projet de recherche relève de la flexibilité de l’approche motivationnelle. En effet, une telle approche possède un important potentiel de spécificité permettant de tenir compte des besoins, habiletés et ressources des hommes et des femmes et a permis de déterminer des objectifs de changements alimentaires qui tenaient compte de leur contexte social et de leur niveau socioéconomique. Cette approche individualisée permet donc de rejoindre et d’intervenir auprès d’une grande partie de la population. Il serait néanmoins intéressant dans une étude future d’évaluer l’impact d’une telle approche sur le risque cardiovasculaire chez des hommes et des femmes présentant des caractéristiques différentes, par exemple un niveau socioéconomique plus faible ou une santé métabolique plus détériorée. Certaines limites en lien avec l’interprétation des travaux présentés dans cette thèse méritent d’être considérées, notamment le fait que l’échantillon n’était pas représentatif de la population générale. En effet, les hommes et les femmes recrutés dans ce projet de recherche présentaient des habitudes alimentaires concordant davantage avec les recommandations du Guide alimentaire canadien et démontraient nécessairement un minimum de motivation au début de l’intervention. Par ailleurs, il importe de garder en tête que dans le cadre de cette étude, le concept du genre a été utilisé de manière dichotomique afin d’améliorer la compréhension de son impact dans un contexte d’intervention nutritionnelle. Cependant, il est évident que le portrait des hommes et des femmes à l’égard de leurs rôles, responsabilités et croyances dans le contexte de l’alimentation n’est pas complètement dissociable l’un de l’autre, et donc qu’en réalité le concept du genre devrait plutôt être considéré selon un continuum (Institute of Gender and Health, 2012). En définitive, cette thèse a permis de mettre en lumière les différences entre les hommes et les femmes quant à l’impact d’une intervention nutritionnelle basée sur une approche motivationnelle. Plus précisément, nos travaux ont permis de démontrer que le programme d’éducation en nutrition de 12 semaines visant l’adoption de l’alimentation méditerranéenne et ayant recours à l’entretien motivationnel a engendré des changements plus prononcés à long terme dans les habitudes alimentaires chez les hommes que chez les femmes, contribuant ainsi à une amélioration plus importante du profil métabolique chez les hommes. 245 BIBLIOGRAPHIE Addis, M.E. & Mahalik, J.R. (2003) Men, masculinity, and the contexts of help seeking. Am Psychol. 58(1):5-14. Agence de la santé publique du Canada. (2015) Le portail canadien des pratiques exemplaires - Maladies cardiovasculaires. Gouvernement du Canada. Disponible : http://cbpp-pcpe.phac-aspc.gc.ca. Agence de la santé publique du Canada. (2009) Suivi des maladies du cœur et des accidents vasculaires cérébraux au Canada. Gouvernement du Canada. Disponible : http://www.phacaspc.gc.ca. Ahluwalia, J.S., Nollen, N., Kaur, H., James, A.S., Mayo, M.S. & Resnicow, K. (2007) Pathway to health: cluster-randomized trial to increase fruit and vegetable consumption among smokers in public housing. Health Psychol. 26(2):214-21. Ajala, O., English, P. & Pinkney, J. (2013) Systematic review and meta-analysis of different dietary approaches to the management of type 2 diabetes. Am J Clin Nutr. 97(3):505-16. Anderson, T.J., Gregoire, J., Hegele, R.A., Couture, P., Mancini, G.B., McPherson, R., Francis, G.A., Poirier, P., Lau, D.C., Grover, S., Genest, J., Jr., Carpentier, A.C., Dufour, R., Gupta, M., Ward, R., Leiter, L.A., Lonn, E., Ng, D.S., Pearson, G.J., Yates, G.M., Stone, J.A. & Ur, E. (2013) 2012 update of the Canadian Cardiovascular Society guidelines for the diagnosis and treatment of dyslipidemia for the prevention of cardiovascular disease in the adult. Can J Cardiol. 29(2):151-67. Arganini CSA, Comitato R, Virgili F & Turrini A. (2012) Gender differences in food choice and dietary intake in modern western societies. Public Health Soc Behav Health. Prof. Jay Maddock (ed.). Disponible : http://www.intechopen.com/books/public-healthsocial-and-behavioral-health/gender-differences-in-food-choice-and-dietary-intake-inmodern-western-societies. Arkowitz, H., Westra, H.A., Miller, W.R. & Rollnick, S. (2008) Motivational interviewing in treating psychological problems. New York: Guilford Press. Ashida, S., Wilkinson, A.V. & Koehly, L.M. (2012) Social influence and motivation to change health behaviors among Mexican-origin adults: implications for diet and physical activity. Am J Health Promot. 26(3):176-9. Bach A, Serra-Majem L, Carrasco JL, Roman B, Ngo J, Bertomeu I, Obrador B. (2006) The use of indexes evaluating the adherence to the Mediterranean diet in epidemiological studies: a review. Public Health Nutr 9(1A):132-146. 247 Bacon, L., Stern, J.S., Van Loan, M.D. & Keim, N.L. (2005) Size acceptance and intuitive eating improve health for obese, female chronic dieters. J Am Diet Assoc. 105(6):929-36. Baker, A.H. & Wardle, J. (2003) Sex differences in fruit and vegetable intake in older adults. Appetite. 40(3):269-75. Bandura, A. (1993) Perceived self-efficacy in cognitive development and functioning. Educational Psychologist. 28:117-48. Bandura, A. (1986) Social Foundations of Thought & Action: A Social Cognitive Theory. Englewood Cliffs, NJ: Prentice Hall. Barnes, R.D. & Ivezaj, V. (2015) A systematic review of motivational interviewing for weight loss among adults in primary care. Obes Rev. 16(4):304-18. Bastien, M., Poirier, P., Lemieux, I. & Despres, J.P. (2014) Overview of epidemiology and contribution of obesity to cardiovascular disease. Prog Cardiovasc Dis. 56(4):369-81. Beardsworth, A.B., Brynan, A., Keil, T., Goode, J., Haslam, C. & Lancashire, E. (2002) Women, men and food: the significance of gender for nutritional attitudes and choices. British Food Journal. 104(7):470-91. Bédard, A., Corneau, L., Lamarche, B., Dodin, S. & Lemieux, S. (2014) Sex-related differences in the effects of the mediterranean diet on glucose and insulin homeostasis. J Nutr Metab. 2014:424130. Bedard, A., Tchernof, A., Lamarche, B., Corneau, L., Dodin, S. & Lemieux, S. (2014) Effects of the traditional Mediterranean diet on adiponectin and leptin concentrations in men and premenopausal women: do sex differences exist? Eur J Clin Nutr. 68(5):561-6. Befort, C.A., Nollen, N., Ellerbeck, E.F., Sullivan, D.K., Thomas, J.L. & Ahluwalia, J.S. (2008) Motivational interviewing fails to improve outcomes of a behavioral weight loss program for obese African American women: a pilot randomized trial. J Behav Med. 31(5):367-77. Bemelmans, W.J., Broer, J., de Vries, J.H., Hulshof, K.F., May, J.F. & Meyboom-De Jong, B. (2000) Impact of Mediterranean diet education versus posted leaflet on dietary habits and serum cholesterol in a high risk population for cardiovascular disease. Public Health Nutr. 3(3):273-83. Bennett, J.A., Lyons, K.S., Winters-Stone, K., Nail, L.M. & Scherer, J. (2007) Motivational interviewing to increase physical activity in long-term cancer survivors: a randomized controlled trial. Nurs Res. 56(1):18-27. Bennett, J.A., Young, H.M., Nail, L.M., Winters-Stone, K. & Hanson, G. (2008) A telephone-only motivational intervention to increase physical activity in rural adults: a randomized controlled trial. Nurs Res. 57(1):24-32. 248 Berger, J.S., Roncaglioni, M.C., Avanzini, F., Pangrazzi, I., Tognoni, G. & Brown, D.L. (2006) Aspirin for the primary prevention of cardiovascular events in women and men: a sex-specific meta-analysis of randomized controlled trials. JAMA. 295(3):306-13. Beunza, J.J., Toledo, E., Hu, F.B., Bes-Rastrollo, M., Serrano-Martinez, M., SanchezVillegas, A., Martinez, J.A. & Martinez-Gonzalez, M.A. (2010) Adherence to the Mediterranean diet, long-term weight change, and incident overweight or obesity: the Seguimiento Universidad de Navarra (SUN) cohort. Am J Clin Nutr. 92(6):1484-93. Bjorntorp, P. (1996) The regulation of adipose tissue distribution in humans. Int J Obes Relat Metab Disord. 20(4):291-302. Blake, C.E., Devine, C.M., Wethington, E., Jastran, M., Farrell, T.J. & Bisogni, C.A. (2009) Employed parents' satisfaction with food-choice coping strategies. Influence of gender and structure. Appetite. 52(3):711-9. Boersma, E., Harrington, R.A., Moliterno, D.J., White, H., Theroux, P., Van de Werf, F., de Torbal, A., Armstrong, P.W., Wallentin, L.C., Wilcox, R.G., Simes, J., Califf, R.M., Topol, E.J. & Simoons, M.L. (2002) Platelet glycoprotein IIb/IIIa inhibitors in acute coronary syndromes: a meta-analysis of all major randomised clinical trials. Lancet. 359(9302):189-98. Bond, M.J., McDowell, A.J. & Wilkinson, J.Y. (2001) The measurement of dietary restraint, disinhibition and hunger: an examination of the factor structure of the Three Factor Eating Questionnaire (TFEQ). Int J Obes Relat Metab Disord. 25(6):900-6. Bonora, E. (2006) The metabolic syndrome and cardiovascular disease. Ann Med. 38(1):64-80. Bouchard, C., Despres, J.P. & Mauriege, P. (1993) Genetic and nongenetic determinants of regional fat distribution. Endocr Rev. 14(1):72-93. Brown, L.M. & Clegg, D.J. (2010) Central effects of estradiol in the regulation of food intake, body weight, and adiposity. J Steroid Biochem Mol Biol. 122(1-3):65-73. Brug, J., Kremers, S.P., Lenthe, F., Ball, K. & Crawford, D. (2008) Environmental determinants of healthy eating: in need of theory and evidence. Proc Nutr Soc. 67(3):30716. Buckland, G., Bach, A. & Serra-Majem, L. (2008) Obesity and the Mediterranean diet: a systematic review of observational and intervention studies. Obes Rev. 9(6):582-93. Burke, B.L., Arkowitz, H. & Menchola, M. (2003) The efficacy of motivational interviewing: a meta-analysis of controlled clinical trials. J Consult Clin Psychol. 71(5):843-61. 249 Canadian Institutes of Health Research-Institute of Gender and Health. (2012) What a Difference Sex and Gender Make? Canada. Disponible : http://www.cihrirsc.gc.ca/e/44734.html Carels, R.A., Darby, L., Cacciapaglia, H.M., Konrad, K., Coit, C., Harper, J., Kaplar, M.E., Young, K., Baylen, C.A. & Versland, A. (2007) Using motivational interviewing as a supplement to obesity treatment: a stepped-care approach. Health Psychol. 26(3):369-74. Carmody, T.P., Brunner, R.L. & St Jeor, S.T. (1995) Dietary helplessness and disinhibition in weight cyclers and maintainers. Int J Eat Disord. 18(3):247-56. Chrysohoou, C., Panagiotakos, D.B., Pitsavos, C., Kokkinos, P., Marinakis, N., Stefanadis, C. & Toutouzas, P.K. (2003) Gender differences on the risk evaluation of acute coronary syndromes: the CARDIO2000 study. Prev Cardiol. 6(2):71-7. Cornier, M.A., Salzberg, A.K., Endly, D.C., Bessesen, D.H. & Tregellas, J.R. (2010) Sexbased differences in the behavioral and neuronal responses to food. Physiol Behav. 99(4):538-43. Courtenay, W.H., McCreary, D.R. & Merighi, J.R. (2002) Gender and ethnic differences in health beliefs and behaviors. J Health Psychol. 7(3):219-31. Dansinger, M.L., Gleason, J.A., Griffith, J.L., Selker, H.P. & Schaefer, E.J. (2005) Comparison of the Atkins, Ornish, Weight Watchers, and Zone diets for weight loss and heart disease risk reduction: a randomized trial. JAMA. 293(1):43-53. de Castro, J.M. (1995) The relationship of cognitive restraint to the spontaneous food and fluid intake of free-living humans. Physiol Behav. 57(2):287-95. de Lorgeril, M., Salen, P., Martin, J.L., Monjaud, I., Delaye, J. & Mamelle, N. (1999) Mediterranean diet, traditional risk factors, and the rate of cardiovascular complications after myocardial infarction: final report of the Lyon Diet Heart Study. Circulation. 99(6):779-85. Deci, E.L., Eghrari, H., Patrick, B.C. & Leone, D.R. (1994) Facilitating internalization: the self-determination theory perspective. J Pers. 62(1):119-42. Deci, E.L. & Ryan, R.M. (1985) Intrinsic motivation and self-determination in human behavior. New York: Plenum. Deci, E.L. & Ryan, R.M. (2012) Self-determination theory in health care and its relations to motivational interviewing: a few comments. Int J Behav Nutr Phys Act. 9(24). Deci, E.L., Ryan, R.M., Gagné, M., Leone, D.R., Usunov, J. & Kornazheva, B.P. (2001) Need satisfaction, motivation, and well-being in the work organizations of a former Eastern Bloc country. Personality and Social Psychology Bulletin. 27(8):930-42. 250 Delahanty, L.M., Meigs, J.B., Hayden, D., Williamson, D.A. & Nathan, D.M. (2002) Psychological and behavioral correlates of baseline BMI in the diabetes prevention program (DPP). Diabetes Care. 25(11):1992-8. Drapeau, V., Provencher, V., Lemieux, S., Despres, J.P., Bouchard, C. & Tremblay, A. (2003) Do 6-y changes in eating behaviors predict changes in body weight? Results from the Quebec Family Study. Int J Obes Relat Metab Disord. 27(7):808-14. Drewnowski, A. (1997) Taste preferences and food intake. Annu Rev Nutr. 17:237-53. Dunn, C.L., Hannan, P.J., Jeffery, R.W., Sherwood, N.E., Pronk, N.P. & Boyle, R. (2006) The comparative and cumulative effects of a dietary restriction and exercise on weight loss. Int J Obes (Lond). 30(1):112-21. Edmunds, J., Ntoumanis, N. & Duda, J.L. (2008) Testing a self-determination theory-based teaching style intervention in the exercise domain. Eur J Soc Psychol. 38:375-88. Elliot, A.J. & Sheldon, K.M. (1998) Avoidance personal goals and the personality-illness relationship. J Pers Soc Psychol. 75(5):1282-99. Elliot, D.L., Goldberg, L., Kuehl, K.S., Moe, E.L., Breger, R.K. & Pickering, M.A. (2007) The PHLAME (Promoting Healthy Lifestyles: Alternative Models' Effects) firefighter study: outcomes of two models of behavior change. J Occup Environ Med. 49(2):204-13. Emanuel, A.S., McCully, S.N., Gallagher, K.M. & Updegraff, J.A. (2012) Theory of Planned Behavior explains gender difference in fruit and vegetable consumption. Appetite. 59(3):693-7. Endevelt, R., Peled, R., Azrad, A., Kowen, G., Valinsky, L. & Heymann, A.D. (2015) Diabetes prevention program in a Mediterranean environment: Individual or group therapy? An effectiveness evaluation. Prim Care Diabetes. 9(2):89-95. Engelhart, M.J., Geerlings, M.I., Ruitenberg, A., van Swieten, J.C., Hofman, A., Witteman, J.C. & Breteler, M.M. (2002) Dietary intake of antioxidants and risk of Alzheimer disease. JAMA. 287(24):3223-9. Esposito, K., Kastorini, C.M., Panagiotakos, D.B. & Giugliano, D. (2011) Mediterranean diet and weight loss: meta-analysis of randomized controlled trials. Metab Syndr Relat Disord. 9(1):1-12. Esposito, K., Marfella, R., Ciotola, M., Di Palo, C., Giugliano, F., Giugliano, G., D'Armiento, M., D'Andrea, F. & Giugliano, D. (2004) Effect of a mediterranean-style diet on endothelial dysfunction and markers of vascular inflammation in the metabolic syndrome: a randomized trial. JAMA. 292(12):1440-6. 251 Estruch, R., Martinez-Gonzalez, M.A., Corella, D., Salas-Salvado, J., Ruiz-Gutierrez, V., Covas, M.I., Fiol, M., Gomez-Gracia, E., Lopez-Sabater, M.C., Vinyoles, E., Aros, F., Conde, M., Lahoz, C., Lapetra, J., Saez, G. & Ros, E. (2006) Effects of a Mediterraneanstyle diet on cardiovascular risk factors: a randomized trial. Ann Intern Med. 145(1):1-11. Estruch, R., Ros, E., Salas-Salvado, J., Covas, M.I., Pharm, D., Corella, D., Aros, F., Gomez-Gracia, E., Ruiz-Gutierrez, V., Fiol, M., Lapetra, J., Lamuela-Raventos, R.M., Serra-Majem, L., Pinto, X., Basora, J., Munoz, M.A., Sorli, J.V., Martinez, J.A. & Martinez-Gonzalez, M.A. (2013) Primary Prevention of Cardiovascular Disease with a Mediterranean Diet. N Engl J Med. Fagerli, R.A. & Wandel, M. (1999) Gender differences in opinions and practices with regard to a "healthy diet". Appetite. 32(2):171-90. Fortier, M.S., Hogg, W., O'Sullivan, T.L., Blanchard, C., Reid, R.D., Sigal, R.J., Boulay, P., Doucet, E., Sweet, S., Bisson, E. & Beaulac, J. (2007a) The physical activity counselling (PAC) randomized controlled trial: rationale, methods, and interventions. Appl Physiol Nutr Metab. 32(6):1170-85. Fortier, M.S., Sweet, S.N., O'Sullivan, T.L. & Williams, G.C. (2007b) A self-determination process model of physical activity adoption in the context of a randomized controlled trial. Psychology of Sport and Exercise. 8:741-57. Freeland-Graves, J.H. & Nitzke, S. (2013) Position of the academy of nutrition and dietetics: total diet approach to healthy eating. J Acad Nutr Diet. 113(2):307-17. Friedewald, W.T., Levy, R.I. & Fredrickson, D.S. (1972) Estimation of the concentration of low-density lipoprotein cholesterol in plasma, without use of the preparative ultracentrifuge. Clin Chem. 18(6):499-502. Fuemmeler, B.F., Masse, L.C., Yaroch, A.L., Resnicow, K., Campbell, M.K., Carr, C., Wang, T. & Williams, A. (2006) Psychosocial mediation of fruit and vegetable consumption in the body and soul effectiveness trial. Health Psychol. 25(4):474-83. Fung, T.T., Chiuve, S.E., McCullough, M.L., Rexrode, K.M., Logroscino, G. & Hu, F.B. (2008) Adherence to a DASH-style diet and risk of coronary heart disease and stroke in women. Arch Intern Med. 168(7):713-20. Fung, T.T., Willett, W.C., Stampfer, M.J., Manson, J.E. & Hu, F.B. (2001) Dietary patterns and the risk of coronary heart disease in women. Arch Intern Med. 161(15):1857-62. Gagné, M. (2003) The Role of Autonomy Support and Autonomy Orientation in Prosocial Behavior Engagement. Motivation and Emotion. 27(3). Garaulet, M. & Perez de, H.F. (2010) Behavioural therapy in the treatment of obesity (II): role of the Mediterranean diet. Nutr Hosp. 25(1):9-17. Garriguet, D. (2009) Diet quality in Canada. Health Rep. 20(3):41-52. 252 Giugliano, D. & Esposito, K. (2005) Mediterranean diet and cardiovascular health. Ann N Y Acad Sci. 1056:253-60. Godin, G. Les comportements dans le domaine de la santé - Comprendre pour mieux intervenir. Les Presses de l'Université de Montréal, 2012. 328 pages. Goodman, S., Hammond, D., Pillo-Blocka, F., Glanville, T., Jenkins R. (2011) Use of nutritional information in Canada: national trends between 2004 and 2008. J Nutr Educ Behav. 43(5):356-65. Gorin, A.A., Powers, T.A., Koestner, R., Wing, R.R. & Raynor, H.A. (2014) Autonomy support, self-regulation, and weight loss. Health Psychol. 33(4):332-9. Goulet, J., Lamarche, B., Nadeau, G. & Lemieux, S. (2003) Effect of a nutritional intervention promoting the Mediterranean food pattern on plasma lipids, lipoproteins and body weight in healthy French-Canadian women. Atherosclerosis. 170(1):115-24. Goulet, J., Lapointe, A., Lamarche, B. & Lemieux, S. (2007) Effect of a nutritional intervention promoting the Mediterranean food pattern on anthropometric profile in healthy women from the Quebec city metropolitan area. Eur J Clin Nutr. 61(11):1293-300. Goulet, J., Nadeau, G., Lapointe, A., Lamarche, B. & Lemieux, S. (2004) Validity and reproducibility of an interviewer-administered food frequency questionnaire for healthy French-Canadian men and women. Nutr J. 3:13. Goulet, J., Provencher, V., Piche, M.E., Lapointe, A., John Weisnagel, S., Nadeau, A., Bergeron, J. & Lemieux, S. (2008) Relationship between eating behaviours and food and drink consumption in healthy postmenopausal women in a real-life context. Br J Nutr. 100(4):910-7. Gropper, S.S., Arsiwalla, D.D., Lord, D.C., Huggins, K.W., Simmons, K.P. & Ulrich, P.V. (2014) Associations among eating regulation and body mass index, weight, and body fat in college students: the moderating role of gender. Eat Behav. 15(2):321-7. Grosso, G., Mistretta, A., Frigiola, A., Gruttadauria, S., Biondi, A., Basile, F., Vitaglione, P., D'Orazio, N. & Galvano, F. (2014) Mediterranean diet and cardiovascular risk factors: a systematic review. Crit Rev Food Sci Nutr. 54(5):593-610. Grundy, S.M., Cleeman, J.I., Daniels, S.R., Donato, K.A., Eckel, R.H., Franklin, B.A., Gordon, D.J., Krauss, R.M., Savage, P.J., Smith Jr, S.C., Spertus, J.A. & Costa, F. (2005) Diagnosis and management of the metabolic syndrome. An American Heart Association/National Heart, Lung, and Blood Institute Scientific Statement. Executive summary. Cardiol Rev. 13(6):322-7. Grundy, S.M., Cleeman, J.I., Merz, C.N., Brewer, H.B., Jr., Clark, L.T., Hunninghake, D.B., Pasternak, R.C., Smith, S.C., Jr. & Stone, N.J. (2004) Implications of recent clinical trials for the National Cholesterol Education Program Adult Treatment Panel III Guidelines. J Am Coll Cardiol. 44(3):720-32. 253 Guay, F., Mageau, G.A. & Vallerand, R.J. (2003) On the hierarchical structure of selfdetermined motivation: a test of top-down, bottom-up, reciprocal, and horizontal effects. Pers Soc Psychol Bull. 29(8):992-1004. Guillaumie, L., Godin, G. & Vézina-Im, L.A. (2010) Psychosocial determinants of fruit and vegetable intake in adult population: a systematic review. Int J Behav Nutr Phys Act. 7:12. Haidinger, T., Zweimuller, M., Stutz, L., Demir, D., Kaider, A. & Strametz-Juranek, J. (2012) Effect of gender on awareness of cardiovascular risk factors, preventive action taken, and barriers to cardiovascular health in a group of Austrian subjects. Gend Med. 9(2):94-102. Hardcastle, S., Taylor, A., Bailey, M. & Castle, R. (2008) A randomised controlled trial on the effectiveness of a primary health care based counselling intervention on physical activity, diet and CHD risk factors. Patient Educ Couns. 70(1):31-9. Harland, J., White, M., Drinkwater, C., Chinn, D., Farr, L. & Howel, D. (1999) The Newcastle exercise project: a randomised controlled trial of methods to promote physical activity in primary care. BMJ. 319(7213):828-32. Harmon, G., Lefante, J. & Krousel-Wood, M. (2006) Overcoming barriers: the role of providers in improving patient adherence to antihypertensive medications. Current Opinion in Cardiology. 21(4):310-5. Hartmann, C., Dohle, S. & Siegrist, M. (2015) A self-determination theory approach to adults' healthy body weight motivation: A longitudinal study focussing on food choices and recreational physical activity. Psychol Health. 1-25. Hays, N.P., Bathalon, G.P., McCrory, M.A., Roubenoff, R., Lipman, R. & Roberts, S.B. (2002) Eating behavior correlates of adult weight gain and obesity in healthy women aged 55-65 y. Am J Clin Nutr. 75(3):476-83. Henriquez Sanchez, P., Ruano, C., de Irala, J., Ruiz-Canela, M., Martinez-Gonzalez, M.A. & Sanchez-Villegas, A. (2012) Adherence to the Mediterranean diet and quality of life in the SUN Project. Eur J Clin Nutr. 66(3):360-8. Henson, S., Blandon, J., Cranfield, J. & Herath, D. (2010) Understanding the propensity of consumers to comply with dietary guidelines directed at heart health. Appetite. 54(1):5261. Hu, F.B. (2002) Dietary pattern analysis: a new direction in nutritional epidemiology. Curr Opin Lipidol. 13(1):3-9. Hu, F.B. (2008) Globalization of food patterns and cardiovascular disease risk. Circulation. 118(19):1913-4. 254 Hu, F.B., Manson, J.E., Stampfer, M.J., Colditz, G., Liu, S., Solomon, C.G. & Willett, W.C. (2001) Diet, lifestyle, and the risk of type 2 diabetes mellitus in women. N Engl J Med. 345(11):790-7. Hu, F.B., Rimm, E., Smith-Warner, S.A., Feskanich, D., Stampfer, M.J., Ascherio, A., Sampson, L. & Willett, W.C. (1999) Reproducibility and validity of dietary patterns assessed with a food-frequency questionnaire. Am J Clin Nutr. 69(2):243-9. Hu, F.B., Rimm, E.B., Stampfer, M.J., Ascherio, A., Spiegelman, D. & Willett, W.C. (2000) Prospective study of major dietary patterns and risk of coronary heart disease in men. Am J Clin Nutr. 72(4):912-21. International Diabetes Federation. (2006) IDF worldwide definition of the metabolic syndrome. Disponible : http://wwwidforg/webdata/docs/MetS_def_update2006pdf (Consulté le 12 juillet 2013). Jakicic, J.M., Wing, R.R. & Winters-Hart, C. (2002) Relationship of physical activity to eating behaviors and weight loss in women. Med Sci Sports Exerc. 34(10):1653-9. Johnson, C.S. & Bedford, J. (2004) Eating attitudes across age and gender groups: a Canadian study. Eat Weight Disord. 9(1):16-23. Kant, A.K. (1996) Indexes of overall diet quality: a review. J Am Diet Assoc. 96(8):78591. Karanja, N.M., Obarzanek, E., Lin, P.H., McCullough, M.L., Phillips, K.M., Swain, J.F., Champagne, C.M. & Hoben, K.P. (1999) Descriptive characteristics of the dietary patterns used in the Dietary Approaches to Stop Hypertension Trial. DASH Collaborative Research Group. J Am Diet Assoc. 99(Suppl 8):S19-27. Kastorini, C.M., Milionis, H.J., Esposito, K., Giugliano, D., Goudevenos, J.A. & Panagiotakos, D.B. (2011) The effect of Mediterranean diet on metabolic syndrome and its components: a meta-analysis of 50 studies and 534,906 individuals. J Am Coll Cardiol. 57(11):1299-313. Keys, A. (1970) Coronary heart disease in seven countries. Circulation. 41 (Suppl 1):1-211. Keys, A., Menotti, A., Karvonen, M.J., Aravanis, C., Blackburn, H., Buzina, R., Djordjevic, B.S., Dontas, A.S., Fidanza, F., Keys, M.H. & et al. (1986) The diet and 15year death rate in the seven countries study. Am J Epidemiol. 124(6):903-15. Kiefer, I., Rathmanner, T. & Kunze, M. (2005) Eating and dieting differences in men and women. Journal of Men's Health and Gender. 2(2):194-201. Knopp, R.H., Paramsothy, P., Retzlaff, B.M., Fish, B., Walden, C., Dowdy, A., Tsunehara, C., Aikawa, K. & Cheung, M.C. (2005) Gender differences in lipoprotein metabolism and dietary response: basis in hormonal differences and implications for cardiovascular disease. Curr Atheroscler Rep. 7(6):472-9. 255 Koloverou, E., Esposito, K., Giugliano, D. & Panagiotakos, D. (2014) The effect of Mediterranean diet on the development of type 2 diabetes mellitus: a meta-analysis of 10 prospective studies and 136,846 participants. Metabolism. 63(7):903-11. Kristal, A.R., Hedderson, M.M., Patterson, R.E. & Neuhouser, M. (2001) Predictors of selfinitiated, healthful dietary change. J Am Diet Assoc. 101(7):762-6. Krukowski, R.A., Harvey-Berino, J., Kolodinsky, J., Narsana, R.T. & Desisto, T.P. (2006) Consumers may not use or understand calorie labeling in restaurants. J Am Diet Assoc. 106(6):917-20. La Guardia, J.G., Ryan, R.M., Couchman, C.E. & Deci, E.L. (2000) Within-person variation in security of attachment: a self-determination theory perspective on attachment, need fulfillment, and well-being. J Pers Soc Psychol. 79(3):367-84. Landaeta-Diaz, L., Fernandez, J.M., Da Silva-Grigoletto, M., Rosado-Alvarez, D., GomezGarduno, A., Gomez-Delgado, F., Lopez-Miranda, J., Perez-Jimenez, F. & FuentesJimenez, F. (2013) Mediterranean diet, moderate-to-high intensity training, and healthrelated quality of life in adults with metabolic syndrome. Eur J Prev Cardiol. 20(4):555-64. Landgren, B.M., Collins, A., Csemiczky, G., Burger, H.G., Baksheev, L. & Robertson, D.M. (2004) Menopause transition: Annual changes in serum hormonal patterns over the menstrual cycle in women during a nine-year period prior to menopause. J Clin Endocrinol Metab. 89(6):2763-9. Lapointe, A., Balk, E.M. & Lichtenstein, A.H. (2006) Gender differences in plasma lipid response to dietary fat. Nutr Rev. 64(5 Pt 1):234-49. Lemieux, S., Prud'homme, D., Bouchard, C., Tremblay, A. & Despres, J.P. (1993) Sex differences in the relation of visceral adipose tissue accumulation to total body fatness. Am J Clin Nutr. 58(4):463-7. Leong, S.L., Madden, C., Gray, A. & Horwath, C. (2012) Self-determined, autonomous regulation of eating behavior is related to lower body mass index in a nationwide survey of middle-aged women. J Acad Nutr Diet. 112(9):1337-46. Li, K.K., Concepcion, R.Y., Lee, H., Cardinal, B.J., Ebbeck, V., Woekel, E. & Readdy, R.T. (2012) An examination of sex differences in relation to the eating habits and nutrient intakes of university students. J Nutr Educ Behav. 44(3):246-50. Li, R., Serdula, M., Bland, S., Mokdad, A., Bowman, B. & Nelson, D. (2000) Trends in fruit and vegetable consumption among adults in 16 US states: Behavioral Risk Factor Surveillance System, 1990-1996. Am J Public Health. 90(5):777-81. Li, Z., Otvos, J.D., Lamon-Fava, S., Carrasco, W.V., Lichtenstein, A.H., McNamara, J.R., Ordovas, J.M. & Schaefer, E.J. (2003) Men and women differ in lipoprotein response to dietary saturated fat and cholesterol restriction. J Nutr. 133(11):3428-33. 256 Liebman, M., Cameron, B.A., Carson, D.K., Brown, D.M. & Meyer, S.S. (2001) Dietary fat reduction behaviors in college students: relationship to dieting status, gender and key psychosocial variables. Appetite. 36(1):51-6. Liebman, M., Pelican, S., Moore, S.A., Holmes, B., Wardlaw, M.K., Melcher, L.M., Raidl, M., Wheeler, B. & Haynes, G.W. (2006) Dietary intake-, eating behavior-, and physical activity-related determinants of high body mass index in the 2003 Wellness IN the Rockies cross-sectional study. Nutrition Research. 26(3):111-7. Lindroos, A.K., Lissner, L., Mathiassen, M.E., Karlsson, J., Sullivan, M., Bengtsson, C. & Sjostrom, L. (1997) Dietary intake in relation to restrained eating, disinhibition, and hunger in obese and nonobese Swedish women. Obes Res. 5(3):175-82. Logan, K.J., Woodside, J.V., Young, I.S., McKinley, M.C., Perkins-Porras, L. & McKeown, P.P. (2010) Adoption and maintenance of a Mediterranean diet in patients with coronary heart disease from a Northern European population: a pilot randomised trial of different methods of delivering Mediterranean diet advice. J Hum Nutr Diet. 23(1):30-7. Lohman, T., Roche, A. & Artorel, R. (1988) The Airlie (VA) Consensus Conference: Standardization of Anthropometric Measurements. Champaign, IL: Human Kinetics Publishers. Lundahl, B., Moleni, T., Burke, B.L., Butters, R., Tollefson, D., Butler, C. & Rollnick, S. (2013) Motivational interviewing in medical care settings: a systematic review and metaanalysis of randomized controlled trials. Patient Educ Couns. 93(2):157-68. Lynch, D.J., Repka, F.J., Nagel, R., Birk, T., Gohara, A., Leighton, R.F., Walsh, M.E. & Weaver, M. (2000) Prediction of dietary adherence in cholesterol reduction: Relative contribution of personality variables and health attitudes. Psychol Health. 15(6):821-8. Maindal, H.T., Sandbaek, A., Kirkevold, M. & Lauritzen, T. (2011) Effect on motivation, perceived competence, and activation after participation in the ''Ready to Act'' programme for people with screen-detected dysglycaemia: a 1-year randomised controlled trial, Addition-DK. Scand J Public Health. 39(3):262-71. Markland, D., Ryan, R.M., Tobin, V.J. & Rollnick, S. (2005) Motivational interviewing and self-determination theory. Journal of Social and Clinical Psychology. 24(6):811-31. Martinez-Gonzalez, M.A., Fuente-Arrillaga, C., Nunez-Cordoba, J.M., Basterra-Gortari, F.J., Beunza, J.J., Vazquez, Z., Benito, S., Tortosa, A. & Bes-Rastrollo, M. (2008) Adherence to Mediterranean diet and risk of developing diabetes: prospective cohort study. BMJ. 336(7657):1348-51. Martinez-Gonzalez, M.A., Garcia-Lopez, M., Bes-Rastrollo, M., Toledo, E., MartinezLapiscina, E.H., Delgado-Rodriguez, M., Vazquez, Z., Benito, S. & Beunza, J.J. (2011) Mediterranean diet and the incidence of cardiovascular disease: a Spanish cohort. Nutr Metab Cardiovasc Dis. 21(4):237-44. 257 Martins, R.K. & McNeil, D.W. (2009) Review of Motivational Interviewing in promoting health behaviors. Clin Psychol Rev. 29(4):283-93. Mask, L. & Blanchard, C.M. (2011) The protective role of general self-determination against 'thin ideal' media exposure on women's body image and eating-related concerns. J Health Psychol. 16(3):489-99. Mata, J., Silva, M.N., Vieira, P.N., Carraca, E.V., Andrade, A.M., Coutinho, S.R., Sardinha, L.B. & Teixeira, P.J. (2009) Motivational "spill-over" during weight control: increased self-determination and exercise intrinsic motivation predict eating self-regulation. Health Psychol. 28(6):709-16. McManus, K., Antinoro, L. & Sacks, F. (2001) A randomized controlled trial of a moderate-fat, low-energy diet compared with a low fat, low-energy diet for weight loss in overweight adults. Int J Obes Relat Metab Disord. 25(10):1503-11. Middleton, G. (2009) Mediterranean Diet Pyramid. Disponible : http://www.oldwayspt.org. Miller, W.R., Brown, J.M., Simpson, T.L., Handmaker, N.S., Bien, T.H., Luckie, L.F., Montgomery, H.A., Hester, R.K. & Tonigan, J.S. (1995) What works ? A methodological analysis of the alcohol treatment outcome literature. In Handbook of alcoholism treatment approaches: Effective alternatives (2nd ed.). Needham Heights, MA: Allyn & Bacon, pp.12-44. Miller, W.R. & Rollnick, S. (2013) L’entretien motivationnel – Aider la personne à engager le changement. Paris: InterEditions. Miller, W.R. & Rollnick, S. (2002) Motivational interviewing: Preparing people for change. New York: Guilford Press. Miller, W.R. & Rose, G.S. (2009) Toward a theory of motivational interviewing. Am Psychol. 64(6):527-37. Moyers, T.B., Martin, T., Manuel, J.K., Hendrickson, S.M. & Miller, W.R. (2005) Assessing competence in the use of motivational interviewing. J Subst Abuse Treat. 28(1):19-26. Mroz, L.W., Chapman, G.E., Oliffe, J.L. & Bottorff, J.L. (2011) Men, food, and prostate cancer: gender influences on men's diets. Am J Mens Health. 5(2):177-87. Munoz, M.A., Fito, M., Marrugat, J., Covas, M.I. & Schroder, H. (2009) Adherence to the Mediterranean diet is associated with better mental and physical health. Br J Nutr. 101(12):1821-7. Murcott, A. (2000) Invited presentation: is it still a pleasure to cook for him? Social changes in the household and the family. Journal of Consumer Studies and Home Economics. 24(2):78-84. 258 National Heart, Lung, and Blood Institute. (2006) In Brief: Your Guide to Lowering Your Blood Pressure with DASH. Disponible : http://www.nhlbi.nih.gov/. NCEP ATP III. (2002) Third report of the National Cholesterol Education Program (NCEP) expert panel on detection, evaluation, and treatment of high blood cholesterol in adults (adult treatment panel III) final report. Circulation 106:3143–3421. Neumark-Sztainer, D., Sherwood, N.E., French, S.A. & Jeffery, R.W. (1999) Weight control behaviors among adult men and women: cause for concern? Obes Res. 7:179-88. Newby, P.K. & Tucker, K.L. (2004) Empirically derived eating patterns using factor or cluster analysis: a review. Nutr Rev. 62(5):177-203. Ng, J.Y., Ntoumanis, N., Thogersen-Ntoumani, C., Deci, E.L., Ryan, R.M., Duda, J.L. & Williams, G.C. (2012) Self-Determination Theory applied to health contexts: A metaanalysis. Perspectives on Psychological Science. 7:325-40. Obarzanek, E., Sacks, F.M., Vollmer, W.M., Bray, G.A., Miller, E.R., 3rd, Lin, P.H., Karanja, N.M., Most-Windhauser, M.M., Moore, T.J., Swain, J.F., Bales, C.W. & Proschan, M.A. (2001) Effects on blood lipids of a blood pressure-lowering diet: the Dietary Approaches to Stop Hypertension (DASH) Trial. Am J Clin Nutr. 74(1):80-9. Panagiotakos, D.B., Pitsavos, C. & Stefanadis, C. (2006) Dietary patterns: a Mediterranean diet score and its relation to clinical and biological markers of cardiovascular disease risk. Nutr Metab Cardiovasc Dis. 16(8):559-68. Panagiotakos, D.B., Polystipioti, A., Papairakleous, N. & Polychronopoulos, E. (2007) Long-term adoption of a Mediterranean diet is associated with a better health status in elderly people; a cross-sectional survey in Cyprus. Asia Pac J Clin Nutr. 16(2):331-7. Patrick, H. & Williams, G.C. (2012) Self-determination theory: its application to health behavior and complementarity with motivational interviewing. Int J Behav Nutr Phys Act. 9:18. Pelletier, L.G. (2002) A motivational analysis of self-determination for pro-environmental behaviors. In Handbook of self-determination research. Rochester, NY: University Of Rochester Press, pp. 205-232. Pelletier, L.G. & Dion, S.C. (2007) An Examination of General and Specific Motivational Mechanisms for the Relations Between Body Dissatisfaction and Eating Behaviors. Social and Clinical Psychology. 26:303-33. Pelletier, L.G., Dion, S.C., Slovinec-D'Angel, M. & Reid, R. (2004) Why Do You Regulate What You Eat? Relationships Between Forms of Regulation, Eating Behaviors, Sustained Dietary Behavior Change, and Psychological Adjustment. Motivation and Emotion. 28(3):245-77. 259 Peters, S.A., Huxley, R.R. & Woodward, M. (2014) Diabetes as risk factor for incident coronary heart disease in women compared with men: a systematic review and metaanalysis of 64 cohorts including 858,507 individuals and 28,203 coronary events. Diabetologia. 57(8):1542-51. Pilote, L., Dasgupta, K., Guru, V., Humphries, K.H., McGrath, J., Norris, C., Rabi, D., Tremblay, J., Alamian, A., Barnett, T., Cox, J., Ghali, W.A., Grace, S., Hamet, P., Ho, T., Kirkland, S., Lambert, M., Libersan, D., O'Loughlin, J., Paradis, G., Petrovich, M. & Tagalakis, V. (2007) A comprehensive view of sex-specific issues related to cardiovascular disease. CMAJ. 176(6):S1-44. Povey, R., Wellens, B. & Conner, M. (2001) Attitudes towards following meat, vegetarian and vegan diets: an examination of the role of ambivalence. Appetite. 37(1):15-26. Prochaska, J.O. & DiClemente, C.C. (1983) Stages and processes of self-change of smoking: toward an integrative model of change. J Consult Clin Psychol. 51(3):390-5. Provencher, V., Drapeau, V., Tremblay, A., Despres, J.P. & Lemieux, S. (2003) Eating behaviors and indexes of body composition in men and women from the Quebec family study. Obes Res. 11(6):783-92. Raine, K.D. (2005) Determinants of healthy eating in Canada: an overview and synthesis. Can J Public Health. 96 (Suppl 3):S8-14, S8-5. Raynor, H.A., Looney, S.M., Steeves, E.A., Spence, M. & Gorin, A.A. (2012) The effects of an energy density prescription on diet quality and weight loss: a pilot randomized controlled trial. J Acad Nutr Diet. 112(9):1397-402. Resnicow, K., Campbell, M.K., Carr, C., McCarty, F., Wang, T., Periasamy, S., Rahotep, S., Doyle, C., Williams, A. & Stables, G. (2004) Body and soul. A dietary intervention conducted through African-American churches. Am J Prev Med. 27(2):97-105. Resnicow, K., DiIorio, C., Soet, J.E., Ernst, D., Borrelli, B. & Hecht, J. (2002) Motivational interviewing in health promotion: it sounds like something is changing. Health Psychol. 21(5):444-51. Resnicow, K. & McMaster, F. (2012) Motivational Interviewing: moving from why to how with autonomy support. Int J Behav Nutr Phys Act. 9:19. Rollnick, S. & Miller, W.R. (1995) What is motivational interviewing? Behavioural and Cognitive Psychotherapy. 23:325-34. Rolls, B.J., Drewnowski, A. & Ledikwe, J.H. (2005) Changing the energy density of the diet as a strategy for weight management. J Am Diet Assoc. 105(5 Suppl 1):S98-103. Rolls, B.J., Ello-Martin, J.A. & Tohill, B.C. (2004) What can intervention studies tell us about the relationship between fruit and vegetable consumption and weight management? Nutr Rev. 62(1):1-17. 260 Rolls, B.J., Fedoroff, I.C. & Guthrie, J.F. (1991) Gender differences in eating behavior and body weight regulation. Health Psychol. 10(2):133-42. Rolls, B.J., Roe, L.S. & Meengs, J.S. (2006) Reductions in portion size and energy density of foods are additive and lead to sustained decreases in energy intake. Am J Clin Nutr. 83(1):11-7. Romaguera, D., Norat, T., Mouw, T., May, A.M., Bamia, C., Slimani, N., Travier, N., Besson, H., Luan, J., Wareham, N., Rinaldi, S., Couto, E., Clavel-Chapelon, F., BoutronRuault, M.C., Cottet, V., Palli, D., Agnoli, C., Panico, S., Tumino, R., Vineis, P., Agudo, A., Rodriguez, L., Sanchez, M.J., Amiano, P., Barricarte, A., Huerta, J.M., Key, T.J., Spencer, E.A., Bueno-de-Mesquita, H.B., Buchner, F.L., Orfanos, P., Naska, A., Trichopoulou, A., Rohrmann, S., Kaaks, R., Bergmann, M., Boeing, H., Johansson, I., Hellstrom, V., Manjer, J., Wirfalt, E., Uhre, J.M., Overvad, K., Tjonneland, A., Halkjaer, J., Lund, E., Braaten, T., Engeset, D., Odysseos, A., Riboli, E. & Peeters, P.H. (2009) Adherence to the Mediterranean diet is associated with lower abdominal adiposity in European men and women. J Nutr. 139(9):1728-37. Rubak, S., Sandbaek, A., Lauritzen, T. & Christensen, B. (2005) Motivational interviewing: a systematic review and meta-analysis. Br J Gen Pract. 55(513):305-12. Ryan, R.M. (1995) Psychological needs and the facilitation of integrative processes. J Pers. 63(3):397-427. Ryan, R.M. & Deci, E.L. (2000) Self-determination theory and the facilitation of intrinsic motivation, social development, and well-being. Am Psychol. 55(1):68-78. Sacks, F.M., Svetkey, L.P., Vollmer, W.M., Appel, L.J., Bray, G.A., Harsha, D., Obarzanek, E., Conlin, P.R., Miller, E.R., 3rd, Simons-Morton, D.G., Karanja, N. & Lin, P.H. (2001) Effects on blood pressure of reduced dietary sodium and the Dietary Approaches to Stop Hypertension (DASH) diet. DASH-Sodium Collaborative Research Group. N Engl J Med. 344(1):3-10. Sandberg, J., Trief, P.M., Greenberg, R.P., Graff, K. & Weinstock, R.S. (2006) He said, she said. J Couple Relationsh Ther. 5(2) :23-42. Sanchez-Villegas, A., Bes-Rastrollo, M., Martinez-Gonzalez, M.A. & Serra-Majem, L. (2006) Adherence to a Mediterranean dietary pattern and weight gain in a follow-up study: the SUN cohort. Int J Obes (Lond). 30(2):350-8. Sanchez-Villegas, A., Delgado-Rodriguez, M., Alonso, A., Schlatter, J., Lahortiga, F., Serra Majem, L. & Martinez-Gonzalez, M.A. (2009) Association of the Mediterranean dietary pattern with the incidence of depression: the Seguimiento Universidad de Navarra/University of Navarra follow-up (SUN) cohort. Arch Gen Psychiatry. 66(10):1090-8. Santé Canada. (2007) Guide alimentaire canadien. Disponible : http://hc-sc.gc.ca/fnan/food-guide-aliment/choose-choix/grain-cereal/need-besoin-fra.php. 261 Sarkadi, A. & Rosenqvist, U. (2002) Social network and role demands in women's Type 2 diabetes: a model. Health Care Women Int. 23(6-7):600-11. Scarsella, C., Almeras, N., Mauriege, P., Blanchet, C., Sauve, L., Dewailly, E., Bergeron, J. & Despres, J.P. (2003) Prevalence of metabolic alterations predictive of cardiovascular disease risk in the Quebec population. Can J Cardiol. 19(1):51-7. Schaefer, E.J. (2002) Lipoproteins, nutrition, and heart disease. Am J Clin Nutr. 75(2):191212. Schroder, H. (2007) Protective mechanisms of the Mediterranean diet in obesity and type 2 diabetes. J Nutr Biochem. 18(3):149-60. Schroder, H., Marrugat, J., Vila, J., Covas, M.I. & Elosua, R. (2004) Adherence to the traditional mediterranean diet is inversely associated with body mass index and obesity in a spanish population. J Nutr. 134(12):3355-61. Schwartz, R.P., Hamre, R., Dietz, W.H., Wasserman, R.C., Slora, E.J., Myers, E.F., Sullivan, S., Rockett, H., Thoma, K.A., Dumitru, G. & Resnicow, K.A. (2007) Officebased motivational interviewing to prevent childhood obesity: a feasibility study. Arch Pediatr Adolesc Med. 161(5):495-501. Schwingshackl, L. & Hoffmann, G. (2015) Diet quality as assessed by the healthy eating index, the alternate healthy eating index, the dietary approaches to stop hypertension score, and health outcomes: a systematic review and meta-analysis of cohort studies. J Acad Nutr Diet. 115(5):780-800.e5. Sheldon, K.M. & Elliot, A.J. (1998) Not all personal goals are personal: Comparing autonomous and controlled reasons for goals as predictors of effort and attainment. Personality and Social Psychology Bulletin. 24(5):546-57. Shi, H., Seeley, R.J. & Clegg, D.J. (2009) Sexual differences in the control of energy homeostasis. Front Neuro endocrinol. 30(3):396-404. Siero, F.W., Broer, J., Bemelmans, W.J. & Meyboom-de Jong, B.M. (2000) Impact of group nutrition education and surplus value of Prochaska-based stage-matched information on health-related cognitions and on Mediterranean nutrition behavior. Health Educ Res. 15(5):635-47. Silva, M.N., Markland, D., Minderico, C.S., Vieira, P.N., Castro, M.M., Coutinho, S.R., Santos, T.C., Matos, M.G., Sardinha, L.B. & Teixeira, P.J. (2008) A randomized controlled trial to evaluate self-determination theory for exercise adherence and weight control: rationale and intervention description. BMC Public Health. 8:234. Silva, M.N., Vieira, P.N., Coutinho, S.R., Minderico, C.S., Matos, M.G., Sardinha, L.B. & Teixeira, P.J. (2010) Using self-determination theory to promote physical activity and weight control: a randomized controlled trial in women. J Behav Med. 33(2):110-22. 262 Smith, S.R. & Zachwieja, J.J. (1999) Visceral adipose tissue: a critical review of intervention strategies. Int J Obes Relat Metab Disord. 23(4):329-35. Sofi, F., Abbate, R., Gensini, G.F. & Casini, A. (2010) Accruing evidence on benefits of adherence to the Mediterranean diet on health: an updated systematic review and metaanalysis. Am J Clin Nutr. 92(5):1189-96. Sofi, F., Cesari, F., Abbate, R., Gensini, G.F. & Casini, A. (2008) Adherence to Mediterranean diet and health status: meta-analysis. BMJ. 337:a1344. Sofi, F., Macchi, C., Abbate, R., Gensini, G.F. & Casini, A. (2014) Mediterranean diet and health status: an updated meta-analysis and a proposal for a literature-based adherence score. Public Health Nutr.17(12):2769-82. Sparks, P., Conner, M., James, R., Shepherd, R. & Povey, R. (2001) Ambivalence about health-related behaviours: an exploration in the domain of food choice. Br J Health Psychol. 6(Pt 1):53-68. Steptoe, A., Perkins-Porras, L., Rink, E., Hilton, S. & Cappuccio, F.P. (2004) Psychological and social predictors of changes in fruit and vegetable consumption over 12 months following behavioral and nutrition education counseling. Health Psychol. 23(6):574-81. Steptoe, A., Wardle, J., Cui, W., Bellisle, F., Zotti, A.M., Baranyai, R. & Sanderman, R. (2002) Trends in smoking, diet, physical exercise, and attitudes toward health in European university students from 13 countries, 1990-2000. Prev Med. 35(2):97-104. Stevens, J., Katz, E.G. & Huxley, R.R. (2010) Associations between gender, age and waist circumference. Eur J Clin Nutr. 64(1):6-15. Stunkard, A.J. & Messick, S. (1985) The three-factor eating questionnaire to measure dietary restraint, disinhibition and hunger. J Psychosom Res. 29(1):71-83. Tan, Y.Y., Gast, G.C. & van der Schouw, Y.T. (2010) Gender differences in risk factors for coronary heart disease. Maturitas. 65(2):149-60. Taylor, P.J., Kolt, G.S., Vandelanotte, C., Caperchione, C.M., Mummery, W.K., George, E.S., Karunanithi, M. & Noakes, M.J. (2013) A review of the nature and effectiveness of nutrition interventions in adult males--a guide for intervention strategies. Int J Behav Nutr Phys Act. 10:13. Teixeira, P.J., Going, S.B., Houtkooper, L.B., Cussler, E.C., Metcalfe, L.L., Blew, R.M., Sardinha, L.B. & Lohman, T.G. (2006) Exercise motivation, eating, and body image variables as predictors of weight control. Med Sci Sports Exerc. 38(1):179-88. Teixeira, P.J., Palmeira, A.L. & Vansteenkiste, M. (2012) The role of self-determination theory and motivational interviewing in behavioral nutrition, physical activity, and health: an introduction to the IJBNPA special series. Int J Behav Nutr Phys Act. 9:17. 263 Trichopoulou, A., Costacou, T., Bamia, C. & Trichopoulos, D. (2003) Adherence to a Mediterranean diet and survival in a Greek population. N Engl J Med. 348(26):2599-608. Trichopoulou, A. & Lagiou, P. (1997) Healthy traditional Mediterranean diet: an expression of culture, history, and lifestyle. Nutr Rev. 55(11 Pt 1):383-9. Trichopoulou, A., Naska, A., Orfanos, P. & Trichopoulos, D. (2005) Mediterranean diet in relation to body mass index and waist-to-hip ratio: the Greek European Prospective Investigation into Cancer and Nutrition Study. Am J Clin Nutr. 82(5):935-40. Vallerand, R.J. (1997) Toward a hierarchical model of intrinsic and extrinsic motivation. In Advances in experimental social psychology. New York: Academic Press, pp. 271-360. Vallerand, R.J. & Bissonnette, R. (1992) Intrinsic, extrinsic, and amotivational styles as predictors of behavior: a prospective study. Journal of Personality. 60:599-620. Vallerand, R.J. & Blanchard, C. (1998) Motivation et éducation permanente : Contributions du modèle hiérarchique de la motivation intrinsèque et extrinsèque. Éducation permanente. 136:15-36. Vallerand, R.J., Fortier, M.S. & Guay, F. (1997) Self-determination and persistence in a real-life setting: toward a motivational model of high school dropout. J Pers Soc Psychol. 72(5):1161-76. Vallerand, R.J. & O'Connor, B.P. (1989) Motivation in the elderly: A theoretical framework and some promising findings. Can Psychol. 30:538-50. Vallerand, R.J. & Ratelle, C.F. (2002) Intrinsic and extrinsic motivation: A hierarchical model. In The motivation and self-determination of behavior: Theoretical and applied issues. Rochester, NY: University of Rochester Press. Vansteenkiste, M. & Sheldon, K.M. (2006) There's nothing more practical than a good theory: integrating motivational interviewing and self-determination theory. Br J Clin Psychol. 45(Pt 1):63-82. Vansteenkiste, M., Williams, G.C. & Resnicow, K. (2012) Toward systematic integration between self-determination theory and motivational interviewing as examples of top-down and bottom-up intervention development: autonomy or volition as a fundamental theoretical principle. Int J Behav Nutr Phys Act. 9:23. Verstuyf, J., Patrick, H., Vansteenkiste, M. & Teixeira, P.J. (2012) Motivational dynamics of eating regulation: a self-determination theory perspective. Int J Behav Nutr Phys Act. 9:21. Waijers, P.M., Feskens, E.J. & Ocke, M.C. (2007) A critical review of predefined diet quality scores. Br J Nutr. 97(2):219-31. 264 Wajchenberg, B.L. (2000) Subcutaneous and visceral adipose tissue: their relation to the metabolic syndrome. Endocr Rev. 21(6):697-738. Waller, G. & Matoba, M. (1999) Emotional eating and eating psychopathology in nonclinical groups: a cross-cultural comparison of women in Japan and the United Kingdom. Int J Eat Disord. 26(3):333-40. Wang, Y., Rimm, E.B., Stampfer, M.J., Willett, W.C. & Hu, F.B. (2005) Comparison of abdominal adiposity and overall obesity in predicting risk of type 2 diabetes among men. Am J Clin Nutr. 81(3):555-63. Wardle, J., Griffith, J., Johnson, F. & Rapoport, L. (2000) Intentional weight control and food choice habits in a national representative sample of adults in the UK. Int J Obes Relat Metab Disord. 24(5):534-40. Wardle, J., Haase, A.M., Steptoe, A., Nillapun, M., Jonwutiwes, K. & Bellisle, F. (2004) Gender differences in food choice: the contribution of health beliefs and dieting. Ann Behav Med. 27(2):107-16. Wardle, J., Steptoe, A., Bellisle, F., Davou, B., Reschke, K., Lappalainen, R. & Fredrikson, M. (1997) Healthy dietary practices among European students. Health Psychol. 16(5):44350. Weggemans, R.M., Zock, P.L., Urgert, R. & Katan, M.B. (1999) Differences between men and women in the response of serum cholesterol to dietary changes. Eur J Clin Invest. 29(10):827-34. Welsh, E.M., Jeffery, R.W., Levy, R.L., Langer, S.L., Flood, A.P., Jaeb, M.A. & Laqua, P.S. (2012) Measuring perceived barriers to healthful eating in obese, treatment-seeking adults. J Nutr Educ Behav. 44(6):507-12. Westenhoefer, J., Stunkard, A.J. & Pudel, V. (1999) Validation of the flexible and rigid control dimensions of dietary restraint. Int J Eat Disord. 26(1):53-64. Willett, W.C. (1994) Diet and health: what should we eat? Science. 264(5158):532-7. Willett, W.C., Sacks, F., Trichopoulou, A., Drescher, G., Ferro-Luzzi, A., Helsing, E. & Trichopoulos, D. (1995) Mediterranean diet pyramid: a cultural model for healthy eating. Am J Clin Nutr. 61(6 Suppl):1402S-6S. Williams, C.M. (2004) Lipid metabolism in women. Proc Nutr Soc. 63(1):153-60. Williams, G.C., Freedman, Z.R. & Deci, E.L. (1998) Supporting autonomy to motivate patients with diabetes for glucose control. Diabetes Care. 21(10):1644-51. Williams, G.C., Gagne, M., Ryan, R.M. & Deci, E.L. (2002a) Facilitating autonomous motivation for smoking cessation. Health Psychol. 21(1):40-50. 265 Williams, G.C., Grow, V.M., Freedman, Z.R., Ryan, R.M. & Deci, E.L. (1996) Motivational predictors of weight loss and weight-loss maintenance. J Pers Soc Psychol. 70(1):115-26. Williams, G.C., McGregor, H.A., Sharp, D., Levesque, C., Kouides, R.W., Ryan, R.M. & Deci, E.L. (2006) Testing a self-determination theory intervention for motivating tobacco cessation: supporting autonomy and competence in a clinical trial. Health Psychol. 25(1):91-101. Williams, G.C., McGregor, H.A., Zeldman, A., Freedman, Z.R. & Deci, E.L. (2004) Testing a self-determination theory process model for promoting glycemic control through diabetes self-management. Health Psychol. 23(1):58-66. Williams, G.C., Minicucci, D.S., Kouides, R.W., Levesque, C.S., Chirkov, V.I., Ryan, R.M. & Deci, E.L. (2002b) Self-determination, smoking, diet and health. Health Educ Res. 17(5):512-21. Wong, M., Gucciardi, E., Li, L. & Grace, S.L. (2005) Gender and nutrition management in type 2 diabetes. Can J Diet Pract Res. 66(4):215-20. World Health Organization. (1993) Food and health indicators: computerized presentation. Copenhagen: WHO Regional Office for Europe, Nutrition Programme. Wu, B.N. & O'Sullivan, A.J. (2011) Sex differences in energy metabolism need to be considered with lifestyle modifications in humans. J Nutr Metab. 2011:391809. Yank, V., Stafford, R.S., Rosas, L.G. & Ma, J. (2013) Baseline reach and adoption characteristics in a randomized controlled trial of two weight loss interventions translated into primary care: a structured report of real-world applicability. Contemp Clin Trials. 34(1):126-35. Yusuf, S., Hawken, S., Ounpuu, S., Dans, T., Avezum, A., Lanas, F., McQueen, M., Budaj, A., Pais, P., Varigos, J. & Lisheng, L. (2004) Effect of potentially modifiable risk factors associated with myocardial infarction in 52 countries (the INTERHEART study): casecontrol study. Lancet. 364(9438):937-52. Zazpe, I., Estruch, R., Toledo, E., Sanchez-Tainta, A., Corella, D., Bullo, M., Fiol, M., Iglesias, P., Gomez-Gracia, E., Aros, F., Ros, E., Schroder, H., Serra-Majem, L., Pinto, X., Lamuela-Raventos, R., Ruiz-Gutierrez, V. & Martinez-Gonzalez, M.A. (2010) Predictors of adherence to a Mediterranean-type diet in the PREDIMED trial. Eur J Nutr. 49(2):91-9. Zazpe, I., Sanchez-Tainta, A., Estruch, R., Lamuela-Raventos, R.M., Schroder, H., SalasSalvado, J., Corella, D., Fiol, M., Gomez-Gracia, E., Aros, F., Ros, E., Ruiz-Gutierrez, V., Iglesias, P., Conde-Herrera, M. & Martinez-Gonzalez, M.A. (2008) A large randomized individual and group intervention conducted by registered dietitians increased adherence to Mediterranean-type diets: the PREDIMED study. J Am Diet Assoc. 108(7):1134-44; discussion 1145. 266 ANNEXE : Score méditerranéen 267 Score méditerranéen Pointage 0 1 2 3 4 Produits céréaliers à grains entiers 1 < 1 portion/jour 1-2 portions/jour 3-4 portions/jour 5-6 portions/jour ≥ 7 portions/jour Légumes 2 < 1 portion/jour 1 portion/jour 2 portions/jour 3 portions/jour ≥ 4 portions/jour Fruits 3 < 1 portion/jour 1 portion/jour 2 portions/jour 3 portions/jour ≥ 4 portions/jour Légumineuses, noix et graines 4 < 0,5 portion/jour 0,5 portion/jour 1 portion/jour 2 portions/jour > 2 portions/jour Huile d’olive, olives et margarine à base d’huile d’olive 5 < 1 fois/jour 1 fois/jour 2 fois/jour 3 fois/jour ≥ 4 fois/jour Lait et produits laitiers 6 < 1 portion/jour ou > 4 portions/jour 4 portions/jour 1 portion/jour 2-3 portions/jour Poissons et fruits de mer (autres que panés) 7 Jamais < 1 portion/sem 1 portion/sem 2 portions/sem ≥ 3 portions/sem Volailles (autres que panées) 7 Jamais < 1 portion/sem 1 portion/sem ou ≥ 4 portions/sem 2 portions/sem 3 portions/sem Oeufs ≥ 7/sem Sucreries 8 ≥ 7 fois/sem 5-6 fois/sem 3-4 fois/sem 1-2 fois/sem < 1/sem Viandes rouges, abats et charcuteries 7 ≥ 7 portions/sem 5-6 portions/sem 3-4 portions/sem 1-2 portions/sem < 1 fois/sem 5-6/sem 0-4/sem Pour les produits céréaliers, une portion équivaut à une tranche de pain, ½ tasse de pâtes alimentaires, de riz ou de couscous, et 30 g de céréales. Le mode alimentaire méditerranéen favorise les grains entiers. Par conséquent, un maximum d’un point est attribué à la consommation de produits céréaliers raffinés (par exemple, pain blanc ou céréales raffinées). 1 Pour les légumes, une portion équivaut à ½ tasse ou un légume de taille moyenne. Le mode alimentaire méditerranéen favorise les légumes frais. Par conséquent, un maximum d’un point est attribué à la consommation d’une portion de jus de légume (½ tasse). 2 Pour les fruits, une portion équivaut à ½ tasse ou un fruit de taille moyenne. Le mode alimentaire méditerranéen favorise les fruits frais. Par conséquent, un maximum d’un point est attribué à la consommation d’une portion de jus de fruit (½ tasse). 3 Pour les légumineuses, noix et graines, une portion équivaut à ½ tasse de légumineuses, ¼ tasse de noix ou graines et à 100 g de tofu. 4 Pour l’huile d’olive, un point est attribué pour chaque usage de cette huile. Le mode alimentaire méditerranéen favorise l’utilisation de l’huile d’olive comme principale source de matières grasses. Par conséquent, un maximum d’un point est attribué à la consommation d’huile de canola ou de margarine faite à partir de cette huile. 5 Pour le lait et les produits laitiers, une portion équivaut à une tasse de lait ou de boisson de soya enrichie, 50 g de fromage, ou 175 g de yogourt. 6 7 Pour les viandes rouges, abats et charcuteries, les volailles et le poisson, une portion équivaut à 75 g. Pour les sucreries, une portion équivaut, par exemple, à 1/12 de gâteau, 1/6 de tarte ou une barre de chocolat de format habituel. 8 269