information dossier
Transcription
information dossier
INFORMATION DOSSIER SOMMAIRE SUMMARY 1. Règlement particulier de la compétition - Supplementary Regulations of the competition 2. Horaires - Time tables 3. Listes des engagés - Entry lists 4. Règlements Sportifs et Lubrifiants - Sporting Regulations and lubricants 5. Nouveau kit de montage de carénage avant - New front fairing mounting kit 6. Prescriptions Générales et Spécifiques - General and Specific Prescriptions 7. Divers - Miscellaneous 1 COMMISSION INTERNATIONALE DE KARTING SUPPLEMENTARY REGULATIONS CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIPS Round 2 CIK-FIA KARTING ACADEMY TROPHY Round 1 ZUERA (ESP) Date: 21-24/05/2015 REGULATIONS Organiser: CDE Zuera Racing The final text of these Supplementary Regulations shall be the French version which will be used should any dispute arise as to their interpretation. Headings in this document are for ease of reference only and do not form part of these Supplementary Regulations. Article 1 – Organisation The Competition shall be run in accordance with the International Sporting Code and its appendices, the FIA and CIK-FIA official Bulletins, the General Prescriptions applicable to the CIK-FIA Karting international Competitions and Championships, Cups and Trophies, the Specific Prescriptions applicable to the CIK-FIA Karting Championships, Cups and Trophies, the Sporting Regulations of the CIK-FIA Championships concerned and these Supplementary Regulations. Article 2 – Information specific to the Competition National Sporting Authority: RFEDA Address: c/o Escultor Peresejo 68bis, 28023 ARAVACA, Spain Address: Carratera Nacional 330 -km 521.5 50800 ZUERA, Spain a) Phone: b) Fax: c) E-mail: d) Web: +34/976 553 973 +34/976 697 129 [email protected] www.circuitointernacionaldezuera.es Organising Committee Composition: Mr Jorge Vecino Mr Narciso Gil Mr Luis Carlos Maurel Circuit: a) Length: 1,700 m b) Direction of the track: clockwise c) Side of the pole position: right d) Number of laps in Qualifying Heats/2nd chance heat 9 laps in KZ&KZ2 ; 6 laps in Academy e) * Number of laps in the final phase: Prefinal: 12 laps in KZ&KZ2 9 laps in Academy Final: a) Phone: b) Fax: c) E-mail: d) Web: +34/91 729 94 30 +34/91 357 02 03 [email protected] www.rfeda.es 18 laps in KZ&KZ2 15 laps in Academy * Each Competition will comprise a final phase named «PreFinal» and «Final» or «Pre-Final 1», «Pre-Final 2» and «Final» in accordance with the number of participants in the Competition. 1 Time Schedule of the Competition: See appendix G) Chief Scrutineer Mr Pedro GARCIA (ESP) Technical Checks: Location: Servicing Park Technical building H) Chief Medical Officer Mr José CUARTERO (ESP) Sporting Checks: Location: Secretary Office – Main building I) CIK-FIA Timekeeping Delegate Mr Pierrick BOTTOLLIER (FRA) Briefing" with the Entrants and Drivers "B Location: Briefing room – Main building J) CIK-FIA Coordinator Mr Randolph BATH (NLD) Location of the official posting board: Secretary Office – Main building K) Judges of Facts * Mr Hans-Jürgen DANGERS (DEU) Mr Marcello SOMERA (ITA) Prizes and awards: * In accordance with Article 11.16.3 of the International Sporting Code, judges of facts will have the following remit: at all times during a competition, recording of the incidents described in Article 31 of the Specific Prescriptions of the International Karting Regulations. From the Organiser: Trophies to the top 3 drivers of the Final and to the Winning Team in KZ and KZ2 From the fuel supplier: Panta Article 4 – Insurances To the Winner of the Final in KZ, KZ2 & Academy 25 fuel litre voucher free of charge In compliance with the legal prescriptions, the Organiser has contracted one or several insurance(s) guaranteeing the following risk(s): Article 3 – Main Officials - Third Party Civil Liability with a maximum value of 70,000,000 € (material damage and physical injury) for the meeting. A) Stewards 1) Two international Stewards Mr Philippe LACKMAN (BEL) Mr Victor DE SOUSA (PRT) - Maximum 15,000,000 € (material damage) Sporting meeting. 2) One national Steward Mr Fidel GARCIA (ESP) Article 5 – Protests and Appeals 3) The Chairman of the Panel of Stewards Mr Philippe LACKMAN (BEL) Amount of the Protest fee: 850 €. B) Two CIK-FIA Race Director Mr Nigel EDWARDS (GBR) Mr Joel BLANC (FRA) - Academy Amount of the Appeal fee set by the ASN: 2,500 €. Amount of the international Appeal fee (FIA): 6,000 €. C) Clerk of the Course Mr Desiderio de la VARA (ESP) Article 6 – Organiser’s supplementary provisions Deputy Clerk of the Course Mr David VALENCIANO (ESP) x Name of the Servicing Parks Officer Mr César ABRALDES (ESP) D) Secretary of the event Mr Francisco ARNAL (ESP) x Name of the Assembly Area Officer Mr Marc ABRALDES (ESP) E) CIK-FIA Technical Delegate Mr Hans-Jürgen DANGERS (DEU) x Name of the Officer in charge of the tyres storing rooms Mrs Arancha GARCÍA (ESP) F) CIK-FIA Scrutineer Mr Marcello SOMERA (ITA) 2 x Name of the Officer in charge of Relations with the Press Mrs Cristina GARCÍA (ESP) x Name of the Officer in charge of Relations with the Drivers/Entrants Mr Pere SAURA (ESP) Article 7 – Supplementary conditions 1) 2) From the Saturday preceding the Competition to the Thursday morning, the track will be closed for all competition karts and Drivers. Offenders shall be excluded from the Competition. On Wednesday as from 09h00, the Paddock will be open for all Entrants who have entered the Championship. Each Paddock space (48 sqm) shall be equipped with at least one 5 kg fire extinguisher. Any other «Visitor» Paddock pass will be under the responsibility of the Organiser. 4) It is forbidden to use motorised vehicles such as minimotorcycles, etc., in the Paddock under pain of exclusion. 5) Children under 12 years old who are not permanently accompanied will not be admitted in the Paddock area. Animals who are not kept on a leash will not be authorised on the location of the Competition while the circuit is open to karts. 7) The circuit will be open for Free Practice on Thursday (see detailed timetable), at the price of 100 € per Driver. This amount includes costs and VAT. Free Practice sessions are only open to Drivers who have entered the Championship. 9) Personal passes must be presented at any time and no one will be readmitted without a pass. Personal passes that are not worn by their holders will be confiscated. Lost passes will not be replaced by the Organiser. «Vehicle» passes are only valid if they bear the registration number of the vehicle concerned before entering the Paddock. 11) From Friday to Sunday, vehicles will only have access to the Paddock from 7h00. After having been placed in the Paddock, trailer trucks may not leave it before the end of the event on Sunday evening. The Organiser must entrust a delegate with the control of safety and of the Paddock. 12) It is only authorised to start the engines during the periods of karting track activities and during two periods of 20 minutes designated on the timetable of the competition: one in the morning, before the first track activity and one at the end of the lunch break. Offenders will be penalised by a fine of 250 €. Il is strictly forbidden to smoke or to use any device risking to provoke fire in the Paddock area, the Servicing Parks, the Parc Fermé, the Assembly Area, on the starting grid or on the track (along the course). Offenders, including Officials, will be penalised by a fine of 125 € and may be thrown out of the circuit. A special location for welding and a «smoking» zone will be provided for by the Organiser. It is forbidden to cook in the Paddock, except with a special authorisation from the Organiser. In all cases, these installations shall be electrical, isolated and equipped with at least one 5 kg fire extinguisher. 6) For safety reasons, the Paddock will close at 22h00 and the Organiser will be responsible for surveillance. It is forbidden to stay in the Paddock after 22h00. 10) During the distribution of passes, on presentation of the corresponding licence (Driver and/or Entrant), every Driver and/or Entrant must sign for the receipt of the documents, thereby undertaking to respect all the regulations (FIA, CIK-FIA and supplementary regulations) as well as these Supplementary Conditions. «Entrant», «Driver» and «Mechanic» passes will be issued at the sporting checks. 3) 8) Only the French text is considered authentic. VISA OF THE ASN No. 15006 VISA OF THE CIK-FIA No. 04/2015 3 COMMISSION INTERNATIONALE DE KARTING RÈGLEMENT PARTICULIER CHAMPIONNATS D’EUROPE CIK-FIA DE KZ ET DE KZ2 Compétition 2 TROPHÉE ACADÉMIE CIK-FIA DE KARTING Compétition 1 ZUERA (ESP) Date: 21-24/05/2015 RÈGLEMENT Organiser: CDE Zuera Racing Le texte final du présent Règlement Particulier sera la version française à laquelle il sera fait référence en cas de controverse d'interprétation. Dans ce document, les intitulés sont énoncés aux seules fins de commodité et ne font pas partie du présent Règlement Particulier. Adresse : Carratera Nacional 330 -km 521.5 50800 ZUERA, Espagne a) Téléphone : +34/976 553 973 b) Fax : +34/976 697 129 c) Courriel : [email protected] d) Site : www.circuitointernacionaldezuera.es Article 1 – Organisation La Compétition sera disputée en conformité avec le Code Sportif International et ses Annexes, les Bulletins Officiels de la FIA et de la CIK-FIA, les Prescriptions Générales applicables aux Compétitions internationales et Championnats, Coupes et Trophées CIK-FIA de Karting, les Prescriptions Spécifiques applicables aux Championnats, Coupes et Trophées CIK-FIA de Karting, le Règlement Sportif des Championnats CIK-FIA concernés, ainsi que le présent Règlement Particulier. Comité d'Organisation Composition : M. Jorge Vecino M. Narciso Gil M. Luis Carlos Maurel Circuit : a) Longueur : 1 700 m. Article 2 – Informations spécifiques de la Compétition b) Sens de la course : horaire Autorité Sportive Nationale : c) Côté de la pole-position : droite RFEDA d) Nombre de tours Manches Qualificatives / Repêchage 9 tours en KZ et KZ2; 6 tours en Académie Adresse : c/o Escultor Peresejo 68bis, 28023 ARAVACA, Espagne a) Téléphone : b) Fax : c) Courriel : d) Site : e) Nombre de tours en phase finale : * Préfinale : 12 tours en KZ et KZ2 9 tours en Académie +34/91 729 94 30 +34/91 357 02 03 [email protected] www.rfeda.es Finale : 18 tours en KZ et KZ2 15 tours en Académie * Chaque Compétition comportera une phase finale, nommées «Pré-Finale» et «Finale» ou «Pré-Finale 1», «Pré-Finale 2» et «Finale» selon le nombre de participants à la Compétition. 1 Horaire de la Compétition : Voir annexe. G) Commissaire Technique en Chef M. Pedro GARCIA (ESP) Vérifications Techniques Lieu : Parc Fermé local Technique H) Médecin en Chef M. Mr José CUARTERO (ESP) Vérifications Sportives Lieu : Bureau du Secrétariat – Bâtiment principal I) Délégué Chronométreur CIK-FIA M. Pierrick BOTTOLLIER (FRA) Briefing" avec les Concurrents et les Pilotes "B Lieu : Salle de Briefing – Bâtiment principal J) Coordinateur CIK-FIA M. Randolph BATH (NLD) Emplacement du tableau officiel d'affichage : Bureau du Secrétariat – Bâtiment principal K) Juges de Faits * M. Hans-Jürgen DANGERS (DEU) M. Marcello SOMERA (ITA) Prix et récompenses : * En accord avec l’Article 11.16.3 du Code Sportif International, les juges de faits auront les responsabilités suivantes : de tout temps durant une compétition, enregistrement des incidents décrits à l’Article 31 des Prescriptions Spécifiques des Règlements Internationaux de Karting. De la part de l’Organisateur : Trophées aux 3 premiers pilotes de la Finale et au Team vainqueur en KZ et en KZ2 De la part du fournisseur d’essence : Panta Article 4 – Assurances Au vainqueur de la Finale en KZ, KZ2 et Académie voucher de 25 litres d’essence gratuit Article 3 – Principaux Officiels Conformément aux prescriptions légales, l´Organisateur a conclu une ou des assurance(s) garantissant le(s) risque(s) suivant(s) : A) Commissaires Sportifs - 1) Deux Commissaires Sportifs internationaux M. Philippe LACKMAN (BEL) M. Victor DE SOUSA (PRT) Responsabilité Civile vis-à-vis de tiers à valeur de 70°000°000 € (dommages materiel et corporel) pour l’épreuve. - Maximum 15°000°000 € (dommages materiel) Manifestation sportive. 2) Un Commissaire Sportif National M. Fidel GARCIA (ESP) Article 5 – Réclamations et Appels 3) Le Président du Collège des Commissaires Sportifs M. Philippe LACKMAN (BEL) Montant du droit de Réclamation : 850.- € B) Deux Directeurs d’Épreuve CIK-FIA M. Nigel EDWARDS (GBR) M. Joel BLANC (FRA) - Académie Montant du droit d'Appel national fixé par l’ASN : 2°500 €. C) Directeur de Course M. Desiderio de la VARA (ESP) Montant du droit d'Appel international (FIA) : 6 000 €. Directeur de Course Adjoint M. David VALENCIANO (ESP) Article 6 – Dispositions particulières de l’Organisateur D) Secrétaire de l’épreuve M. Francisco ARNAL (ESP) x Nom du Responsable des Parcs d’Assistance M. César ABRALDES (ESP) E) Délégué Technique CIK-FIA M. Hans-Jürgen DANGERS (DEU) x Nom du Responsable de la Pré-Grille M. Marc ABRALDES (ESP) F) Commissaire Technique CIK-FIA M. Marcello SOMERA (ITA) 2 x Nom du Responsable des locaux de stockage des pneumatiques M. Arancha GARCÍA (ESP) x Nom du Responsable des Relations avec la Presse: M. Cristina GARCÍA (ESP) 7) Le circuit sera ouvert pour les essais libres le jeudi (voir horaire détaillé), au prix de 100 € par pilote. Ce montant s’entend frais et TVA inclus. Ces essais libres sont accessibles uniquement aux Pilotes engagés dans le Championnat. 8) Pour des raisons de sécurité, le Paddock sera fermé à 22h00 et l’organisateur assurera une surveillance. Il est interdit de séjourner dans le Paddock après 22h00. x Nom du Responsable des Relations avec les Pilotes/Concurrents M. Pere SAURA (ESP) 9) Les laissez-passer personnels doivent être présentés à tout moment, il n’y aura pas de réadmission sans laissez-passer. Les laissez-passer personnels qui ne seraient pas portés par leur titulaire seront confisqués. Les laissez-passer perdus ne seront pas remplacés par l’organisateur. Les laissez-passer «Véhicule» ne sont valables que s’ils portent le numéro d’immatriculation du véhicule concerné avant l’entrée au Paddock. Article 7 – Conditions supplémentaires 1) Du samedi précédant la Compétition au jeudi matin, la piste sera fermée à tous les karts et Pilotes de compétition. Les contrevenants seront exclus de la Compétition. Mercredi à partir de 09h00, le Paddock sera ouvert pour tous les Concurrents engagés dans le Championnat. Chaque emplacement de Paddock (48m2) devra être munis d’au moins un extincteur de 5kg. 10) A la distribution des laissez-passer, sur présentation de la licence correspondante (Pilote et/ou Concurrent), chaque Pilote et/ou Concurrent doit signer la réception des documents et de ce fait, s’engage à respecter tous les règlements et les présentes informations générales (Règlement particulier FIA, CIK-FIA aussi bien que les Conditions supplémentaires). 2) Les laisser-passer «Concurrent», «Pilotes» et «Mécaniciens» seront délivrés aux Vérifications Sportives. 3) Tout laissez-passer «Visiteur» Paddock additionnel sera sous la responsabilité de l’Organisateur. 11) Du vendredi au dimanche, les véhicules ne pourront avoir accès au Paddock qu’à partir de 07h00. Les semi-remorques, une fois placées dans le Paddock, ne pourront plus le quitter avant la fin de l’épreuve le dimanche soir. L’organisateur confiera le contrôle de la sécurité et du Paddock à un délégué. 4) Le Paddock est interdit aux engins motorisés, mini motos, etc., sous peine d’exclusion. 5) Il est strictement interdit de fumer et d’utiliser tout appareil risquant de provoquer le feu dans la zone du Paddock, les Parcs d’Assistance, le Parc Fermé, la prégrille, la grille de départ et à l’intérieur de la piste (le long du tracé). Les contrevenants, y compris les Officiels, seront pénalisés d’une amende de 125 € et pourront être expulsés du circuit. Un endroit spécial pour souder et une zone «fumeurs» seront prévus par l’Organisateur. Il est interdit de cuisiner dans le Paddock, sauf avec une autorisation spéciale de l’Organisateur; en tous cas, ces installations devront être électriques, cloisonnées et munies d’au moins un extincteur de 5kg. 12) Il est seulement autorisé de démarrer les moteurs durant les périodes d’activité de karting en piste, ainsi que durant deux périodes de 20 minutes désignées dans l’horaire de la compétition: une le matin, avant la première activité en piste et une autre à la fin de la pause déjeuner. Les contrevenants seront pénalisés d’une amende de 250 €. Seul le texte français fait foi. 6) Les enfants de moins de 12 ans non accompagnés de façon permanente ne seront pas admis dans la zone du Paddock. Les animaux en liberté ne seront pas autorisés sur le lieu de la Compétition pendant que le Circuit est ouvert aux Karts. VISA DE L’ASN No. 15006 VISA DE LA CIK-FIA No. 04/2015 3 2 ZUERA (ESP), 20-24/05/2015 2015 CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIP 2015 CIK-FIA KARTING ACADEMY TROPHY Academy KZ KZ KZ2 Academy 17:00 - 18:00 18:00 - 19:00 17:00 - 17:20 17:35 - 17:55 18:10 - 18:30 Tous All Tous All Briefing (Pilotes & Concurrents) Vérifications Techniques & Distribution des pneus (Essais libres) Distribution du carburant Tous All 15:00 - 18:00 KZ2 Retrait des bons des pneus auprès des Manufacturiers Tous All 14:30 - 17:30 15:00 - 17:00 Collection of equipment (engines and chassis) allocated by drawing lots by the drivers (or a CIKǦFIA official if the driver has not arrived), Engines will be assembled on the chassis by Parolin Retrait du matériel (moteurs et châssis) attribué par tirage au sort réalisé par les pilotes (ou un officiel CIKǦFIA si le pilote n’est pas présent à cette occasion), Montage des moteurs sur les châssis par Parolin Academy 14:30 - 18:00 08.05.2015 Briefing (Drivers & Entrants) Technical Checks & Tyres collection (Free Practice) Fuel distribution 11:06 Tyre vouchers collected from the Manufacturers Sporting Checks & Transponder collection Paddock installation Controls & other Vérifications Sportives & Distribution des transpondeurs Contrôle & autres Tous All Sessions 14:00 - 18:00 Epreuves Installation du Paddock Groupe Group Tous All Classe Class 09:00 - 18:00 Heure Hour MERCREDI / WEDNESDAY 20/05/2015 ZUERA (ESP), 20-24/05/2015 2015 CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIP 2015 CIK-FIA KARTING ACADEMY TROPHY 17:45 - 18:05 17:20 - 17:40 16:55 - 17:15 16:30 - 16:50 16:05 - 16:25 15:40 - 16:00 15:15 - 15:35 14:50 - 15:10 14:25 - 14:45 14:00 - 14:20 13:35 - 13:55 13:10 - 13:30 12:30 - 13:30 12:10 - 12:30 11:45 - 12:05 11:20 - 11:40 10:55 - 11:15 10:30 - 10:50 10:05 - 10:25 09:40 - 10:00 09:15 - 09:35 08:50 - 09:10 08:25 - 08:45 08:00 - 08:20 Heure Hour KZ Academy KZ2 KZ Academy KZ2 KZ Academy KZ2 Classe Class Impair Odd Pair Even Impair Odd Pair Even n° 345-390 n° 323-344 n° 301-322 Impair Odd Pair Even Impair Odd Pair Even n° 345-390 n° 323-344 n° 301-322 Impair Odd Pair Even Impair Odd Pair Even n° 345-390 n° 323-344 n° 301-322 Groupe Group JEUDI / THURSDAY 21/05/2015 Essais libres (3) 20 min Session de Test (3) 20 min Essais libres (3) 20 min Essais libres (2) 20 min Session de Test (2) 20 min Tous All Essais libres (2) 20 min Essais libres (1) 20 min Session de Test (1) 20 min Essais libres (1) 20 min Tous All Epreuves Free Practice (3) 20 min Test Session (3) 20 min Free Practice (3) 20 min Free Practice (2) 20 min Test Session (2) 20 min Free Practice (2) 20 min Free Practice (1) 20 min Test Session (1) 20 min Free Practice (1) 20 min Sessions DÉMARRAGE DES MOTEURS PAUSE DÉMARRAGE DES MOTEURS Contrôle & autres 08.05.2015 START UP ENGINES BREAK START UP ENGINES Controls & other 11:06 2015 CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIP 2015 CIK-FIA KARTING ACADEMY TROPHY ZUERA (ESP), 20-24/05/2015 - - - - - - - - - - - - - - 13:10 15:00 13:35 14:00 14:25 14:50 15:15 15:40 16:05 16:30 16:55 17:20 17:45 10:55 12:30 - 10:30 - - 10:05 12:10 - 09:40 - - 09:15 - - 08:50 11:45 - 08:25 11:20 - - 08:00 Heure Hour 18:05 17:40 17:15 16:50 16:25 16:00 15:35 15:10 14:45 14:20 13:55 18:00 13:30 13:30 12:30 12:05 11:40 11:15 10:50 10:25 10:00 09:35 09:10 08:45 08:20 KZ Academy KZ2 KZ Academy KZ2 KZ Academy KZ2 Classe Class Pair Even Impair Odd Pair Even Impair Odd n° 301-322 n° 323-344 n° 345-390 Pair Even Impair Odd Pair Even Impair Odd n° 301-322 n° 323-344 n° 345-390 Pair Even Impair Odd Pair Even Impair Odd n° 301-322 n° 323-344 n° 345-390 Groupe Group VENDREDI / FRIDAY 22/05/2015 Essais libres (6) 20 min Essais libres (5) 20 min Tous All Essais libres (5) 20 min Essais libres (4) 20 min Tous All Epreuves Free Practice (6) 20 min Free Practice (5) 20 min Free Practice (5) 20 min Free Practice (4) 20 min Sessions 08.05.2015 11:06 START UP ENGINES Tyre vouchers collected from the Manufacturers; Tyres collected (Qualifying Practice - Final) in the Parc Fermé DÉMARRAGE DES MOTEURS BREAK START UP ENGINES Controls & other Retrait des bons des pneus auprès des Manufacturiers Distribution des pneus (Essais Qualificatifs - Finale) dans le Parc PAUSE DÉMARRAGE DES MOTEURS Contrôle & autres 2015 CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIP 2015 CIK-FIA KARTING ACADEMY TROPHY ZUERA (ESP), 20-24/05/2015 10:30 10:45 11:00 11:15 11:30 11:45 10:35 - 10:43 10:50 - 10:58 11:05 - 11:13 11:20 - 11:28 11:35 - 11:43 11:50 - 11:58 C-D B-C Academy KZ 13:45 14:05 14:25 14:45 15:05 15:25 15:45 13:50 - 14:05 14:10 - 14:25 14:30 - 14:45 14:50 - 15:05 15:10 - 15:25 15:30 - 15:45 15:50 - 16:05 17:05 17:25 17:45 17:10 - 17:25 17:30 - 17:45 17:50 - 18:05 KZ2 KZ 16:45 16:50 - 17:05 B-C A-D B-E A-C A-C A-C Academy 16:05 16:25 16:10 - 16:25 D-E A-B B-C A-E 16:30 - 16:45 KZ2 KZ2 KZ 13:25 13:30 - 13:45 A-B B-D A-B Academy 13:05 13:10 - 13:25 C-E Série 1 Series 1 Série 2 Series 2 Série 3 Series 3 Série 1 Series 1 Série 2 Series 2 Série 1 Series 1 Série 2 Series 2 Série 1 Series 1 Série 2 Series 2 Série 3 Series 3 Série 1 Series 1 Série 2 Series 2 Série 1 Series 1 Série 2 Series 2 Groupe Group 12:45 KZ2 KZ Academy KZ2 KZ Academy KZ2 Classe Class 12:50 - 13:05 12:25 - 12:45 12:00 - 12:45 10:15 Pré grille fermée Pre-grid closing 10:20 - 10:28 09:55 - 10:05 09:40 - 09:50 09:25 - 09:35 09:10 - 09:20 08:55 - 09:05 08:40 - 08:50 08:25 - 08:35 08:00 - 08:20 Heure Hour SAMEDI / SATURDAY 23/05/2015 Manche Qualificative (KZ / KZ2: 9 tours; 15 km) (Academy: 6 tours; 10 km) Tous All Essais Qualificatifs Warm-up 10 min Tous All Epreuves Qualifying Heat (KZ / KZ2: 9 laps; 15 km) (Academy: 6 laps; 10 km) Qualifying Practice Warm-up 10 min Sessions Contrôle & autres DÉMARRAGE DES MOTEURS PAUSE DÉMARRAGE DES MOTEURS Controls & other 08.05.2015 START UP ENGINES BREAK START UP ENGINES 11:06 2015 CIK-FIA EUROPEAN KZ & KZ2 CHAMPIONSHIP 2015 CIK-FIA KARTING ACADEMY TROPHY ZUERA (ESP), 20-24/05/2015 KZ 10:15 16:20 16:05 15:35 15:30 15:25 15:20 Tous All KZ Finalistes Finalists Top 3 Top 3 Finale (18 tours; 30 km) Final (23 laps; 30 km) Conférence de presse Podiums DEPART FORMATION DE LA GRILLE MISE EN GRILLE SUR PISTE Podiums Top 3 FORMATION DE LA GRILLE MISE EN GRILLE SUR PISTE DEPART Academy Finale (15 tours; 25 km) 15:15 14:35 Final (19 laps; 25 km) FORMATION DE LA GRILLE MISE EN GRILLE SUR PISTE DÉMARRAGE DES MOTEURS PAUSE Présentation des Pilotes 14:50 14:45 14:40 Finalistes Finalists Final (23 laps; 30 km) Prefinal (12 laps; 20 km) Prefinal (9 laps; 15 km) Prefinal (12 laps; 20 km) Contrôles & autres DÉMARRAGE DES MOTEURS Podiums Top 3 Finale (18 tours; 30 km) Préfinale (12 tours; 20 km) Préfinale (9 tours; 15 km) Préfinale (12 tours; 20 km) Second Chance Heat (9 laps; 15 km) Second Chance Heat (6 laps; 10 km) Second Chance Heat (9 laps; 15 km) Warm-up 10 min Sessions 14:30 Tous All Tous All Manche de Repêchage (9 tours; 15 km) Manche de Repêchage (6 tours; 10 km) Manche de Repêchage (9 tours; 15 km) Warm-up 10 min Epreuves DEPART Finalistes Finalists Prefinal Prefinal (first 28 qualified) Prefinal (first 28 qualified) Tous All Manche de Repêchage Second Chance Heat Manche de Repêchage Second Chance Heat Groupe Group 14:00 13:55 13:50 13:25 - 13:45 KZ2 12:30 12:35 - 12:55 13:45 KZ 12:10 12:15 - 12:30 13:00 - 13:45 KZ2 Academy 11:45 11:50 - 12:10 11:00 - 11:30 10:20 - 10:40 Academy 09:55 10:00 - 10:15 KZ 09:25 - 09:35 KZ2 Academy 09:10 - 09:20 09:35 KZ2 08:55 - 09:05 09:40 - 09:55 Academy 08:40 - 08:50 Classe Class KZ2 Pré grille fermée Pre-grid closing 08:25 - 08:35 08:00 - 08:20 Heure Hour DIMANCHE / SUNDAY 24/05/2015 08.05.2015 Press conference Podiums START STARTING GRID MAKING UP PRE-GRID ON THE TRACK Podiums START STARTING GRID MAKING UP PRE-GRID ON THE TRACK Podiums START STARTING GRID MAKING UP PRE-GRID ON THE TRACK START UP ENGINES BREAK Presentation of Drivers START UP ENGINES Controls & other 11:06 3 < EŽ͘ ŶƚƌLJ>ŝƐƚ;ϮϳƌŝǀĞƌƐͿ ƌŝǀĞƌ EĂƚŝŽŶ ŶƚƌĂŶƚ EĂƚŝŽŶ ƋƵŝƉŵĞŶƚ ϭ ƌĞĞnjĞŶ͕ZŝĐŬ ŝƌĞůZd^ƌů ZŝĐĐŝĂƌĚŽ<ĂƌƚͬWĂƌŝůůĂͬΖƐƚŽŶĞ Ϯ dŚŽŶŽŶ͕:ŽŶĂƚŚĂŶ WƌĂŐĂ<ĂƌƚZĂĐŝŶŐ WƌĂŐĂͬWĂƌŝůůĂͬΖƐƚŽŶĞ ϯ ƌĚŝŐŽ͕DĂƌĐŽ dŽŶLJ<ĂƌƚZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬΖƐƚŽŶĞ ϰ >ĂŵŵĞƌƐ͕ĂƐ &ŽƌŵƵůĂ< &ŽƌŵƵůĂ<ͬWĂƌŝůůĂͬΖƐƚŽŶĞ ϱ >ĞŶŶŽdžͲ>Ăŵď͕:ŽƌĚŽŶ ŝƌĞůZd^ƌů ŝƌĞůƌƚͬWĂƌŝůůĂͬΖƐƚŽŶĞ ϲ WĞdž͕:Žƌƌŝƚ WĞdžZĂĐŝŶŐdĞĂŵ /ŶƚƌĞƉŝĚͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϳ ĞŽŶƚŽ͕WĂŽůŽ Z'^Ɖ Z'ͬDĂdžƚĞƌͬΖƐƚŽŶĞ ϴ ,ĂũĞŬ͕WĂƚƌŝŬ WƌĂŐĂ<ĂƌƚZĂĐŝŶŐ WƌĂŐĂͬWĂƌŝůůĂͬΖƐƚŽŶĞ ϵ ,ĂŶůĞLJ͕ĞŶ DĂĚͲƌŽĐ<ĂƌƚŝŶŐ ƌŽĐWƌŽŵŽƚŝŽŶƐͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϬ dŽƌƐĞůůŝŶŝ͕DŝƌŬŽ d<ZĂĐŝŶŐdĞĂŵWŽůĂŶĚ ZŝĐĐŝĂƌĚŽ<ĂƌƚͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϭ ďďĂƐƐĞ͕ŶƚŚŽŶLJ ^ŽĚŝŬĂƌƚ ^ŽĚŝͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϮ <ŽnjůŝŶƐŬŝ͕ƌŶĂƵĚ ^ŽĚŝŬĂƌƚ ^ŽĚŝͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϰ ĂŵƉŽŶĞƐĐŚŝ͕&ůĂǀŝŽ dŽŶLJ<ĂƌƚZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬΖƐƚŽŶĞ ϭϱ &ŽƌĞ͕ĂǀŝĚĞ Z'^Ɖ Z'ͬDĂdžƚĞƌͬΖƐƚŽŶĞ ϭϲ WƵŚĂŬŬĂ͕^ŝŵŽ Z'^Ɖ Z'ͬDĂdžƚĞƌͬΖƐƚŽŶĞ ϭϳ <ŽŬŬŽ͕,ĞŶƌŝ ŝŶŽZĂĐŝŶŐͬ^ ŝŶŽ<ĂƌƚͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϴ <ƵŽǀŝ͕:ĂŶ <ƵŽǀŝ͕:ĂŶ WĂƌŽůŝŶͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϭϵ /ŐůĞƐŝĂƐ͕:ĠƌĠŵLJ ůƉŚĂ<ĂƌƚŝŶŐ ůƉŚĂ<ĂƌƚŝŶŐͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϮϬ ƵƌĂŶ͕ůĞƐƐĂŶĚƌŽ ZDZĂĐŝŶŐ ZDͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ Ϯϭ DĂƌŝŶĞůůŝ͕EĂƚĂŶ ZDZĂĐŝŶŐ ZDͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ ϮϮ ĂĐŬŵĂŶ͕ŶĚƌĞĂƐ <ŽƐŵŝĐZĂĐŝŶŐĞƉƚ <ŽƐŵŝĐͬsŽƌƚĞdžͬΖƐƚŽŶĞ Ϯϯ >ƵŶĚďĞƌŐ͕ŽƵŐůĂƐ <ŽƐŵŝĐZĂĐŝŶŐĞƉƚ <ŽƐŵŝĐͬsŽƌƚĞdžͬΖƐƚŽŶĞ Ϯϰ WĂĂƵǁĞ͕DĞŶŶŽ ŝƌĞůZd^ƌů ŝƌĞůƌƚͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ Ϯϱ dƵũƵůĂ͕dƵŽŵĂƐ DĂĚͲƌŽĐ<ĂƌƚŝŶŐ ƌŽĐWƌŽŵŽƚŝŽŶƐͬdDZĂĐŝŶŐͬΖƐƚŽŶĞ Ϯϲ Ăůğ͕ŶĚƌĞĂ Ăůğ͕ŶĚƌĞĂ Z'ͬDĂdžƚĞƌͬΖƐƚŽŶĞ Ϯϳ ĂƌůƚŽŶ͕'ĂƌLJ 'ĨŽƌĐĞZĂĐŝŶŐ ZͬDŽĚĞŶĂŶŐŝŶĞƐͬΖƐƚŽŶĞ Ϯϴ ,ĂďƵůŝŶ͕<ƌŝƐƚŝũĂŶ dŬĂƌƚ^ƌů d<ĂƌƚͬDŽĚĞŶĂŶŐŝŶĞƐͬΖƐƚŽŶĞ ƵĞƌĂ;^WͿϮϭͲϮϰͬϬϱͬϮϬϭϱ dŝŵŝŶŐďLJƉĞdždŝŵŝŶŐ Apex Timing - timing solutions and services http://www.apex-timing.com/ WĂŐĞϭͬϭ ƉĞdždŝŵŝŶŐ <Ϯ ŶƚƌLJ>ŝƐƚ;ϲϭƌŝǀĞƌƐͿ EŽ͘ ƌŝǀĞƌ EĂƚŝŽŶ ŶƚƌĂŶƚ ϯϬϭ &ĞĚĞƌĞƌ͕&ĂďŝĂŶ Z'^Ɖ Z'^WͬDĂdžƚĞƌͬ>ĞŽŶƚ ϯϬϮ ^ŝĞďĞĐŬĞ͕DĂŝŬ ^ZWZĂĐŝŶŐdĞĂŵ Z'ͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϬϯ EŽƌƌŝƐ͕:ŽŚŶ DĂĐŚϭDŽƚŽƌƐƉŽƌƚ DĂĐŚϭͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϬϰ :ŽŚĂŶƐƐŽŶ͕:ŽĞů ŶĞƌŐLJŽƌƐĞ ŶĞƌŐLJŽƌƐĞͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϬϱ ĂŶĐŚŝ͕DĂƚƚĞŽ 'WZĂĐŝŶŐ 'WZĂĐŝŶŐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϬϲ <ƌĞŵĞƌƐ͕DĂƌŝũŶ ŝƌĞůZd^ƌů ŝƌĞůƌƚͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϬϳ ŽƌďĞƌŝ͕>ƵĐĂ dŽŶLJ<ĂƌƚZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϬϴ ZŽŵŬĞŵĂ͕ZŝĐĂƌĚŽ <^tŝƌĞůĂƌƚƵƐƚƌŝĂ ŝƌĞůƌƚͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϬϵ ^ƉĞĐŬĞŶ͕'ƵƵƐƚ WZĂĐŝŶŐdĞĂŵ 'ŝůůĂƌĚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϬ WŝĐĐŝŶŝ͕ůĞƐƐŝŽ dŽŶLJ<ĂƌƚZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϭϭ WĞƐĐĂĚŽƌ͕:ŽƌŐĞĂƌůŽƐ WƌĂŐĂ<ĂƌƚZĂĐŝŶŐ WƌĂŐĂͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϭϮ WĞdž͕^ƚĂŶ WĞdžZĂĐŝŶŐdĞĂŵ /ŶƚƌĞƉŝĚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϯ WĂƐŬĞǀŝĐŝƵƐ͕WĂƵůŝƵƐ <ĂƌƚŝŶŐŽŬůƵďĂƐDƐ<Ăƌƚ ŶĞƌŐLJŽƌƐĞͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϰ dƂƌŶƋǀŝƐƚ͕WĞƌƐŽŶĞŶũĂŵŝŶ Z',ŽůůĂŶĚ Z'ͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϱ ĂŶĐŚĞƚƚĂ͕DĂƌĐŽ ůƉŚĂ<ĂƌƚŝŶŐ ůƉŚĂ<ĂƌƚŝŶŐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϲ ZŚLJŶ͕ZƵĚŽůĨ ^ŽůŐĂƚDŽƚŽƌƐƉŽƌƚ ŝƌĞůƌƚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϭϳ ĂŵƉůĞƐĞ͕>ŽƌĞŶnjŽ &ŽƌŵƵůĂ< &ŽƌŵƵůĂ<ͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϭϴ DĂŶĚŽnjnjŝ͕'ŝŽƌŐŝŽůďĞƌƚŽ ŝƌĞůZd^ƌů ŝƌĞůƌƚͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϭϵ EŝůƐƐŽŶ͕ƌĂŶĚŽŶ &ůĂŶĚƌŝĂ<Ăƌƚ^ǁĞĚĞŶ Z<ͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϮϬ /ĚnjŬŽǁƐŬŝ͕ĂƌƚŽƐnj d<ZĂĐŝŶŐdĞĂŵWŽůĂŶĚ ZŝĐĐŝĂƌĚŽ<ĂƌƚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϮϭ ,ŝůƚďƌĂŶĚ͕WĞĚƌŽ Z'^Ɖ Z'^WͬDĂdžƚĞƌͬ>ĞŽŶƚ ϯϮϮ ,ŽƌŝŽ͕&ƵŵĂ Z'^Ɖ Z'^WͬDĂdžƚĞƌͬ>ĞŽŶƚ ϯϮϯ dŝĞŶĞ͕&ĞůŝĐĞ Z'^Ɖ Z'^WͬDĂdžƚĞƌͬ>ĞŽŶƚ ϯϮϰ ZŽƐĂƚŝ͕&ĂďƌŝnjŝŽ Z'^Ɖ Z'^WͬDĂdžƚĞƌͬ>ĞŽŶƚ ϯϮϱ ^ƚĞĞŵĂŶ͕WĞƉŝũŶ Z',ŽůůĂŶĚ Z'ͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϮϲ sĂŶ,ĂĂŶĚĞů͕ŚĂŶƚĂů Z',ŽůůĂŶĚ Z'ͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϮϳ ĞƌŶĂƌĚŽƚƚŽ͕ŶƌŝĐŽ DĂƌĂŶĞůůŽ<Ăƌƚ DĂƌĂŶĞůůŽͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϮϴ ĞďƌŝĂŶƌŝnjĂ͕'ĞƌĂƌĚ DĂƌĂŶĞůůŽ<Ăƌƚ DĂƌĂŶĞůůŽͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϮϵ 'ŝĂŶŶŽŶŝ͕>ŽƌĞŶnjŽ DĂƌĂŶĞůůŽ<Ăƌƚ DĂƌĂŶĞůůŽͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϯϬ DŽƐĐĂ͕dŽŵŵĂƐŽ DĂƌĂŶĞůůŽ<Ăƌƚ DĂƌĂŶĞůůŽͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϭ DLJĞƌƐ͕:ĂŵĞƐ ^ĐƵĚĞƌŝĂWZ^ƌů WZͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϮ ^ƉŝŶĞůůŝ͕>ŽƌŝƐ ^ĐƵĚĞƌŝĂWZ^ƌů WZͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϯ ^ƉŽƌƚĞůůĂ͕'ŝŽǀĂŶŶŝ ^ĐƵĚĞƌŝĂWZ^ƌů WZͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϰ &ŽŶƚĂŝŶĞ͕WĂƵů ůƉŚĂ<ĂƌƚŝŶŐ ůƉŚĂ<ĂƌƚŝŶŐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϱ 'ŽŶnjĂůĞƐ͕EŝĐŽůĂƐ ůƉŚĂ<ĂƌƚŝŶŐ ůƉŚĂ<ĂƌƚŝŶŐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϯϲ ĂǀĂůŝĞƌŝ͕ůďĞƌƚŽ 'ŽůĚ<ĂƌƚZĂĐŝŶŐdĞĂŵ ZŝŐŚĞƚƚŝZŝĚŽůĨŝͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϯϳ >ŽƌŬŽǁƐŬŝ͕dŽŵ:ŽƐĞĨ 'ŽůĚ<ĂƌƚZĂĐŝŶŐdĞĂŵ ZŝŐŚĞƚƚŝZŝĚŽůĨŝͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϯϴ ĞƐĂŶĐĞŶĞnj͕WĂŽůŽ 'ŽƵĚĂŶƚ͕ĠĚƌŝĐ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϯϵ >ĂƵƌĞŶƚ͕dŚŽŵĂƐ 'ŽƵĚĂŶƚ͕ĠĚƌŝĐ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϰϬ njĞĚŽ^ŽƵƐĂ͕zŽŚĂŶ ^ƚƌĂŬŬĂŚĂŝƚĞĐŚ ĂŶĂƌĚŝͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϰϭ ŶŐŵĂŶ͕<ĞǀŝŶ ^ƚƌĂŬŬĂŚĂŝƚĞĐŚ ĂŶĂƌĚŝͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ƵĞƌĂ;^WͿϮϭͲϮϰͬϬϱͬϮϬϭϱ dŝŵŝŶŐďLJƉĞdždŝŵŝŶŐ Apex Timing - timing solutions and services http://www.apex-timing.com/ EĂƚŝŽŶ WĂŐĞϭͬϮ ƋƵŝƉŵĞŶƚ ƉĞdždŝŵŝŶŐ <Ϯ ŶƚƌLJ>ŝƐƚ;ϲϭƌŝǀĞƌƐͿ EŽ͘ ƌŝǀĞƌ EĂƚŝŽŶ ŶƚƌĂŶƚ ϯϰϮ ĞůĞŶƚĂ͕&ƌĂŶĐĞƐĐŽ ĞůĞŶƚĂ͕&ƌĂŶĐĞƐĐŽ WĂƌŽůŝŶͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϰϯ DĂnjnjĂůŝ͕DĂƐƐŝŵŽ DĂĚͲƌŽĐ<ĂƌƚŝŶŐ ƌŽĐWƌŽŵŽƚŝŽŶƐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϰϰ ZĂƐŵƵƐƐĞŶ͕EŝŬŽůĂũ ŝŶŽZĂĐŝŶŐͬ^ ŝŶŽ<ĂƌƚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϰϱ ĂďŝŶŐƚŽŶ͕^ĞĂŶ ŶĞƌŐLJŽƌƐĞ ŶĞƌŐLJŽƌƐĞͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϰϲ dŝůůŽĐĂ͕>ƵĐĂ 'ĨŽƌĐĞZĂĐŝŶŐ ZͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϰϳ ŽƚƚŝƌŽůŝ͕ŶƚŽŝŶĞ 'WZĂĐŝŶŐ 'WZĂĐŝŶŐͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϰϴ ^ĐŚŵŝƚnj͕ůĞdžĂŶĚĞƌ <^DZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϰϵ WŝĞƌƵƐnjĞŬ͕<ĞǀŝŶ <^tŝƌĞůĂƌƚƵƐƚƌŝĂ ŝƌĞůƌƚͬWĂƌŝůůĂͬ>ĞŽŶƚ ϯϱϬ ^ĐŚƵůƚŚĞŝƐƐ͕DĂƌĐĞů DĂĐŚϭDŽƚŽƌƐƉŽƌƚ DĂĐŚϭͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϱϭ DƵƐŝŽ͕>ƵŝŐŝ WĂůŵŝƐĂŶŽ͕DŝĐŚĞůĞDĞĚŽƌŽ WĂƌŽůŝŶͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϱϮ WƌŽƐƉĞƌŝ͕KůŝǀĞƌŶƌŝĐŽ WƌŽƐƉĞƌŝ͕KůŝǀĞƌŶƌŝĐŽ Z'ͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϱϯ EĞŐƌŽ͕ZŝĐĐĂƌĚŽ ZĞŶĚĂ͕ŶƚŽŶŝŽ Z'^WͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϱϰ DĂƌƚLJŶLJƵŬ͕DĂdžŝŵ ^ZWZĂĐŝŶŐdĞĂŵ Z'ͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϱϱ ŝůĚ͕DĂĚƐ d<ZĂĐŝŶŐ ŶĞƌŐLJŽƌƐĞͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϱϲ &ĂƐďĞƌŐ͕ŶĚƌĞĂƐ dŽŶLJ<ĂƌƚZĂĐŝŶŐdĞĂŵ dŽŶLJ<ĂƌƚͬsŽƌƚĞdžͬ>ĞŽŶƚ ϯϴϲ ŽďŽƐDĂŶnjĂŶĂů͕ƌƚƵƌŽ EĂnjĂďĂůƵďŝnjĂƌƌĞƚĂ͕DŝŬĞů /ŶƚƌĞƉŝĚͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϴϳ dĂŶŬŽzƵƌƌĞďĂƐŽ͕:ŽŶ dĂŶŬŽzƵƌƌĞďĂƐŽ͕:ŽŶ /ŶƚƌĞƉŝĚͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ϯϴϴ DŝĐŚ͕dŚŽŵĂƐ DŝĐŚ͕dŚŽŵĂƐ ŝƌĞůƌƚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϴϵ ZŽLJ͕DĂdžŝŵĞ ZŽLJ͕DĂdžŝŵĞ ŝƌĞůƌƚͬdDZĂĐŝŶŐͬ>ĞŽŶƚ ϯϵϬ ZĂŵŽŶ͕ƌŝĐ dŬĂƌƚ^ƌů d<ĂƌƚͬDŽĚĞŶĂŶŐŝŶĞƐͬ>ĞŽŶƚ ƵĞƌĂ;^WͿϮϭͲϮϰͬϬϱͬϮϬϭϱ dŝŵŝŶŐďLJƉĞdždŝŵŝŶŐ Apex Timing - timing solutions and services http://www.apex-timing.com/ EĂƚŝŽŶ WĂŐĞϮͬϮ ƋƵŝƉŵĞŶƚ ƉĞdždŝŵŝŶŐ ĐĂĚĞŵLJ ŶƚƌLJ>ŝƐƚ;ϱϭƌŝǀĞƌƐͿ EŽ͘ ƌŝǀĞƌ EĂƚŝŽŶ ŶƚƌĂŶƚ ϱϬϭ sĂŶĞƌůŽ͕'ůĞŶŶ sĂŶĞƌůŽ͕DĂƌĐĞů WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϮ ƵLJƐ͕LJůĂŶ ƵLJƐ͕ƌŝŬ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϯ dƐƵũŝŵŽƚŽ͕^ŚŝŽŶ dƐƵũŝŵŽƚŽ͕<ƵŶŝLJƵŬŝ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϰ dŽŵŝƚĂ͕ƌƵŐĂ dŽŵŝƚĂ͕<ĞŶũŝ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϱ ĂůŬŝƌĂŶ͕DĞŚŵĞƚDĞƌƚ ĂůŬŝƌĂŶ͕DĞŚŵĞƚKŶĚĞƌ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϲ EŽƵĞƚ͕dŚĠŽ EŽƵĞƚ͕&ƌĞĚĞƌŝĐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϳ ŽƵƌƐŝŵĂƵůƚ͕ŶnjŽ ŽƵƌƐŝŵĂƵůƚ͕:ĞƌŽŵĞ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϴ >ůŽǀĞƌĂƐƌƵŶĞƚ͕yĂǀŝĞƌ >ůŽǀĞƌĂƐŽŵĞƌŵĂ͕ĂƌůŽƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϬϵ >ĂŚŽnj>ŽƉĞnj͕ůĞũĂŶĚƌŽ >ĂŚŽnj͕ZĂŵŽŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϬ ƌŽǁŶ͕ůĨŝĞ ƌŽǁŶ͕ůĂŝƌĞ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϭ ƌĂĚƐŚĂǁ͕ĂůůƵŵ ƌĂĚƐŚĂǁ͕WĞƚĞ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϮ ^ŚĂǁ͕ůůŝŽƚƚ ^ŚĂǁ͕ŶĚƌĞǁ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϯ ^ĐŽƚƚ͕ĞŶŶŝƐͲWĞƚĞƌ ^ĐŽƚƚ͕>ĞĞͲWĞƚĞƌ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϰ ĞůůĂŽůĞƚƚĂ͕DƵƌŝůŽ ĞůůĂŽůĞƚƚĂ͕DĂƌĐŽƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϱ ĞůůĂŽůĞƚƚĂ͕DĂƌĐĞů ĞůůĂŽůĞƚƚĂ͕DĂƌĐŽƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϲ 'ĞŶŝƐŝ͕EŝĐŽůŽ 'ĞŶŝƐŝ͕ůĂƵĚŝŽ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϳ ^ĂŶĚƌĞ͕&ĞĚĞƌŝĐŽ ^ĂŶĚƌĞ͕>ŝǀŝŽ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϴ ŚĞŶŐ͕:ŝĂŶŝĂŶ ŚĞŶŐ͕ŝŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϭϵ &ĂĚŚŝůWƌĂƚĂŵĂ͕&ĞƌƌĞů EƵƌŚĂŵnjĂŚ͕:ƵĨƌŝnjĂů WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϬ ĂŵƵůĂ͕/ůůLJĂ ĂŵƵůĂ͕'ĞŶŶĂĚŝLJ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϭ tŚŝƚĞ͕^ƚƵĂƌƚ tŚŝƚĞ͕ĂǀŝĚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϮ ƚŚĂŶĂƐŽƉŽƵůŽƐ͕^ŽƚŝƌŝŽƐ <ĞǀŽƌŬŝĂŶ͕ƌƐĂŬŽǀŝ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϯ ΖƌĐLJ͕ůĞdžĂŶĚĞƌ ΖƌĐLJ͕^ĐŽƚƚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϰ ^ůƵƚƐŬŝLJ͕ƌƚĞŵ ^ůƵƚƐŬŝLJ͕ZŽŵĂŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϱ ^ůƵƚƐŬŝLJ͕ĂŬŚĂƌ ^ůƵƚƐŬŝLJ͕ZŽŵĂŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϲ EŝůƐƐŽŶ͕ůĨƌĞĚ EŝůƐƐŽŶ͕dŽŶLJ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϳ ŵĞŶĚŽůĂ͕DŝĐŚĞůĂŶŐĞůŽ ŵĞŶĚŽůĂ͕ĂƌŵĞůŽ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϴ ĞtŝůĚĞ͕hŐŽ 'ĞŶƚŝůŝŶŝ͕WĂŽůĂ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϮϵ >ĂƐƐĞŶ͕ŵŝů >ĂƐƐĞŶ͕WĞƚĞƌ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϬ DĂũŽƌŵŽĞŶ͕'ƵƌŽ DĂũŽƌŵŽĞŶ͕DŽƌƚĞŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϭ ,ĞLJĞƌĚĂŚů͕ŵŝů ,ĞLJĞƌĚĂŚů͕ƌŝŬ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϮ DŽŐŚĂĚĂŵƉŽƵƌ͕ĂƌŝƵƐ DŽŐŚĂĚĂŵƉŽƵƌ͕,ŽũĂƚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϯ :ŽŶĞƐ͕:ĂŐŐĞƌ :ŽŶĞƐ͕WĂƌŶĞůů WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϰ >ĞǁŝƐ͕ZLJĂŶ >ĞǁŝƐ͕^ƚĞƉŚĞŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϱ WŽĚŽďƐŬLJ͕>ƵŬĂƐ WŽĚŽďƐŬLJ͕>ƵŬĂƐ^ƌ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϲ ůǀĂƌĂĚŽ͕:ŽƐĠDŝŐƵĞů ůǀĂƌĂĚŽ͕'ŝŽǀĂŶŶŝ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϳ sĂƐŬĞůŝƐ͕<ĂƐƉĂƌĂƐ sĂƐŬĞůŝƐ͕sŝƌŐŝŶŝũƵƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϴ ,ĂƐĂŶ͕,ƵƐƐĂŝŶůŝ ,ĂƐĂŶ͕ůŝďďĂƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϯϵ ĞƐŚĂƌĂ͕dĂůĂů ĞƐŚĂƌĂ͕KƚŚŵĂŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϬ ƌĂĚŚLJĂ͕zĂƐŚ ƌĂĚŚLJĂ͕^ƵũŝƚŚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϭ &ƌĂŶĐŝƐ͕WĂƵůd͘ &ƌĂŶĐŝƐ͕:ŽƐĞƉŚd͘ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ƵĞƌĂ;^WͿϮϭͲϮϰͬϬϱͬϮϬϭϱ dŝŵŝŶŐďLJƉĞdždŝŵŝŶŐ Apex Timing - timing solutions and services http://www.apex-timing.com/ EĂƚŝŽŶ WĂŐĞϭͬϮ ƋƵŝƉŵĞŶƚ ƉĞdždŝŵŝŶŐ ĐĂĚĞŵLJ ŶƚƌLJ>ŝƐƚ;ϱϭƌŝǀĞƌƐͿ EŽ͘ ƌŝǀĞƌ EĂƚŝŽŶ ŶƚƌĂŶƚ ϱϰϮ ^ĐŚůĞƚƚ͕<ƌŝƐƚŽƉŚĞƌ ^ĐŚůĞƚƚ͕ůĞdžĂŶĚƌƵ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϯ ŽŚĞŶ͕/ĚŽ ŽŚĞŶ͕ŵŝŚĂŝ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϰ dĂŶ͕:ƵŶtĞŝƚŚĂŶ dĂŶ͕^ŚƵĂLJdĂƌŶŐsŝŶĐĞŶƚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϱ >ĞĞ͕ŚĂŶũŽŽŶ >ĞĞ͕ŽŶŐǁŽŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϲ ŽƵĐŚĂďŬĞ͕ZƵďĞŶƐ ŽƵĐŚĂďŬĞ͕/ŵĂĚ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϳ ƵĚŽǀƐŬŝƐ͕DŝŚĂŝůƐ ƵĚŽǀƐŬŝƐ͕ůĞdžĂŶĚƌƐ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϴ zƵ͕ZŽLJĐĞ ,ĞƵŶŐ͕zĞĞ<ǁĂŶ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϰϵ ^ĂŶƚŽƐ͕DŝĐŚĂĞů ^ĂŶƚŽƐ͕DŝĐŚĂĞů,͘:ŽƐĞĨ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϱϬ 'ĂƌĐŝĂ>ŽƉĞnj͕DĂƌƚĂ 'ĂƌĐŝĂ͕&ƌĂŶĐŝƐĐŽ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ϱϱϭ WĂLJŽƚDĂĐŝĞů͕>ĂŚĞƌt͘ DĂĐŝĞůůŝďĂŝ͕ƌĐŝůŝŽ WĂƌŽůŝŶͬ&/DͬΖƐƚŽŶĞ ƵĞƌĂ;^WͿϮϭͲϮϰͬϬϱͬϮϬϭϱ dŝŵŝŶŐďLJƉĞdždŝŵŝŶŐ Apex Timing - timing solutions and services http://www.apex-timing.com/ EĂƚŝŽŶ WĂŐĞϮͬϮ ƋƵŝƉŵĞŶƚ ƉĞdždŝŵŝŶŐ 4 CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP RÈGLEMENT SPORTIF SPORTING REGULATIONS La CIK-FIA organise le Championnat d’Europe CIK-FIA de KZ (« le Championnat ») qui est la propriété de la CIK-FIA. Le Championnat couronnera le Pilote Champion d’Europe CIK-FIA de KZ. Toutes les parties concernées (FIA, CIKFIA, ASN, Organisateurs, Promoteur, Concurrents et circuits) s’engagent à appliquer ainsi qu’à observer les règles régissant le Championnat et les Trophées. The CIK-FIA organises the CIK-FIA European KZ Championship («the Championship») which is the property of the CIK-FIA. The Championship will reward the European KZ Champion Driver. All the parties concerned (FIA, CIKFIA, ASNs, Organisers, Promoter, Entrants and circuits) undertake to apply and observe the rules governing the Championship and the Trophies. RÈGLEMENT REGULATIONS /HWH[WH¿QDOGXSUpVHQW5qJOHPHQW6SRUWLIVHUDOD YHUVLRQIUDQoDLVHjODTXHOOHLOVHUDIDLWUpIpUHQFHHQFDVGH controverse d’interprétation. Dans ce document, les intituOpVVRQWpQRQFpVDX[VHXOHV¿QVGHFRPPRGLWpHWQHIRQW SDVSDUWLHGXSUpVHQW5qJOHPHQW6SRUWLI 7KH¿QDOWH[WRIWKHVH6SRUWLQJ5HJXODWLRQVVKDOOEHWKH French version which will be used should any dispute arise as to their interpretation. Headings in this document are for ease of reference only and do not form part of these 6SRUWLQJ5HJXODWLRQV OBLIGATIONS GÉNÉRALES GENERAL UNDERTAKINGS 7RXVOHV3LORWHV&RQFXUUHQWVHW2I¿FLHOVSDUWLFLSDQWDX Championnat s’engagent en leur nom propre et celui de leurs employés et agents, à observer toutes les disposiWLRQVGX&RGH6SRUWLI,QWHUQDWLRQDO©OH&RGHªGX&RGH GH&RQGXLWHVXU&LUFXLWVGH.DUWLQJOH5qJOHPHQW7HFKQLTXHGH.DUWLQJ©OH5qJOHPHQW7HFKQLTXHªOHV3UHVcriptions Générales applicables aux Compétitions internationales et Championnats, Coupes et Trophées CIK-FIA de Karting (« les Prescriptions Générales »), les Prescriptions 6SpFL¿TXHVDSSOLFDEOHVDX[&KDPSLRQQDWV&RXSHVHW Trophées de la CIK-FIA de Karting (« les Prescriptions SpéFL¿TXHVªOH5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQHWOH SUpVHQW5qJOHPHQW6SRUWLI $OO'ULYHUV(QWUDQWVDQG2I¿FLDOVSDUWLFLSDWLQJLQWKH Championship undertake, on behalf of themselves, their employees and agents, to observe all the provisions of the International Sporting Code («the Code»), the Code of Driving Conduct on Karting Circuits, the Karting Technical 5HJXODWLRQV©WKH7HFKQLFDO5HJXODWLRQV»), the General Prescriptions applicable to the CIK-FIA Karting international Competitions and Championships, Cups and Trophies («the General PrescriptionsªWKH6SHFL¿F3UHVFULSWLRQV applicable to the CIK-FIA Karting Championships, Cups and Trophies («WKH6SHFL¿F3UHVFULSWLRQV»), the SupplePHQWDU\5HJXODWLRQVRIWKH&RPSHWLWLRQFRQFHUQHGDQG WKHVH6SRUWLQJ5HJXODWLRQV 3) Seule la CIK-FIA est habilitée à accorder des dérogaWLRQVDXSUpVHQW5qJOHPHQW6SRUWLI 3) Only the CIK-FIA is entitled to grant waivers to these 6SRUWLQJ5HJXODWLRQV LE CHAMPIONNAT : PRINCIPE ET DÉROULEMENT THE CHAMPIONSHIP: PRINCIPLE AND RUNNING 4) Le Championnat se déroule en trois Compétitions. 4) The Championship is run over three Competitions. 5) Les Compétitions comptant pour le Championnat («les Compétitions») auront le statut de compétitions internationales libres. 5) The Competitions counting towards the Championship («the Competitions») will have the status of full international Competitions. &KDTXH&RPSpWLWLRQFRPSRUWHUDXQHSKDVH¿QDOHQRPmées «Pré-Finale» et «Finale» ou «Pré-Finale 1», «PréFinale 2» et «Finale» selon le nombre de participants à la Compétition. Les distances des Pré-Finales et de la Finale, à partir du signal de départ jusqu’au drapeau à damier, seront égales au nombre minimum de tours complets nécessaires pour dépasser respectivement les distances de 20 km et 30 km. Le drapeau à damier sera présenté au NDUWGHWrWHORUVTX¶LOIUDQFKLWODOLJQHG¶DUULYpH©OD/LJQHª jOD¿QGXWRXUSHQGDQWOHTXHOFHWWHGLVWDQFHHVWDWWHLQWH La Ligne consiste en une ligne unique traversant la piste. (DFK&RPSHWLWLRQZLOOFRPSULVHD¿QDOSKDVHQDPHG «Pre-Final» and «Final» or «Pre-Final 1», «Pre-Final 2» and «Final» in accordance with the number of participants in the Competition. The distance of the Pre-Finals and )LQDOIURPWKHVWDUWLQJVLJQDOWRWKHFKHTXHUHGÀDJZLOO be equal to the minimum number of full laps necessary for reaching the respective distances of 20 km and 30 NP7KHFKHTXHUHGÀDJZLOOEHVKRZQWRWKHOHDGLQJNDUW ZKHQLWFURVVHVWKH¿QLVKLQJOLQH©WKH/LQHªDWWKHHQG RIWKHODSGXULQJZKLFKWKDWGLVWDQFHLVUHDFKHG7KH/LQH consists in a single line across the track. CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP CLASSEMENTS CLASSIFICATIONS 7) Le classement du Championnat sera établi comme suit : chaque Pilote pourra totaliser 80% des résultats, arrondis DXFKLIIUHOHSOXVSURFKHVRLW 7KHFODVVL¿FDWLRQRIWKH&KDPSLRQVKLSZLOOEHHVWDblished as follows : 80% of the results rounded up or down WRWKHQHDUHVW¿JXUHZLOOFRXQWLH - si le nombre de Compétitions est compris entre 3 et 7, le plus mauvais résultat obtenu dans les classements interPpGLDLUHVpWDEOLVjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV ainsi que le plus mauvais résultat obtenu lors des Finales seront décomptés. - if the number of Competitions is between 3 and 7, the ZRUVWUHVXOWREWDLQHGLQWKHLQWHUPHGLDWHFODVVL¿FDWLRQV (established after the Qualifying Heats) and the worst result obtained in the Finals will be discounted. 8QUpVXOWDWQXOFRQVpFXWLIjXQHH[FOXVLRQQHSRXUUDSDV être décompté. $EODQNUHVXOWGXHWRDQH[FOXVLRQPD\QRWEHGLVFRXQWHG 8) Le titre de Pilote Champion d’Europe KZ de la CIKFIA sera attribué au Pilote qui aura obtenu le plus grand nombre de points. 8) The title of CIK-FIA European KZ Champion Driver will be awarded to the Driver who has obtained the largest number of points. 9a) À chaque Compétition, le classement intermédiaire pWDEOLjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVGRQQHUDOLHXj une attribution de points aux 10 premiers Pilotes classés, selon le barème suivant : 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9a) $WHDFK&RPSHWLWLRQIRUWKHLQWHUPHGLDWHFODVVL¿FDtion (established after the Qualifying Heats), points will be DZDUGHGWRWKHWRSFODVVL¿HG'ULYHUVDFFRUGLQJWRWKH following scale: 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9b) À chaque Compétition, le classement de la Finale donnera lieu à une attribution de points aux 15 premiers Pilotes classés, selon le barème suivant : 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. E$WHDFK&RPSHWLWLRQIRUWKHFODVVL¿FDWLRQRIWKH)LQDO SRLQWVZLOOEHDZDUGHGWRWKHWRSFODVVL¿HG'ULYHUV according to the following scale: 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. CANDIDATURES DES CONCURRENTS ENTRANTS’ APPLICATIONS 10) Les candidats devront être titulaires de Licences Internationales de Concurrents en cours de validité et des autorisations (visas) nécessaires délivrées par leur ASN DI¿OLpHjOD),$ 10) Applicants must hold valid Entrants’ International /LFHQFHVDQGWKHQHFHVVDU\DXWKRULVDWLRQVYLVDVLVVXHG E\WKHLU$61VDI¿OLDWHGWRWKH),$ 11a) Les candidatures de participation au Championnat devront être soumises à la CIK-FIA au plus tard le 18 mars DXPR\HQGXIRUPXODLUHG¶HQJDJHPHQWGLVSRQLEOHVXU ZZZFLN¿DFRPHWGRLYHQWrWUHDFFRPSDJQpHVGHVFRSLHV des licences et droits d’engagement à l’ordre de la FIA. Les candidats acceptés sont automatiquement admis à toutes les Compétitions du Championnat et seront les seuls Concurrents participant à ces Compétitions. Les canGLGDWVUHIXVpVVHURQWDYLVpVDYDQWOHDYULO 11a) Applications to participate in the Championship shall be submitted to the CIK-FIA by 18 March at the latest by PHDQVRIWKHHQWU\IRUPDYDLODEOHRQZZZFLN¿DFRPDQG must be accompanied by the copies of the licences and entry fee to the order of the FIA. Successful applicants are automatically admitted to all the Championship Competitions and will be the only Entrants at these Competitions. Unsuccessful applications will be QRWL¿HGEHIRUH$SULO ,OHVWSRVVLEOHDSUqVODSXEOLFDWLRQGHODOLVWHRI¿FLHOOHGHV HQJDJpVVXUZZZFLN¿DFRPGHFKDQJHUXQHIRLVDXFRXUV du Championnat : - l’équipement (châssis et/ou moteurs). Ce changement doit être demandé par le Concurrent par e-mail à la CIK YRLUOH5qJOHPHQWFRQFHUQDQWOHV&KDQJHPHQWVGH0DWpULHOVXUZZZFLN¿DFRP±©(QWU\)RUPVª - et/ou le Concurrent. Ce changement doit être demandé SDUOH3LORWHDXPR\HQGXIRUPXODLUHFRQFHUQp $IWHUWKHSXEOLFDWLRQRIWKHRI¿FLDOHQWU\OLVWRQZZZFLN¿D com website, it is possible to change once during the Championship: - the Equipment (chassis and/or engines). This change must be requested by the Entrant by email to WKH&,.VHH5HJXODWLRQVUHJDUGLQJ&KDQJHVRI(TXLSPHQW RQZZZFLN¿DFRP(QWU\)RUPV - and/or the Entrant. This change has to be requested by the Driver by means of the form concerned. 11b) Il est possible de ne s’engager que pour une ComSpWLWLRQGX&KDPSLRQQDW&HWWHIRUPHG¶HQJDJHPHQWHVW appelée «Wild Card». Les Pilotes «Wild Card» ne marqueront pas de points pour le Championnat. Les candidatures de participation à une Compétition du 11b) It is possible to only enter one Championship Competition. This form of entry is called «Wild Card». «Wild Card» Drivers will not score points for the Championship. Applications to participate in one Championship Compe- CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP Championnat devront être soumises à la CIK-FIA au plus WDUGVHPDLQHVDYDQWOHV9pUL¿FDWLRQV6SRUWLYHVGHOD &RPSpWLWLRQFRQFHUQpHDXPR\HQGXIRUPXODLUHG¶HQJDJHPHQWGLVSRQLEOHVXUZZZFLN¿DFRPHWGRLYHQWrWUH accompagnées des copies des licences et droits d’engagement à l’ordre de la FIA. /HVFDQGLGDWVUHIXVpVVHURQWDYLVpVVHPDLQHVDYDQWOHV 9pUL¿FDWLRQV6SRUWLYHVGHOD&RPSpWLWLRQFRQFHUQpH tition shall be submitted to the CIK-FIA at the latest 4 weeks prior to the Sporting Checks of the Competition concerned by means of the entry form available on www. FLN¿DFRPDQGPXVWEHDFFRPSDQLHGE\WKHFRSLHVRIWKH licences and entry fee to the order of the FIA. Le nombre des engagés pour le Championnat ne sera pas limité. The number of entries for the Championship will not be limited. 12) Les candidatures devront comprendre : 12) Applications shall include: DXQHFRQ¿UPDWLRQTXHOHFDQGLGDWHQVRQQRPHWFHOXL de toute personne concernée par sa participation au Championnat a lu et compris le Code, les Prescriptions *pQpUDOHVOHV3UHVFULSWLRQV6SpFL¿TXHVOHV$QQH[HVOH 5qJOHPHQW7HFKQLTXHHWOH5qJOHPHQW6SRUWLIHWV¶HQJDJH à les observer, DFRQ¿UPDWLRQWKDWWKHDSSOLFDQWKDVUHDGDQGXQGHUVWRRG WKH&RGHWKH*HQHUDO3UHVFULSWLRQVWKH6SHFL¿F5HJXODWLRQVWKH$SSHQGLFHVWKH7HFKQLFDO5HJXODWLRQVDQGWKH 6SRUWLQJ5HJXODWLRQVDQGDJUHHVRQKLVRZQEHKDOIDQGRQ behalf of everyone associated with his participation in the Championship, to respect them, b) les noms, coordonnées et détails du Pilote, b) the names, contact details and datas of the Driver, c) l’engagement du candidat à participer à toutes les &RPSpWLWLRQV c) an undertaking by the applicant to participate in every &RPSHWLWLRQ /HVIRUPXODLUHVG¶HQJDJHPHQWLQFRPSOHWVRXVHXOHPHQWHQYR\pVSDUID[RXFRXUULHOQHVHURQWSDVSULVHQ considération. 13) Entry forms that are incomplete or that were sent by ID[RUHPDLORQO\VKDOOQRWEHWDNHQLQWRFRQVLGHUDWLRQ PILOTES ADMIS ELIGIBLE DRIVERS 14a) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré $GpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUPLWp avec l’Article 3.4.4 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14a) Drivers entering the Championship must be holders RID*UDGH$,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHGE\WKHLU $61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOH RIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV'ULYLQJ Conduct. 14b) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré %GpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUPLWp avec l’Article 3.4.3 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14b) Drivers entering the Championship must be holders RID*UDGH%,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHGE\WKHLU $61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOH RIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV'ULYLQJ Conduct. 14c) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré &6HQLRUGpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUmité avec l’Article 3.4.2 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14c) Drivers entering the Championship must be holders RID*UDGH&6HQLRU,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHG E\WKHLU$61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOHRIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV 'ULYLQJ&RQGXFW KARTS ET MATÉRIEL ADMIS ELIGIBLE KARTS AND EQUIPMENT 15) Le Championnat est réservé aux karts de KZ1, tels TXHGp¿QLVSDUOH5qJOHPHQW7HFKQLTXH 7KH&KDPSLRQVKLSLVUHVHUYHGIRU.=NDUWVDVGH¿QHGE\WKH7HFKQLFDO5HJXODWLRQV &KDTXH3LORWHDXUDOHGURLWGHSUpVHQWHUDX[9pUL¿FDtions Techniques le matériel suivant : Nombre de châssis : 2, de même marque Nombre de moteurs : 2, de même marque Trains de pneus « slick»: *, de la marque prescrite pour le Championnat 16) Each Driver will be entitled to submit to Scrutineering the following equipment: Number of chassis : 2, of the same make Number of engines: 2, of the same make Sets of « slick» tyres : *, of the prescribed make for the Championship 8QVXFFHVVIXODSSOLFDQWVZLOOEHQRWL¿HGZHHNVSULRUWR the Sporting Checks of the Competition concerned. CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP Les karts devront être présentés complets (châssis, carrosseries et accessoires montés) avec les moteurs. 7KHNDUWVPXVWEHSUHVHQWHGLQIXOOFRQ¿JXUDWLRQDVVHPEOHGFKDVVLVERG\ZRUNH[WUDFRPSRQHQWVZLWKWKH engines. A partir des Essais Libres, chaque Pilote pourra disposer du matériel suivant : Nombre de châssis : 2 (les 2 marqués aux 9pUL¿FDWLRQV7HFKQLTXHV Nombre de moteurs : 2 (les 2 marqués aux 9pUL¿FDWLRQV7HFKQLTXHV Trains de pneus « slicks » : * (nombre maximum de pneus) Trains de pneus « pluie » : 2 trains de pneus « pluie » QHXIVSRXUOHV(VVDLV4XDOL¿FDWLIVOHV0DQFKHV4XDOL¿FDWLYHVOD0DQFKHGHUHSrFKDJHHWODSKDVH¿QDOH Le nombre de pneus « pluie » réservés aux Essais Libres et aux Warm-Ups n’est pas limité. As from the Free Practice, each Driver may have the following equipment: Number of chassis : 2 (the 2 marked at Scrutineering) Number of engines : 2 (the 2 marked at Scrutineering) 6HWVRI©VOLFNªW\UHV PD[LPXPQXPEHU of tyres) Sets of « wet weather » tyres : 2 sets of new «wet weather» tyres for Qualifying Practice, Qualifying Heats, 6HFRQG&KDQFH+HDWDQG¿QDOSKDVH The number of «wet weather» tyres reserved for Free Practice and Warm-Ups are not limited 120%5(0$;,080'(31(866/,&.6 a) Pouvant être utilisés lors des Essais Libres et des WarmUps : WUDLQVGHSQHXV©VOLFNVªQHXIVSRXUODSUHPLqUH Compétition CIK de l’année dans laquelle un Pilote est engagé (et Pilotes Wild Card) dans la catégorie KZ) 0$;,080180%(52)6/,&.7<5(6 D5HVHUYHGIRUXVHLQ)UHH3UDFWLFHDQG:DUPXSV WUDLQGHSQHXV©VOLFNVªQHXIVWUDLQGHSQHXV© slicks » précédemment attribués d’une Compétition CIK de l’année en cours dans la catégorie KZ (dans toutes les autres Compétitions CIK de l’année en cours dans lesquelles un Pilote est engagé dans la catégorie KZ) - 2 sets of new «slick» tyres + 1 set of previously allocated «slick» tyres of a CIK competition of the current year in the KZ category (in all other CIK competitions of the current year in which a driver is entered in the KZ category) E3RXYDQWrWUHXWLOLVpVGHSXLVOHV(VVDLV4XDOL¿FDWLIV jusqu’à la Finale : WUDLQVGHSQHXV©VOLFNVªQHXIV E5HVHUYHGIRUXVHIURP4XDOLI\LQJ3UDFWLFHXQWLOWKH Final: - 2 sets of new «slick» tyres c) Distribution : /RUVGHFKDTXH&RPSpWLWLRQHWFRQIRUPpPHQWDXSURJUDPPHXQERQGRLWrWUHDFKHWpDXSUqVGX0DQXIDFWXULHU GHSQHXV'LVWULEXWHXU/DGLVWULEXWLRQGHVSQHXVVHIHUD dans le Parc d’Assistance et aura lieu par tirage au sort. Les codes-barres correspondant aux pneus attribués à chaque Pilote seront reproduits sur le Passeport Technique du Pilote concerné. c) Distribution: At the respective Competition and according to the timetable, a voucher must be acquired from the tyre Manufacturer/Distributor.Tyres will be distributed and allocated by random draw in the Servicing Park. The bar codes corresponding to each Driver will be reproduced on the Technical Passport of the Driver concerned. d) Dépôt : Les pneus seront stockés sous la responsabilité du Concurrent/Pilote. d) Stocking: Tyres will be stocked under the responsability of the Entrant/Driver. /¶DSSDUHLOGHPHVXUH0LQL5$(/LWHGHODVRFLpWp©5$( 6\VWHPV,QF86$ªVHUDXWLOLVpHQ(VVDLV4XDOL¿FDWLIV 0DQFKHV4XDOL¿FDWLYHV0DQFKHGH5HSrFKDJHHWSKDVH ¿QDOHSRXUYpUL¿HUTXHOHVSQHXVVRQWHQFRQIRUPLWpDYHF le règlement. La mesure COV des pneus ne devra pas dépasser 15 ppm (valeur limite maximale) en toutes circonstances. Note : La pollution des pneus, par ex. par spray pour chaîne, doit être évitée car elle peut entraîner le dépassement de la valeur limite. 7KHPHDVXULQJGHYLFH0LQL5$(/LWHRIWKHFRPSDQ\ ©5$(6\VWHPV,QF86$ªZLOOEHXVHGLQ4XDOLI\LQJ 3UDFWLFH4XDOLI\LQJ+HDWV6HFRQG&KDQFH+HDWDQG¿QDO phase to check that the tyres are in conformity with the regulations. 7KH92&PHDVXUHPHQWRIWKHW\UHVPD\QRWH[FHHG SSPPD[LPXPOLPLWLQJYDOXHXQGHUDQ\FLUFXPVWDQFHV Note: Pollution of the tyres, e.g. by chain spray, must be avoided since this can result in the limiting value being H[FHHGHG Si le contrôle permet d’établir qu’un ou plusieurs pneus QHVRQWSDVHQFRQIRUPLWpDYHFOHUqJOHPHQWOH3LORWH concerné ne sera pas autorisé à accéder à la Pré-grille (et Should the check establish that one or more tyres are not in conformity with the regulations, the relevant Driver will not be allowed access to the Assembly Area: consequently VHWVRIQHZ©VOLFNªW\UHVLQWKH¿UVW&,.FRPSHWLWLRQ of the year in which a driver is entered (and Wild Card Drivers) in the KZ category) CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP par conséquent ne participera pas à la partie corresponGDQWHGHODFRPSpWLWLRQ(VVDLV4XDOL¿FDWLIV0DQFKHV 4XDOL¿FDWLYHV0DQFKHGH5HSrFKDJHSKDVH¿QDOH/HV réclamations à l’encontre de cette procédure ne sont pas admises. Les réclamations et appels en la matière n’ont SDVG¶HIIHWVXVSHQVLI no participation in the corresponding part of the competition (Qualifying Practice, Qualifying Heats, Second Chance +HDW¿QDOSKDVH3URWHVWVDJDLQVWWKLVSURFHGXUHDUHQRW admitted. Protests and Appeals in this regard do not have a suspensive effect. )RXUQLVVHXUH[FOXVLIGHSQHXV ([FOXVLYHW\UHVXSSOLHU %5,'*(6721(HVWOHIRXUQLVVHXUH[FOXVLIGHSQHXV/HV SQHXVIRXUQLVVHURQWOHVVXLYDQWV %5,'*(6721(LVWKHH[FOXVLYHVXSSOLHURIWKHW\UHV7KH tyres supplied will be as follows: <00'5)=3ULPH;DYDQWHW<00'5)= 3ULPH;DUULqUHSRXUOHVSQHXVVOLFNV</3:(5 ;DYDQWHW</3:(5;DUULqUHSRXU les pneus «pluie». Le prix proposé par Bridgestone est de 180 € le train de pneus slicks et de 185 € le train de pneus «pluie» (TTC). <00'5)=3ULPH;IURQWDQG<00'5 )=3ULPH;UHDUIRUVOLFNW\UHV</3:(5 ;IURQWDQG</3:(5;UHDUIRU©ZHW weather» tyres. The price proposed by Bridgestone is 180 € per set of slick W\UHVDQG¼SHUVHWRI©ZHWZHDWKHUªW\UHVLQFOWD[ Coordonnées de Bridgestone : %ULGJHVWRQH0RWRUVSRUW+ROODQG2I¿FH Mme Annemiek Bonnenkamp Bulkstraat 70, 4158 EC DEIL, Pays-Bas 7pOpSKRQH PRELOH - E-mail: [email protected] Address of Bridgestone: %ULGJHVWRQH0RWRUVSRUW+ROODQG2I¿FH Mrs Annemiek Bonnenkamp %XONVWUDDW(&'(,/WKH1HWKHUODQGV - Phone: +31/345 650 115 +31/653 264 353 (mobile) - E-mail: [email protected] 19) Gestion des deux châssis /HFKRL[GXFKkVVLVSDUPLOHVGHX[PDUTXpVDX[9pUL¿FDWLRQV7HFKQLTXHVSRXUOHV(VVDLVHW0DQFKHV4XDOL¿FDWLIV HW&RXUVHVGHODSKDVH¿QDOHHVWODLVVpjO¶DSSUpFDWLRQ du Pilote. Cependant, en cas de conditions climatiques changeantes, chacun des deux châssis devra être prêt à O¶HPSORLHWPRQWpGDQVGHX[FRQ¿JXUDWLRQVGLIIpUHQWHV l’une de type «sec», l’autre de type «pluie». Les deux châssis devront être introduits en Parc d’Assistance «Départ». Aucun délai supplémentaire ne sera alloué à un Pilote n’ayant pas respecté cette consigne. Seul le châssis sélectionné par le Pilote pourra être amené en Pré-grille ou HQJULOOHHWFHFKRL[VHUDGp¿QLWLI La substitution du châssis sélectionné ne sera autorisée TXHVXUGpFLVLRQGX'LUHFWHXUG¶eSUHXYHHQFDVGH©67$57 DELAYED». Tout Pilote ne disposant pas (ou plus) d’un kart de réserve devra retourner en Parc d’Assistance «Départ» SRXUHIIHFWXHUOHVLQWHUYHQWLRQVPpFDQLTXHVQpFHVVDLUHV et sera invité à s’élancer de la Pré-grille lorsque tous les autres karts auront quitté la Pré-grille ou la grille pour GpPDUUHUOHXUWRXUGHIRUPDWLRQHWUHVWHUDREOLJDWRLUHPHQW jO¶DUULqUHGHODIRUPDWLRQ 19) Management of the two chassis The choice of the chassis (from among the two chassis marked at Scrutineering) to be used for the Qualifying 3UDFWLFHDQG+HDWVDQGUDFHVRIWKH¿QDOSKDVHLVOHIWWR the discretion of the Driver. However, in case of changing weather conditions, each of the two chassis must be ready IRUXVHDQGVHWXSLQWZRGLIIHUHQWFRQ¿JXUDWLRQVRQHRI the “dry-weather” type, the other of the “wet-weather” type. The two chassis must be placed in the “Start” Servicing Park. No additional time will be allowed to a Driver who has not respected these instructions. Only the chassis selected by the driver may be taken to the Assembly Area RUWRWKHJULGDQGWKLVFKRLFHZLOOEH¿QDO The substitution of the selected chassis will be authorised RQO\E\GHFLVLRQRIWKH5DFH'LUHFWRULQWKH&RPSHWLWLRQ WKDW³67$57'(/$<('´LVDQQRXQFHG$Q\'ULYHUZKRGRHV not dispose (or no longer disposes) of a reserve kart shall return to the «Start» Servicing Park in order to carry out WKHQHFHVVDU\PHFKDQLFDOLQWHUYHQWLRQVKHZLOOEHLQYLWHG to leave the Assembly Area only once all the other karts have left the Assembly Area or the Grid to start their formation lap, and he will have to stay at the back of the formation. CARBURANT FUEL 5qJOHPHQWGHGLVWULEXWLRQ Le Conseil Mondial du Sport Automobile de la FIA a décidé GHGpVLJQHU3$17$DSUqVXQHSURFpGXUHG¶DSSHOG¶RIIUHV FRPPHIRXUQLVVHXUH[FOXVLIGXFDUEXUDQW.$57521 type) devant être utilisé par chaque Pilote. 20) Distribution regulations The FIA World Motor Sport Council has decided to designate PANTA, following a tender procedure, as the H[FOXVLYHVXSSOLHURIIXHO.$57521W\SHWREHXVHG by each Driver. /HFDUEXUDQWGHPDUTXH3DQWDVHUDIRXUQLSDU3DQWDDX prix de 4,27 € (TTC) le litre sur le lieu des Compétitions et sans commande préalable par les Concurrents. The fuel of the Panta make will be supplied by Panta at the SULFHRI¼DOOWD[HVLQFOXGHGSHUOLWUHDWWKHYHQXHRI the Competitions, without its being necessary for Competi- CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP Le camion du Fournisseur de carburant désigné arrivera sur le circuit la veille des premiers Essais Libres (voir horaire). &HSURJUDPPHHVWVXMHWjPRGL¿FDWLRQV7RXWHPRGL¿FDWLRQ doit être publiée. tors to order it previously. The appointed fuel Supplier’s lorry will arrive at the circuit WKHGD\EHIRUHWKH¿UVW)UHH3UDFWLFHVHHVFKHGXOH7KLV SURJUDPPHLVVXEMHFWWRPRGL¿FDWLRQV$Q\PRGL¿FDWLRQ shall be published. Le Pilote achète des Bons de 25 litres au Fournisseur de carburant. Les Pilotes doivent impérativement remettre un Bon du Fournisseur de carburant pour obtenir la quantité de carburant sollicitée. The Driver buys 25-litre Vouchers from the fuel Supplier. Drivers shall hand over a Voucher from the fuel Supplier in order to obtain the desired fuel quantity. L’huile destinée au mélange du carburant 2-temps est celle SXEOLpHVXUODOLVWHGHVOXEUL¿DQWVDJUppVSDUOD&,.),$ 7KHOXEULFDQWIRUWKHVWURNHIXHOPL[WXUHLVWKDWSXEOLVKHG in the list of lubricants approved by the CIK-FIA. L’essence sera livrée dans des tonnelets de 30 litres, remSOLVGHOLWUHVFHFLSHUPHWWDQWDX[&RQFXUUHQWVGHIDLUH leur mélange. Les tonnelets seront livrés capsulés. 7KHIXHOVKDOOEHVXSSOLHGLQOLWUHGUXPV¿OOHGZLWK OLWUHVWKLVHQDEOHV(QWUDQWVWRSUHSDUHWKHLUPL[WXUH Drums shall be delivered capped. Coordonnées de Panta : Panta Distribuzione S.P.A., MM. *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/,( 7pO )D[ (PDLOFULVWRIDQLOOLJLRYDQQL#SDQWDLWPRQLFROXFD# panta.it Address of Panta : Panta Distribuzione S.P.A., Messrs *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/< - Phone: +39/0373 235 141 )D[ (PDLOFULVWRIDQLOOLJLRYDQQL#SDQWDLWPRQLFROXFD# panta.it SÉCURITÉ GÉNÉRALE GENERAL SAFETY 21) Article 2.14 des Prescriptions Générales. 21) Article 2.14 of the General Prescriptions. DÉROULEMENT DU CHAMPIONNAT RUNNING OF THE CHAMPIONSHIP 22) Les Compétitions se composeront d’Essais Libres, G¶(VVDLV4XDOL¿FDWLIVGH0DQFKHV4XDOL¿FDWLYHVG¶XQH 0DQFKHGH5HSrFKDJHpYHQWXHOOHHWG¶XQHSKDVH¿QDOH 22) The Competitions will comprise Free Practice, Qualifying Practice, Qualifying Heats, possible Second Chance +HDWDQGD¿QDOSKDVH D(VVDLV/LEUHV$UWLFOH$GHV3UHVFULSWLRQV6SpFL¿TXHV D)UHH3UDFWLFH$UWLFOH$RIWKH6SHFL¿F3UHVFULSWLRQV E(VVDLV4XDOL¿FDWLIV$UWLFOH%GHV3UHVFULSWLRQV 6SpFL¿TXHV E4XDOLI\LQJ3UDFWLFH$UWLFOH%RIWKH6SHFL¿F3UHVcriptions. F0DQFKHV4XDOL¿FDWLYHV$UWLFOH&GHV3UHVFULSWLRQV 6SpFL¿TXHV F4XDOLI\LQJ+HDWV$UWLFOH&RIWKH6SHFL¿F3UHVFULStions. G0DQFKHGH5HSrFKDJH$UWLFOH'GHV3UHVFULSWLRQV 6SpFL¿TXHV G6HFRQG&KDQFH+HDW$UWLFOH'RIWKH6SHFL¿F3HVcriptions H3KDVH¿QDOH: $UWLFOH(GHV3UHVFULSWLRQV6SpFL¿TXHV e) Final phase : $UWLFOH(RIWKH6SHFL¿F3UHVFULSWLRQV GRILLES DE DÉPART STARTING GRIDS 23) Article 2.19 des Prescriptions Générales. 23) Article 2.19 of the General Prescriptions PROCÉDURE DE DÉPART STARTING PROCEDURE 24) Article 2.20 des Prescriptions Générales. 24) Article 2.20 of the General Prescriptions. 25) Type de départs : départs arrêtés pour karts à boîte de YLWHVVHVWHOVTXHGp¿QLVjO¶$UWLFOHGHV3UHVFULSWLRQV Générales. 25) Type of starts: standing starts for karts with gearER[HVDVGH¿QHGLQ$UWLFOHRIWKH*HQHUDO3UHVFULStions. /HV&RPPLVVDLUHV6SRUWLIVSRXUURQWXWLOLVHUWRXW 26) The Stewards may use any video or electronic system CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP système vidéo ou électronique susceptible de les aider à prendre une décision. Les décisions des Commissaires 6SRUWLIVSRXUURQWSUpYDORLUVXUFHOOHVGHV-XJHVGH)DLW 7RXWHLQIUDFWLRQDX[GLVSRVLWLRQVGX&RGHRXGXSUpVHQW 5qJOHPHQW6SRUWLIUHODWLYHVjODSURFpGXUHGHGpSDUW pourra entraîner l’exclusion du Pilote concerné de laCompétition. likely to help them to take a decision. The Stewards’ decisions may supersede those taken by Judges of Fact. Any infringement to the provisions of the Code or of these 6SRUWLQJ5HJXODWLRQVUHODWLQJWRWKHVWDUWLQJSURFHGXUH PD\HQWDLOWKHH[FOXVLRQRIWKH'ULYHUFRQFHUQHGIURPWKH Competition. SUSPENSION D’UNE COURSE SUSPENDING A RACE 27) Article 2.21 des Prescriptions Générales. 27) Article 2.21 of the General Prescriptions. REPRISE D’UNE COURSE RESUMING A RACE 28) Article 2.22 des Prescriptions Générales. 28) Article 2.22 of the General Prescriptions. ARRIVÉE FINISH 29) Article 2.23 des Prescriptions Générales. 29) Article 2.23 of the General Prescriptions. PARC FERMÉ PARC FERMÉ 30) Article 2.13 des Prescriptions Générales. 30) Article 2.13 of the General Prescriptions. INCIDENTS INCIDENTS 31) Article 2.24 des Prescriptions Générales. 31) Article 2.24 of the General Prescriptions. DROITS D’ENGAGEMENT ET FONDS DE PRIX ENTRY FEES AND PRIZE FUND 32) Chaque ASN ayant inscrit un ou plusieurs Pilotes devra verser à la CIK-FIA 252 Euros par Championnat pour alimenter le Fonds de Prix commun récompensant les Championnats. 32) Each ASN having entered one or several Drivers must pay to the CIK-FIA 252 Euros per Championship to contribute to the common Prize Fund, which rewards the Championships. 33) Le droit d’engagement et l’inscription devront être payés et envoyés par le Concurrent. La CIK-FIA devra être en possession des inscriptions au plus tard à la date de FO{WXUH¿[pHDXPDUV/HGURLWG¶LQVFULSWLRQSDU3LORWH pour le Championnat est de 1’560 Euros pour toute insFULSWLRQHQYR\pHDYDQWOHPDUVPLQXLWKHXUHVXLVVH pour les inscriptions soumises entre le 12 mars et le 18 mars, le droit d’inscription sera porté à 2’080 Euros (dont 100 Euros seront versés à chaque Organisateur). 33) Entry fees and entries must be paid and sent by the Entrant. The CIK-FIA must have received entries at the latest on the closing date of entries, set at 18 March. The entry fee per Driver for the Championship is 1,560 Euros for entry applications sent prior to 11 March at midnight 6ZLVVWLPHIRUDSSOLFDWLRQVVXEPLWWHGEHWZHHQ0DUFK and 18 March, the entry fee will be increased to 2,080 Euros (100 Euros of which will be paid to each Organiser). CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP RÈGLEMENT SPORTIF SPORTING REGULATIONS La CIK-FIA organise le Championnat d’Europe CIK-FIA de KZ2 (« le Championnat ») qui est la propriété de la CIK-FIA. Le Championnat couronnera le Pilote Champion d’Europe CIK-FIA de KZ2. Toutes les parties concernées (FIA, CIKFIA, ASN, Organisateurs, Promoteur, Concurrents et circuits) s’engagent à appliquer ainsi qu’à observer les règles régissant le Championnat. The CIK-FIA organises the CIK-FIA European KZ2 Championship («the Championship») which is the property of the CIK-FIA. The Championship will reward the European KZ2 Champion Driver. All the parties concerned (FIA, CIKFIA, ASNs, Organisers, Promoter, Entrants and circuits) undertake to apply and observe the rules governing the Championship. RÈGLEMENT REGULATIONS /HWH[WH¿QDOGXSUpVHQW5qJOHPHQW6SRUWLIVHUDOD YHUVLRQIUDQoDLVHjODTXHOOHLOVHUDIDLWUpIpUHQFHHQFDVGH controverse d’interprétation. Dans ce document, les intituOpVVRQWpQRQFpVDX[VHXOHV¿QVGHFRPPRGLWpHWQHIRQW SDVSDUWLHGXSUpVHQW5qJOHPHQW6SRUWLI 7KH¿QDOWH[WRIWKHVH6SRUWLQJ5HJXODWLRQVVKDOOEHWKH French version which will be used should any dispute arise as to their interpretation. Headings in this document are for ease of reference only and do not form part of these 6SRUWLQJ5HJXODWLRQV OBLIGATIONS GÉNÉRALES GENERAL UNDERTAKINGS 7RXVOHV3LORWHV&RQFXUUHQWVHW2I¿FLHOVSDUWLFLSDQWDX Championnat s’engagent en leur nom propre et celui de leurs employés et agents, à observer toutes les disposiWLRQVGX&RGH6SRUWLI,QWHUQDWLRQDO©OH&RGHªGX&RGH GH&RQGXLWHVXU&LUFXLWVGH.DUWLQJOH5qJOHPHQW7HFKQLTXHGH.DUWLQJ©OH5qJOHPHQW7HFKQLTXHªOHV3UHVcriptions Générales applicables aux Compétitions internationales et Championnats, Coupes et Trophées CIK-FIA de Karting (« les Prescriptions Générales »), les Prescriptions 6SpFL¿TXHVDSSOLFDEOHVDX[&KDPSLRQQDWV&RXSHVHW Trophées de la CIK-FIA de Karting (« les Prescriptions SpéFL¿TXHVªOH5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQHWOH SUpVHQW5qJOHPHQW6SRUWLI $OO'ULYHUV(QWUDQWVDQG2I¿FLDOVSDUWLFLSDWLQJLQWKH Championship undertake, on behalf of themselves, their employees and agents, to observe all the provisions of the International Sporting Code («the Code»), the Code of Driving Conduct on Karting Circuits, the Karting Technical 5HJXODWLRQV©WKH7HFKQLFDO5HJXODWLRQV»), the General Prescriptions applicable to the CIK-FIA Karting international Competitions and Championships, Cups and Trophies («the General PrescriptionsªWKH6SHFL¿F3UHVFULSWLRQV applicable to the CIK-FIA Karting Championships, Cups and Trophies («WKH6SHFL¿F3UHVFULSWLRQV»), the SupplePHQWDU\5HJXODWLRQVRIWKH&RPSHWLWLRQFRQFHUQHGDQG WKHVH6SRUWLQJ5HJXODWLRQV 3) Seule la CIK-FIA est habilitée à accorder des dérogaWLRQVDXSUpVHQW5qJOHPHQW6SRUWLI 3) Only the CIK-FIA is entitled to grant waivers to these 6SRUWLQJ5HJXODWLRQV LE CHAMPIONNAT : PRINCIPE ET DÉROULEMENT THE CHAMPIONSHIP: PRINCIPLE AND RUNNING 4) Le Championnat se déroule en trois Compétitions. 4) The Championship is run over three Competitions. 5) Les Compétitions comptant pour le Championnat («les Compétitions») auront le statut de compétitions internationales libres. 5) The Competitions counting towards the Championship («the Competitions») will have the status of full international Competitions. &KDTXH&RPSpWLWLRQFRPSRUWHUDXQHSKDVH¿QDOHQRPmées «Pré-Finale» et «Finale» ou «Pré-Finale 1», «PréFinale 2» et «Finale» selon le nombre de participants à la Compétition. Les distances des Pré-Finales et de la Finale, à partir du signal de départ jusqu’au drapeau à damier, seront égales au nombre minimum de tours complets nécessaires pour dépasser respectivement les distances de 20 km et 30 km. Le drapeau à damier sera présenté au NDUWGHWrWHORUVTX¶LOIUDQFKLWODOLJQHG¶DUULYpH©OD/LJQHª jOD¿QGXWRXUSHQGDQWOHTXHOFHWWHGLVWDQFHHVWDWWHLQWH La Ligne consiste en une ligne unique traversant la piste. (DFK&RPSHWLWLRQZLOOFRPSULVHD¿QDOSKDVHQDPHG «Pre-Final» and «Final» or «Pre-Final 1», «Pre-Final 2» and «Final» in accordance with the number of participants in the Competition. The distance of the Pre-Finals and )LQDOIURPWKHVWDUWLQJVLJQDOWRWKHFKHTXHUHGÀDJZLOO be equal to the minimum number of full laps necessary for reaching the respective distances of 20 km and 30 NP7KHFKHTXHUHGÀDJZLOOEHVKRZQWRWKHOHDGLQJNDUW ZKHQLWFURVVHVWKH¿QLVKLQJOLQH©WKH/LQHªDWWKHHQG RIWKHODSGXULQJZKLFKWKDWGLVWDQFHLVUHDFKHG7KH/LQH consists in a single line across the track. CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP CLASSEMENTS CLASSIFICATIONS 7) Le classement du Championnat sera établi comme suit : chaque Pilote pourra totaliser 80% des résultats, arrondis DXFKLIIUHOHSOXVSURFKHVRLW 7KHFODVVL¿FDWLRQRIWKH&KDPSLRQVKLSZLOOEHHVWDblished as follows : 80% of the results rounded up or down WRWKHQHDUHVW¿JXUHZLOOFRXQWLH - si le nombre de Compétitions est compris entre 3 et 7, le plus mauvais résultat obtenu dans les classements interPpGLDLUHVpWDEOLVjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV ainsi que le plus mauvais résultat obtenu lors des Finales seront décomptés. - if the number of Competitions is between 3 and 7, the ZRUVWUHVXOWREWDLQHGLQWKHLQWHUPHGLDWHFODVVL¿FDWLRQV (established after the Qualifying Heats) and the worst result obtained in the Finals will be discounted. 8QUpVXOWDWQXOFRQVpFXWLIjXQHH[FOXVLRQQHSRXUUDSDV être décompté. $EODQNUHVXOWGXHWRDQH[FOXVLRQPD\QRWEHGLVFRXQWHG 8) Le titre de Pilote Champion d’Europe KZ2 de la CIKFIA sera attribué au Pilote qui aura obtenu le plus grand nombre de points. 8) The title of CIK-FIA European KZ2 Champion Driver will be awarded to the Driver who has obtained the largest number of points. 9a) À chaque Compétition, le classement intermédiaire pWDEOLjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVGRQQHUDOLHXj une attribution de points aux 10 premiers Pilotes classés, selon le barème suivant : 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9a) $WHDFK&RPSHWLWLRQIRUWKHLQWHUPHGLDWHFODVVL¿FDtion (established after the Qualifying Heats), points will be DZDUGHGWRWKHWRSFODVVL¿HG'ULYHUVDFFRUGLQJWRWKH following scale: 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9b) À chaque Compétition, le classement de la Finale donnera lieu à une attribution de points aux 15 premiers Pilotes classés, selon le barème suivant : 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. E$WHDFK&RPSHWLWLRQIRUWKHFODVVL¿FDWLRQRIWKH)LQDO SRLQWVZLOOEHDZDUGHGWRWKHWRSFODVVL¿HG'ULYHUV according to the following scale: 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. CANDIDATURES DES CONCURRENTS ENTRANTS’ APPLICATIONS 10) Les candidats devront être titulaires de Licences Internationales de Concurrents en cours de validité et des autorisations (visas) nécessaires délivrées par leur ASN DI¿OLpHjOD),$ 10) Applicants must hold valid Entrants’ International /LFHQFHVDQGWKHQHFHVVDU\DXWKRULVDWLRQVYLVDVLVVXHG E\WKHLU$61VDI¿OLDWHGWRWKH),$ 11a) Les candidatures de participation au Championnat devront être soumises à la CIK-FIA au plus tard le 18 mars DXPR\HQGXIRUPXODLUHG¶HQJDJHPHQWGLVSRQLEOHVXU ZZZFLN¿DFRPHWGRLYHQWrWUHDFFRPSDJQpHVGHVFRSLHV des licences et droits d’engagement à l’ordre de la FIA. Les candidats acceptés sont automatiquement admis à toutes les Compétitions du Championnat et seront les seuls Concurrents participant à ces Compétitions. Les canGLGDWVUHIXVpVVHURQWDYLVpVDYDQWOHDYULO 11a) Applications to participate in the Championship shall be submitted to the CIK-FIA by 18 March at the latest by PHDQVRIWKHHQWU\IRUPDYDLODEOHRQZZZFLN¿DFRPDQG must be accompanied by the copies of the licences and entry fee to the order of the FIA. Successful applicants are automatically admitted to all the Championship Competitions and will be the only Entrants at these Competitions. Unsuccessful applications will be QRWL¿HGEHIRUH$SULO ,OHVWSRVVLEOHDSUqVODSXEOLFDWLRQGHODOLVWHRI¿FLHOOHGHV HQJDJpVVXUZZZFLN¿DFRPGHFKDQJHUXQHIRLVDXFRXUV du Championnat : - l’équipement (châssis et/ou moteurs). Ce changement doit être demandé par le Concurrent par e-mail à la CIK YRLUOH5qJOHPHQWFRQFHUQDQWOHV&KDQJHPHQWVGH0DWpULHOVXUZZZFLN¿DFRP±©(QWU\)RUPVª - et/ou le Concurrent. Ce changement doit être demandé SDUOH3LORWHDXPR\HQGXIRUPXODLUHFRQFHUQp $IWHUWKHSXEOLFDWLRQRIWKHRI¿FLDOHQWU\OLVWRQZZZFLN¿D com website, it is possible to change once during the Championship: - the Equipment (chassis and/or engines). This change must be requested by the Entrant by email to WKH&,.VHH5HJXODWLRQVUHJDUGLQJ&KDQJHVRI(TXLSPHQW RQZZZFLN¿DFRP(QWU\)RUPV - and/or the Entrant. This change has to be requested by the Driver by means of the form concerned. 11b) Il est possible de ne s’engager que pour une ComSpWLWLRQGX&KDPSLRQQDW&HWWHIRUPHG¶HQJDJHPHQWHVW appelée «Wild Card». Les Pilotes «Wild Card» ne marqueront pas de points pour le Championnat. Les candidatures de participation à une Compétition du 11b) It is possible to only enter one Championship Competition. This form of entry is called «Wild Card». «Wild Card» Drivers will not score points for the Championship. Applications to participate in one Championship Compe- CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP Championnat devront être soumises à la CIK-FIA au plus WDUGVHPDLQHVDYDQWOHV9pUL¿FDWLRQV6SRUWLYHVGHOD &RPSpWLWLRQFRQFHUQpHDXPR\HQGXIRUPXODLUHG¶HQJDJHPHQWGLVSRQLEOHVXUZZZFLN¿DFRPHWGRLYHQWrWUH accompagnées des copies des licences et droits d’engagement à l’ordre de la FIA. /HVFDQGLGDWVUHIXVpVVHURQWDYLVpVVHPDLQHVDYDQWOHV 9pUL¿FDWLRQV6SRUWLYHVGHOD&RPSpWLWLRQFRQFHUQpH tition shall be submitted to the CIK-FIA at the latest 4 weeks prior to the Sporting Checks of the Competition concerned by means of the entry form available on www. FLN¿DFRPDQGPXVWEHDFFRPSDQLHGE\WKHFRSLHVRIWKH licences and entry fee to the order of the FIA. Le nombre des engagés pour le Championnat ne sera pas limité. The number of entries for the Championship will not be limited. 12) Les candidatures devront comprendre : 12) Applications shall include: DXQHFRQ¿UPDWLRQTXHOHFDQGLGDWHQVRQQRPHWFHOXL de toute personne concernée par sa participation au Championnat a lu et compris le Code, les Prescriptions *pQpUDOHVOHV3UHVFULSWLRQV6SpFL¿TXHVOHV$QQH[HVOH 5qJOHPHQW7HFKQLTXHHWOH5qJOHPHQW6SRUWLIHWV¶HQJDJH à les observer, DFRQ¿UPDWLRQWKDWWKHDSSOLFDQWKDVUHDGDQGXQGHUVWRRG WKH&RGHWKH*HQHUDO3UHVFULSWLRQVWKH6SHFL¿F5HJXODWLRQVWKH$SSHQGLFHVWKH7HFKQLFDO5HJXODWLRQVDQGWKH 6SRUWLQJ5HJXODWLRQVDQGDJUHHVRQKLVRZQEHKDOIDQGRQ behalf of everyone associated with his participation in the Championship, to respect them, b) les noms, coordonnées et détails du Pilote, b) the names, contact details and datas of the Driver, c) l’engagement du candidat à participer à toutes les &RPSpWLWLRQV c) an undertaking by the applicant to participate in every &RPSHWLWLRQ /HVIRUPXODLUHVG¶HQJDJHPHQWLQFRPSOHWVRXVHXOHPHQWHQYR\pVSDUID[RXFRXUULHOQHVHURQWSDVSULVHQ considération. 13) Entry forms that are incomplete or that were sent by ID[RUHPDLORQO\VKDOOQRWEHWDNHQLQWRFRQVLGHUDWLRQ PILOTES ADMIS ELIGIBLE DRIVERS 14a) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré $GpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUPLWp avec l’Article 3.4.4 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14a) Drivers entering the Championship must be holders RID*UDGH$,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHGE\WKHLU $61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOH RIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV'ULYLQJ Conduct. 14b) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré %GpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUPLWp avec l’Article 3.4.3 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14b) Drivers entering the Championship must be holders RID*UDGH%,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHGE\WKHLU $61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOH RIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV'ULYLQJ Conduct. 14c) Les Pilotes s’engageant au Championnat doivent être titulaires d’une Licence Internationale de Karting de Degré &6HQLRUGpOLYUpHSDUOHXU$61DI¿OLpHjOD),$HQFRQIRUmité avec l’Article 3.4.2 des Licences Internationales de Karting pour Pilotes & du Code de Conduite. 14c) Drivers entering the Championship must be holders RID*UDGH&6HQLRU,QWHUQDWLRQDO.DUWLQJ/LFHQFHLVVXHG E\WKHLU$61DI¿OLDWHGWRWKH),$LQFRPSOLDQFHZLWK$UWLFOHRIWKH,QWHUQDWLRQDO.DUWLQJ/LFHQFHVIRU'ULYHUV 'ULYLQJ&RQGXFW KARTS ET MATÉRIEL ADMIS ELIGIBLE KARTS AND EQUIPMENT 15) Le Championnat est réservé aux karts de KZ2, tels TXHGp¿QLVSDUOH5qJOHPHQW7HFKQLTXH 7KH&KDPSLRQVKLSLVUHVHUYHGIRU.=NDUWVDVGH¿QHGE\WKH7HFKQLFDO5HJXODWLRQV &KDTXH3LORWHDXUDOHGURLWGHSUpVHQWHUDX[9pUL¿FDtions Techniques le matériel suivant : Nombre de châssis : 2, de même marque Nombre de moteurs : 2, de même marque Trains de pneus « slick»: *, de la marque prescrite pour le Championnat 16) Each Driver will be entitled to submit to Scrutineering the following equipment: Number of chassis : 2, of the same make Number of engines: 2, of the same make Sets of « slick» tyres : *, of the prescribed make for the Championship 8QVXFFHVVIXODSSOLFDQWVZLOOEHQRWL¿HGZHHNVSULRUWR the Sporting Checks of the Competition concerned. CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP Les karts devront être présentés complets (châssis, carrosseries et accessoires montés) avec les moteurs. 7KHNDUWVPXVWEHSUHVHQWHGLQIXOOFRQ¿JXUDWLRQDVVHPEOHGFKDVVLVERG\ZRUNH[WUDFRPSRQHQWVZLWKWKH engines. A partir des Essais Libres, chaque Pilote pourra disposer du matériel suivant : 1RPEUHGHFKkVVLV OHVPDUTXpVDX[9pUL¿ cations Techniques) 1RPEUHGHPRWHXUV OHVPDUTXpVDX[9pUL¿ cations Techniques) Trains de pneus « slicks » : * (nombre maximum de pneus) Trains de pneus « pluie » : 2 trains de pneus « pluie » QHXIVSRXUOHV(VVDLV4XDOL¿FDWLIVOHV0DQFKHV4XDOL¿FDWLYHVOD0DQFKHGHUHSrFKDJHHWODSKDVH¿QDOH Le nombre de pneus « pluie » réservés aux Essais Libres et aux Warm-Ups n’est pas limité. As from the Free Practice, each Driver may have the following equipment: Number of chassis : 2 (the 2 marked at Scrutineering) Number of engines : 2 (the 2 marked at Scrutineering) 6HWVRI©VOLFNªW\UHV PD[LPXPQXPEHU of tyres) Sets of « wet weather » tyres : 2 sets of new «wet weather» tyres for Qualifying Practice, Qualifying Heats, 6HFRQG&KDQFH+HDWDQG¿QDOSKDVH The number of «wet weather» tyres reserved for Free Practice and Warm-Ups are not limited 120%5(0$;,080'(31(866/,&.6 a) Pouvant être utilisés lors des Essais Libres et des WarmUps : WUDLQVGHSQHXV©VOLFNVªQHXIVSRXUODSUHPLqUH Compétition CIK de l’année dans laquelle un Pilote est engagé (et Pilotes Wild Card) dans la catégorie KZ2) 0$;,080180%(52)6/,&.7<5(6 D5HVHUYHGIRUXVHLQ)UHH3UDFWLFHDQG:DUPXSV WUDLQVGHSQHXV©VOLFNVªQHXIVWUDLQGHSQHXV© slicks » précédemment attribués d’une Compétition CIK de l’année en cours dans la catégorie KZ2 (dans toutes les autres Compétitions CIK de l’année en cours dans lesquelles un Pilote est engagé dans la catégorie KZ2) - 2 sets of new «slick» tyres + 1 set of previously allocated «slick» tyres of a CIK competition of the current year in the KZ2 category (in all other CIK competitions of the current year in which a driver is entered in the KZ2 category) E3RXYDQWrWUHXWLOLVpVGHSXLVOHV(VVDLV4XDOL¿FDWLIV jusqu’à la Finale : WUDLQVGHSQHXV©VOLFNVªQHXIV E5HVHUYHGIRUXVHIURP4XDOLI\LQJ3UDFWLFHXQWLOWKH Final: - 2 sets of new «slick» tyres c) Distribution : /RUVGHFKDTXH&RPSpWLWLRQHWFRQIRUPpPHQWDXSURJUDPPHXQERQGRLWrWUHDFKHWpDXSUqVGX0DQXIDFWXULHU GHSQHXV'LVWULEXWHXU/DGLVWULEXWLRQGHVSQHXVVHIHUD dans le Parc d’Assistance et aura lieu par tirage au sort. Les codes-barres correspondant aux pneus attribués à chaque Pilote seront reproduits sur le Passeport Technique du Pilote concerné. c) Distribution: At the respective Competition and according to the timetable, a voucher must be acquired from the tyre Manufacturer/Distributor.Tyres will be distributed and allocated by random draw in the Servicing Park. The bar codes corresponding to each Driver will be reproduced on the Technical Passport of the Driver concerned. d) Dépôt : Les pneus seront stockés sous la responsabilité du Concurrent/Pilote. d) Stocking: Tyres will be stocked under the responsability of the Entrant/Driver. /¶DSSDUHLOGHPHVXUH0LQL5$(/LWHGHODVRFLpWp©5$( 6\VWHPV,QF86$ªVHUDXWLOLVpHQ(VVDLV4XDOL¿FDWLIV 0DQFKHV4XDOL¿FDWLYHV0DQFKHGH5HSrFKDJHHWSKDVH ¿QDOHSRXUYpUL¿HUTXHOHVSQHXVVRQWHQFRQIRUPLWpDYHF le règlement. La mesure COV des pneus ne devra pas dépasser 15 ppm (valeur limite maximale) en toutes circonstances. Note : La pollution des pneus, par ex. par spray pour chaîne, doit être évitée car elle peut entraîner le dépassement de la valeur limite. 7KHPHDVXULQJGHYLFH0LQL5$(/LWHRIWKHFRPSDQ\ ©5$(6\VWHPV,QF86$ªZLOOEHXVHGLQ4XDOLI\LQJ 3UDFWLFH4XDOLI\LQJ+HDWV6HFRQG&KDQFH+HDWDQG¿QDO phase to check that the tyres are in conformity with the regulations. 7KH92&PHDVXUHPHQWRIWKHW\UHVPD\QRWH[FHHG SSPPD[LPXPOLPLWLQJYDOXHXQGHUDQ\FLUFXPVWDQFHV Note: Pollution of the tyres, e.g. by chain spray, must be avoided since this can result in the limiting value being H[FHHGHG Si le contrôle permet d’établir qu’un ou plusieurs pneus QHVRQWSDVHQFRQIRUPLWpDYHFOHUqJOHPHQWOH3LORWH concerné ne sera pas autorisé à accéder à la Pré-grille (et Should the check establish that one or more tyres are not in conformity with the regulations, the relevant Driver will not be allowed access to the Assembly Area: consequently VHWVRIQHZ©VOLFNªW\UHVLQWKH¿UVW&,.FRPSHWLWLRQ of the year in which a driver is entered in a CIK competition (and Wild Card Drivers) in the KZ2 category) CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP par conséquent ne participera pas à la partie corresponGDQWHGHODFRPSpWLWLRQ(VVDLV4XDOL¿FDWLIV0DQFKHV 4XDOL¿FDWLYHV0DQFKHGH5HSrFKDJHSKDVH¿QDOH/HV réclamations à l’encontre de cette procédure ne sont pas admises. Les réclamations et appels en la matière n’ont SDVG¶HIIHWVXVSHQVLI no participation in the corresponding part of the competition (Qualifying Practice, Qualifying Heats, Second Chance +HDW¿QDOSKDVH3URWHVWVDJDLQVWWKLVSURFHGXUHDUHQRW admitted. Protests and Appeals in this regard do not have a suspensive effect. )RXUQLVVHXUH[FOXVLIGHSQHXV ([FOXVLYHW\UHVXSSOLHU /(&217HVWOHIRXUQLVVHXUH[FOXVLIGHSQHXV/HVSQHXV IRXUQLVVHURQWOHVVXLYDQWV /(&217LVWKHH[FOXVLYHVXSSOLHURIWKHW\UHV7KHW\UHV supplied will be as follows: /3)=3ULPH;DYDQWHW/3)=3ULPH ;DUULqUHSRXUOHVSQHXVVOLFNV:/+ ;DYDQWHW:/+;DUULqUHSRXUOHV pneus «pluie». Le prix proposé par LeCont est de 182 € le train de pneus slicks et de 184 € le train de pneus «pluie» (TTC). /3)=3ULPH;IURQWDQG/3)=3ULPH ;UHDUIRUVOLFNW\UHV:/+;IURQW DQG:/+;UHDUIRU©ZHWZHDWKHUªW\UHV &RRUGRQQpHVGH/H&RQW/H&RQW6UO03DROR%20%$5$ 9LD3LQHWD529(5(7271,7$/,( - Tél.: +39/0464 42 96 02 )D[ (PDLOH[SRUW#OHFRQWFRP $GGUHVVRI/H&RQW/H&RQW6UO0U3DROR%20%$5$ 9LD3LQHWD529(5(7271,7$/< 3KRQH )D[ - E mail: [email protected] 19) Gestion des deux châssis /HFKRL[GXFKkVVLVSDUPLOHVGHX[PDUTXpVDX[9pUL¿FDWLRQV7HFKQLTXHVSRXUOHV(VVDLVHW0DQFKHV4XDOL¿FDWLIV HW&RXUVHVGHODSKDVH¿QDOHHVWODLVVpjO¶DSSUpFDWLRQ du Pilote. Cependant, en cas de conditions climatiques changeantes, chacun des deux châssis devra être prêt à O¶HPSORLHWPRQWpGDQVGHX[FRQ¿JXUDWLRQVGLIIpUHQWHV l’une de type «sec», l’autre de type «pluie». Les deux châssis devront être introduits en Parc d’Assistance «Départ». Aucun délai supplémentaire ne sera alloué à un Pilote n’ayant pas respecté cette consigne. Seul le châssis sélectionné par le Pilote pourra être amené en Pré-grille ou HQJULOOHHWFHFKRL[VHUDGp¿QLWLI La substitution du châssis sélectionné ne sera autorisée TXHVXUGpFLVLRQGX'LUHFWHXUG¶eSUHXYHHQFDVGH©67$57 DELAYED». Tout Pilote ne disposant pas (ou plus) d’un kart de réserve devra retourner en Parc d’Assistance «Départ» SRXUHIIHFWXHUOHVLQWHUYHQWLRQVPpFDQLTXHVQpFHVVDLUHV et sera invité à s’élancer de la Pré-grille lorsque tous les autres karts auront quitté la Pré-grille ou la grille pour GpPDUUHUOHXUWRXUGHIRUPDWLRQHWUHVWHUDREOLJDWRLUHPHQW jO¶DUULqUHGHODIRUPDWLRQ 19) Management of the two chassis The choice of the chassis (from among the two chassis marked at Scrutineering) to be used for the Qualifying 3UDFWLFHDQG+HDWVDQGUDFHVRIWKH¿QDOSKDVHLVOHIWWR the discretion of the Driver. However, in case of changing weather conditions, each of the two chassis must be ready IRUXVHDQGVHWXSLQWZRGLIIHUHQWFRQ¿JXUDWLRQVRQHRI the “dry-weather” type, the other of the “wet-weather” type. The two chassis must be placed in the “Start” Servicing Park. No additional time will be allowed to a Driver who has not respected these instructions. Only the chassis selected by the driver may be taken to the Assembly Area RUWRWKHJULGDQGWKLVFKRLFHZLOOEH¿QDO The substitution of the selected chassis will be authorised RQO\E\GHFLVLRQRIWKH5DFH'LUHFWRULQWKH&RPSHWLWLRQ WKDW³67$57'(/$<('´LVDQQRXQFHG$Q\'ULYHUZKRGRHV not dispose (or no longer disposes) of a reserve kart shall return to the «Start» Servicing Park in order to carry out WKHQHFHVVDU\PHFKDQLFDOLQWHUYHQWLRQVKHZLOOEHLQYLWHG to leave the Assembly Area only once all the other karts have left the Assembly Area or the Grid to start their formation lap, and he will have to stay at the back of the formation. CARBURANT FUEL 5qJOHPHQWGHGLVWULEXWLRQ Le Conseil Mondial du Sport Automobile de la FIA a décidé GHGpVLJQHU3$17$DSUqVXQHSURFpGXUHG¶DSSHOG¶RIIUHV FRPPHIRXUQLVVHXUH[FOXVLIGXFDUEXUDQW.$57521 type) devant être utilisé par chaque Pilote. 20) Distribution regulations The FIA World Motor Sport Council has decided to designate PANTA, following a tender procedure, as the H[FOXVLYHVXSSOLHURIIXHO.$57521W\SHWREHXVHG by each Driver. /HFDUEXUDQWGHPDUTXH3DQWDVHUDIRXUQLSDU3DQWDDX prix de 4,27 € (TTC) le litre sur le lieu des Compétitions et sans commande préalable par les Concurrents. The fuel of the Panta make will be supplied by Panta at the SULFHRI¼DOOWD[HVLQFOXGHGSHUOLWUHDWWKHYHQXHRI the Competitions, without its being necessary for Competitors to order it previously. The appointed fuel Supplier’s lorry will arrive at the circuit Le camion du Fournisseur de carburant désigné arrivera sur 7KHSULFHSURSRVHGE\/H&RQWLV¼SHUVHWRIVOLFN W\UHVDQG¼SHUVHWRI©ZHWZHDWKHUªW\UHVLQFOWD[ CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP le circuit la veille des premiers Essais Libres (voir horaire). &HSURJUDPPHHVWVXMHWjPRGL¿FDWLRQV7RXWHPRGL¿FDWLRQ doit être publiée. WKHGD\EHIRUHWKH¿UVW)UHH3UDFWLFHVHHVFKHGXOH7KLV SURJUDPPHLVVXEMHFWWRPRGL¿FDWLRQV$Q\PRGL¿FDWLRQ shall be published. Le Pilote achète des Bons de 25 litres au Fournisseur de carburant. Les Pilotes doivent impérativement remettre un Bon du Fournisseur de carburant pour obtenir la quantité de carburant sollicitée. The Driver buys 25-litre Vouchers from the fuel Supplier. Drivers shall hand over a Voucher from the fuel Supplier in order to obtain the desired fuel quantity. L’huile destinée au mélange du carburant 2-temps est celle SXEOLpHVXUODOLVWHGHVOXEUL¿DQWVDJUppVSDUOD&,.),$ 7KHOXEULFDQWIRUWKHVWURNHIXHOPL[WXUHLVWKDWSXEOLVKHG in the list of lubricants approved by the CIK-FIA. L’essence sera livrée dans des tonnelets de 30 litres, remSOLVGHOLWUHVFHFLSHUPHWWDQWDX[&RQFXUUHQWVGHIDLUH leur mélange. Les tonnelets seront livrés capsulés. 7KHIXHOVKDOOEHVXSSOLHGLQOLWUHGUXPV¿OOHGZLWK 25OLWUHVWKLVHQDEOHV(QWUDQWVWRSUHSDUHWKHLUPL[WXUH Drums shall be delivered capped. Coordonnées de Panta : Panta Distribuzione S.P.A., MM. *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/,( - Tél.: +39/0373 235 141 )D[ (PDLOFULVWRIDQLOOLJLRYDQQL#SDQWDLWPRQLFROXFD# panta.it $GGUHVVRI3DQWD3DQWD'LVWULEX]LRQH63$0HVVUV *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/< 3KRQH )D[ (PDLOFULVWRIDQLOOLJLRYDQQL#SDQWDLWPRQLFROXFD# panta.it SÉCURITÉ GÉNÉRALE GENERAL SAFETY 21) Article 2.14 des Prescriptions Générales. 21) Article 2.14 of the General Prescriptions. DÉROULEMENT DU CHAMPIONNAT RUNNING OF THE CHAMPIONSHIP 22) Les Compétitions se composeront d’Essais Libres, G¶(VVDLV4XDOL¿FDWLIVGH0DQFKHV4XDOL¿FDWLYHVG¶XQH 0DQFKHGH5HSrFKDJHpYHQWXHOOHHWG¶XQHSKDVH¿QDOH 22) The Competitions will comprise Free Practice, Qualifying Practice, Qualifying Heats, possible Second Chance +HDWDQGD¿QDOSKDVH D(VVDLV/LEUHV$UWLFOH$GHV3UHVFULSWLRQV6SpFL¿TXHV D)UHH3UDFWLFH$UWLFOH$RIWKH6SHFL¿F3UHVFULSWLRQV E(VVDLV4XDOL¿FDWLIV$UWLFOH%GHV3UHVFULSWLRQV 6SpFL¿TXHV E4XDOLI\LQJ3UDFWLFH$UWLFOH%RIWKH6SHFL¿F3UHVcriptions. F0DQFKHV4XDOL¿FDWLYHV$UWLFOH&GHV3UHVFULSWLRQV 6SpFL¿TXHV F4XDOLI\LQJ+HDWV$UWLFOH&RIWKH6SHFL¿F3UHVFULStions. G0DQFKHGH5HSrFKDJH$UWLFOH'GHV3UHVFULSWLRQV 6SpFL¿TXHV G6HFRQG&KDQFH+HDW$UWLFOH'RIWKH6SHFL¿F3HVcriptions H3KDVH¿QDOH: $UWLFOH(GHV3UHVFULSWLRQV6SpFL¿TXHV e) Final phase : $UWLFOH(RIWKH6SHFL¿F3UHVFULSWLRQV GRILLES DE DÉPART STARTING GRIDS 23) Article 2.19 des Prescriptions Générales. 23) Article 2.19 of the General Prescriptions PROCÉDURE DE DÉPART STARTING PROCEDURE 24) Article 2.20 des Prescriptions Générales. 24) Article 2.20 of the General Prescriptions. 25) Type de départs : départs arrêtés pour karts à boîte de YLWHVVHVWHOVTXHGp¿QLVjO¶$UWLFOHGHV3UHVFULSWLRQV Générales. 25) Type of starts: standing starts for karts with gearER[HVDVGH¿QHGLQ$UWLFOHRIWKH*HQHUDO3UHVFULStions. /HV&RPPLVVDLUHV6SRUWLIVSRXUURQWXWLOLVHUWRXW système vidéo ou électronique susceptible de les aider à prendre une décision. Les décisions des Commissaires 26) The Stewards may use any video or electronic system likely to help them to take a decision. The Stewards’ decisions may supersede those taken by Judges of Fact. CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP 6SRUWLIVSRXUURQWSUpYDORLUVXUFHOOHVGHV-XJHVGH)DLW 7RXWHLQIUDFWLRQDX[GLVSRVLWLRQVGX&RGHRXGXSUpVHQW 5qJOHPHQW6SRUWLIUHODWLYHVjODSURFpGXUHGHGpSDUW pourra entraîner l’exclusion du Pilote concerné de laCompétition. Any infringement to the provisions of the Code or of these 6SRUWLQJ5HJXODWLRQVUHODWLQJWRWKHVWDUWLQJSURFHGXUH PD\HQWDLOWKHH[FOXVLRQRIWKH'ULYHUFRQFHUQHGIURPWKH Competition. SUSPENSION D’UNE COURSE SUSPENDING A RACE 27) Article 2.21 des Prescriptions Générales. 27) Article 2.21 of the General Prescriptions. REPRISE D’UNE COURSE RESUMING A RACE 28) Article 2.22 des Prescriptions Générales. 28) Article 2.22 of the General Prescriptions. ARRIVÉE FINISH 29) Article 2.23 des Prescriptions Générales. 29) Article 2.23 of the General Prescriptions. PARC FERMÉ PARC FERMÉ 30) Article 2.13 des Prescriptions Générales. 30) Article 2.13 of the General Prescriptions. INCIDENTS INCIDENTS 31) Article 2.24 des Prescriptions Générales. 31) Article 2.24 of the General Prescriptions. DROITS D’ENGAGEMENT ET FONDS DE PRIX ENTRY FEES AND PRIZE FUND 32) Chaque ASN ayant inscrit un ou plusieurs Pilotes devra verser à la CIK-FIA 252 Euros par Championnat pour alimenter le Fonds de Prix commun récompensant les Championnats. 32) Each ASN having entered one or several Drivers must pay to the CIK-FIA 252 Euros per Championship to contribute to the common Prize Fund, which rewards the Championships. 33) Le droit d’engagement et l’inscription devront être payés et envoyés par le Concurrent. La CIK-FIA devra être en possession des inscriptions au plus tard à la date de FO{WXUH¿[pHDXPDUV/HGURLWG¶LQVFULSWLRQSDU3LORWH pour le Championnat est de 1’560 Euros pour toute insFULSWLRQHQYR\pHDYDQWOHPDUVPLQXLWKHXUHVXLVVH pour les inscriptions soumises entre le 12 mars et le 18 mars, le droit d’inscription sera porté à 2’080 Euros (dont 100 Euros seront versés à chaque Organisateur). 33) Entry fees and entries must be paid and sent by the Entrant. The CIK-FIA must have received entries at the latest on the closing date of entries, set at 18 March. The entry fee per Driver for the Championship is 1,560 Euros for entry applications sent prior to 11 March at midnight 6ZLVVWLPHIRUDSSOLFDWLRQVVXEPLWWHGEHWZHHQ0DUFK and 18 March, the entry fee will be increased to 2,080 Euros (100 Euros of which will be paid to each Organiser). TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY RÈGLEMENT SPORTIF SPORTING REGULATIONS La CIK-FIA organise le Trophée Académie de Karting de la CIK-FIA («le Trophée») qui est la propriété de la CIK-FIA. Le Trophée couronnera le Pilote Vainqueur du Trophée Académie de Karting de la CIK-FIA. Toutes les parties concernées (FIA, CIK-FIA, ASN, Organisateurs, Promoteur, Concurrents et circuits) s’engagent à appliquer ainsi qu’à observer les règles régissant les Compétitions. The CIK-FIA organises the CIK-FIA Karting Academy Trophy («the Trophy») which is the property of the CIKFIA. The Trophy will reward the Driver Winner of the CIKFIA Karting Academy Trophy. All the parties concerned (FIA, CIK-FIA, ASNs, Organisers, Promoter, Entrants and circuits) undertake to apply and observe the rules governing the Competitions. RÈGLEMENT REGULATIONS /HWH[WH¿QDOGXSUpVHQW5qJOHPHQW6SRUWLIVHUDOD YHUVLRQIUDQoDLVHjODTXHOOHLOVHUDIDLWUpIpUHQFHHQFDV de controverse d’interprétation. Dans ce document, les LQWLWXOpVVRQWpQRQFpVDX[VHXOHV¿QVGHFRPPRGLWpHWQH IRQWSDVSDUWLHGXSUpVHQW5qJOHPHQW6SRUWLI 7KH¿QDOWH[WRIWKHVH6SRUWLQJ5HJXODWLRQVVKDOOEHWKH French version which will be used should any dispute arise as to their interpretation. Headings in this document are for ease of reference only and do not form part of these 6SRUWLQJ5HJXODWLRQV OBLIGATIONS GÉNÉRALES GENERAL UNDERTAKINGS 7RXVOHV3LORWHV&RQFXUUHQWVHW2I¿FLHOVSDUWLFLSDQWDX Championnat s’engagent en leur nom propre et celui de leurs employés et agents, à observer toutes les dispoVLWLRQVGX&RGH6SRUWLI,QWHUQDWLRQDO©OH&RGHªGX &RGHGH&RQGXLWHVXU&LUFXLWVGH.DUWLQJOH5qJOHPHQW 7HFKQLTXHGH.DUWLQJ©OH5qJOHPHQW7HFKQLTXHªOHV Prescriptions Générales applicables aux Compétitions internationales et Championnats, Coupes et Trophées CIK-FIA de Karting (« les Prescriptions Générales »), les 3UHVFULSWLRQV6SpFL¿TXHVDSSOLFDEOHVDX[&KDPSLRQnats, Coupes et Trophées de la CIK-FIA de Karting (« les 3UHVFULSWLRQV6SpFL¿TXHVªOH5qJOHPHQW3DUWLFXOLHUGHOD &RPSpWLWLRQHWOHSUpVHQW5qJOHPHQW6SRUWLI $OO'ULYHUV(QWUDQWVDQG2I¿FLDOVSDUWLFLSDWLQJLQWKH Championship undertake, on behalf of themselves, their employees and agents, to observe all the provisions of the International Sporting Code (« the Code »), the Code of Driving Conduct on Karting Circuits, the Karting Technical 5HJXODWLRQV© WKH7HFKQLFDO5HJXODWLRQV ») the General Prescriptions applicable to the CIK-FIA Karting international Competitions and Championships, Cups and Trophies (« the General Prescriptions ªWKH6SHFL¿F3UHVFULSWLRQV applicable to the CIK-FIA Karting Championships, Cups and Trophies (« WKH6SHFL¿F3UHVFULSWLRQV »), the SupplePHQWDU\5HJXODWLRQVRIWKH&RPSHWLWLRQFRQFHUQHGDQG WKHVH6SRUWLQJ5HJXODWLRQV 3) Seule la CIK-FIA est habilitée à accorder des dérogaWLRQVDXSUpVHQW5qJOHPHQW6SRUWLI 3) Only the CIK-FIA is entitled to grant waivers to these 6SRUWLQJ5HJXODWLRQV LE TROPHÉE :PRINCIPE ET DÉROULEMENT THE TROPHY: PRINCIPLE AND RUNNING 4) Le Trophée se déroule sur trois Compétitions. 4) The Trophy is run over three Competitions. 5) Les Compétitions comptant pour le Trophée («les Compétitions «) auront le statut de compétitions internationales réservées. 5) The Competitions counting towards the Trophy («the Competitions») will have the status of restricted international Competitions. &KDTXH&RPSpWLWLRQFRPSRUWHUDXQHSKDVH¿QDOH nommées «Pré-Finale» et «Finale» selon le nombre de participants à la Compétition. Les distances de la PréFinale et de la Finale, à partir du signal de départ jusqu’au drapeau à damier, seront égales au nombre minimum de tours complets nécessaires pour dépasser respectivement les distances de 15 km et 25 km. Le drapeau à damier VHUDSUpVHQWpDXNDUWGHWrWHORUVTX¶LOIUDQFKLWODOLJQH G¶DUULYpH©OD/LJQHªjOD¿QGXWRXUSHQGDQWOHTXHOFHWWH distance est atteinte. La Ligne consiste en une ligne unique traversant la piste. (DFK&RPSHWLWLRQZLOOFRPSULVHD¿QDOSKDVHQDPHG «Pre-Final» and «Final» in accordance with the number of participants in the Competition. The distance of the PreFinal and Final, from the starting signal to the chequered ÀDJZLOOEHHTXDOWRWKHPLQLPXPQXPEHURIIXOOODSV necessary for reaching the respective distances of 15 NPDQGNP7KHFKHTXHUHGÀDJZLOOEHVKRZQWRWKH OHDGLQJNDUWZKHQLWFURVVHVWKH¿QLVKLQJOLQH©WKH/LQHª at the end of the lap during which that distance is reached. 7KH/LQHFRQVLVWVLQDVLQJOHOLQHDFURVVWKHWUDFN TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY CLASSEMENTS CLASSIFICATIONS 7) Le classement du Championnat sera établi comme suit : chaque Pilote pourra totaliser 80% des résultats, arrondis DXFKLIIUHOHSOXVSURFKHVRLW 7KHFODVVL¿FDWLRQRIWKH&KDPSLRQVKLSZLOOEHHVWDblished as follows : 80% of the results rounded up or down WRWKHQHDUHVW¿JXUHZLOOFRXQWLH - si le nombre de Compétitions est compris entre 3 et 7, le plus mauvais résultat obtenu dans les classements interPpGLDLUHVpWDEOLVjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV ainsi que le plus mauvais résultat obtenu lors des Finales seront décomptés. - if the number of Competitions is between 3 and 7, the ZRUVWUHVXOWREWDLQHGLQWKHLQWHUPHGLDWHFODVVL¿FDWLRQV (established after the Qualifying Heats) and the worst result obtained in the Finals will be discounted. 8QUpVXOWDWQXOFRQVpFXWLIjXQHH[FOXVLRQQHSRXUUDSDV être décompté. $EODQNUHVXOWGXHWRDQH[FOXVLRQPD\QRWEHGLVFRXQWHG 8) Le titre de Pilote Vainqueur du Trophée Académie de Karting de la CIK-FIA sera attribué au Pilote qui aura obtenu le plus grand nombre de points. 8) The title of Driver Winner of the CIK-FIA Karting Academy Trophy will be awarded to the Driver who has obtained the largest number of points. 9a) À chaque Compétition, le classement intermédiaire pWDEOLjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVGRQQHUDOLHXj une attribution de points aux 10 premiers Pilotes classés, selon le barème suivant : 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9a) $WHDFK&RPSHWLWLRQIRUWKHLQWHUPHGLDWHFODVVL¿FDtion (established after the Qualifying Heats), points will be DZDUGHGWRWKHWRSFODVVL¿HG'ULYHUVDFFRUGLQJWRWKH following scale: 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. 9b) À chaque Compétition, le classement de la Finale donnera lieu à une attribution de points aux 15 premiers Pilotes classés, selon le barème suivant : 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. E$WHDFK&RPSHWLWLRQIRUWKHFODVVL¿FDWLRQRIWKH)LQDO SRLQWVZLOOEHDZDUGHGWRWKHWRSFODVVL¿HG'ULYHUV according to the following scale: 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. CANDIDATURES DES CONCURRENTS ENTRANTS’ APPLICATIONS 10) Les candidats devront être titulaires de Licences Internationales de Concurrents en cours de validité et des autorisations (visas) nécessaires délivrées par leur ASN DI¿OLpHjOD),$ 10) Applicants must hold valid Entrants’ International /LFHQFHVDQGWKHQHFHVVDU\DXWKRULVDWLRQVYLVDVLVVXHG E\WKHLU$61VDI¿OLDWHGWRWKH),$ 11) Le Concurrent sera obligatoirement le père, la mère ou le tuteur légal du Pilote. 11) The Entrant must be the father, the mother or the legal guardian of the Driver. 12) Les candidatures de participation au Trophée devront être soumises à la CIK-FIA au plus tard le 31 mars au PR\HQGXIRUPXODLUHG¶HQJDJHPHQWGLVSRQLEOHDXSUqVGHV ASN et doivent être accompagnées des copies des licences et des droits d’engagement à l’ordre de la FIA. Les candidats acceptés sont automatiquement admis à toutes les Compétitions des Trophées et seront les seuls Concurrents SDUWLFLSDQWjFHV&RPSpWLWLRQV/HVFDQGLGDWVUHIXVpV seront avisés avant le 14 avril. Aucun changement de Concurrent ne sera autorisé après O¶RI¿FLDOLVDWLRQGHODOLVWHGHVHQJDJpV 12) Applications to participate in the Trophy shall be submitted to the CIK-FIA by 31 March by means of the entry form available from the ASNs and must be accompanied by the copies of the licences and by entry fees to the order of the FIA. Successful applicants are automatically admitted to all the Trophy Competitions and will be the only Entrants at these Competitions. Unsuccessful applicants ZLOOEHQRWL¿HGEHIRUH$SULO 13) Toutes les candidatures seront étudiées par la CIK-FIA, qui publiera la liste des karts et des Pilotes acceptés, avec leurs numéros de compétition, au plus tard 15 jours après la date de clôture des engagements. 13) All applications will be studied by the CIK-FIA, which will publish the list of karts and Drivers accepted, with their racing numbers, at the latest 15 days after the closing date for entries. 14) Les candidatures devront comprendre: 14) Applications shall include: DXQHFRQ¿UPDWLRQTXHOHFDQGLGDWHQVRQQRPHWFHOXL de toute personne concernée par sa participation à la Compétition, a lu et compris le Code, les Prescriptions *pQpUDOHVOHV3UHVFULSWLRQV6SpFL¿TXHVOHV$QQH[HVOH DFRQ¿UPDWLRQWKDWWKHDSSOLFDQWKDVUHDGDQGXQGHUVWRRG WKH&RGHWKH*HQHUDO3UHVFULSWLRQVWKH6SHFL¿F5HJXODWLRQVWKH$SSHQGLFHVWKH7HFKQLFDO5HJXODWLRQVDQGWKH 6SRUWLQJ5HJXODWLRQVDQGDJUHHVRQKLVRZQEHKDOIDQGRQ No change of Entrant shall be allowed after the entry list KDVEHHQPDGHRI¿FLDO TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY 5qJOHPHQW7HFKQLTXHHWOH5qJOHPHQW6SRUWLIHWV¶HQJDJH à les observer; behalf of everyone associated with his participation in the Competition, to respect them; b) les noms, coordonnées et détails du Pilote, ainsi qu’une photo passeport et la copie de sa licence; b) the names, contact details, data and a passport photo of the Driver, as well as a copy of his licence; c) l’engagement du candidat à participer à toutes les Compétitions; c) an undertaking by the applicant to participate in every Competition; d) un chèque de 600 euros de caution garantissant la participation du candidat à toutes les Compétitions des Trophées et la restitution du matériel utilisé, en bon état, DXIRXUQLVVHXUXQLTXHGHNDUWV d) a deposit cheque of 600 euros guaranteeing that the candidate participates in all the Trophy Competitions and returns the equipment used, in good condition, to the single-supplier of karts; 15) Le nombre des engagés au Trophée sera limité à 51. 15) The number of entries in the Trophy will be limited to 51. PILOTES ADMIS ELIGIBLE DRIVERS 16) Les Pilotes âgés de 13 ans minimum (ou atteignant leurs 13 ans dans le courant de l’année) à 15 ans maximum (n’atteignant pas leurs 16 ans avant le 31 décembre de l’année). 16) Drivers who are at least 13 years old (or who reach their 13th birthday during the year) and 15 years old as DPD[LPXPQRWUHDFKLQJWKHLUWKELUWKGD\EHIRUH December of the year concerned). Un Pilote classé parmi les 15 premiers d’un précédent Championnat CIK-FIA de la catégorie Junior ne sera pas admis. $'ULYHUZKRKDVEHHQFODVVL¿HGDPRQJWKHWRSLQD previous CIK-FIA Championship of the Junior category will not be accepted. 17) Les Pilotes devront être sélectionnés par leurs ASN respectives, à raison d’un Pilote par ASN. Un engagement VHUDUpVHUYpjXQH3LORWHIHPPHVpOHFWLRQQpHSDUOD&RPmission Femmes dans le Sport Automobile de la FIA. L’acceptation des 50 autres candidatures sera établie par ordre de priorité sur la base des critères suivants: 17) Drivers shall be selected by their respective ASNs - one Driver per ASN. One entry will be reserved for a lady Driver selected by the FIA Women in Motorsport Commission. The acceptance of the other 50 candidatures will be established by priority order on the basis of the following criteria: a) les ASN ayant inscrit le plus de Compétitions aux calenGULHUVVSRUWLILQWHUQDWLRQDOHWRXGH]RQHDXFRXUVGHOD saison précédente ; a) ASNs having entered the most Competitions on the international sporting calendar and/or zone calendar during the previous season; b) les ASN non organisatrices de Compétitions internatioQDOHVRXGH]RQHD\DQWpWpOHVSOXVUHSUpVHQWpHVSDUOHXUV licenciés Pilotes dans les Championnats de la CIK-FIA de la saison précédente ; b) ASNs which do not organise international or zone Competitions but have had the largest representation of their licence-holding Drivers in CIK-FIA Championships of the previous season; c) autres ASN ne remplissant ni le critère «a», ni le critère «bªFLGHVVXVPDLVD\DQWIDLWFRQQDvWUHjOD&,.),$OHXU intention de sélectionner un Pilote pour le Trophée; c) other ASNs meeting neither criterion «a», nor criterion «b» above but which have informed the CIK-FIA of their intention to select a Driver for the Trophy; d) dans le cas où le nombre total des ASN sélectionnant un 3LORWHVHUDLWLQIpULHXUjOHV$61UpSRQGDQWDXFULWqUH «a» ci-dessus seraient invitées à sélectionner un deuxième Pilote. d) should the total number of ASNs selecting a Driver be less than 50, ASNs meeting criterion «a» above would be invited to select a second Driver. Le mode de sélection des Pilotes par les ASN relève de la seule compétence de ces dernières. Les ASN sont tenues de communiquer le nom de leur Pilote sélectionné à la CIK-FIA avant le 31 mars. The mode of selection of Drivers by ASNs comes within the sole remit of the latter. ASNs have to communicate the name of their selected Driver to the CIK-FIA before 31 March. 18) Les Pilotes titulaires d’une Licence CIK-FIA Internationale de Karting de Degré C-Junior (délivrée par leur $61DI¿OLpHjOD),$HQFRQIRUPLWpDYHFO¶$UWLFOHGHV 18) Drivers holding a CIK-FIA Grade C-Junior International .DUWLQJ/LFHQFHLVVXHGE\WKHLU$61DI¿OLDWHGWRWKH),$ in compliance with Article 3.4.2 of of the International TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY Licences Internationales de Karting pour Pilotes & du Code de Conduite. .DUWLQJ/LFHQFHVIRU'ULYHUV'ULYLQJ&RQGXFW KARTS ET MATÉRIEL ADMIS ELIGIBLE KARTS AND EQUIPMENT 19) Chaque Compétition est réservée aux karts de KF3, WHOVTXHGp¿QLVSDUOH5qJOHPHQW7HFKQLTXHDYHFOHVVSpFL¿FLWpVVXLYDQWHVSRXUOHPRWHXU - carburateur sans connexions électroniques, à cuve, GHYDQWUHVWHUVWULFWHPHQWG¶RULJLQHIRXUQLSORPEpHWSUp UpJOpSDUOHIRXUQLVVHXUXQLTXHGHPRWHXUV (DFK&RPSHWLWLRQLVUHVHUYHGIRU.)NDUWVDVGH¿QHG E\WKH7HFKQLFDO5HJXODWLRQVZLWKWKHIROORZLQJVSHFL¿F characteristics for the engine: ÀRDWFKDPEHUFDUEXUHWWRUZLWKRXWHOHFWURQLFFRQQHFWLRQV which must remain strictly original, supplied sealed and pre-set by the single-supplier of engines. 8QIRXUQLVVHXUXQLTXHGHNDUWVFKRLVLDSUqVXQHSURFpGXUH G¶DSSHOG¶RIIUHVDpWpGpVLJQpSRXUIRXUQLUWRXVOHVNDUWV GX7URSKpHVXUOHSULQFLSHG¶XQHORFDWLRQ©FOHIVHQPDLQV© pour toute la durée du Trophée. A single-supplier of karts, chosen further to a tender procedure, has been designated for the supply of all the karts used in the Trophy, according to a «turnkey» principle to be applied throughout the Trophy. L’ensemble du kart comprenant tous les éléments livrés SDUOH)RXUQLVVHXUXQLTXHQHSHXWVXELUDXFXQHPRGL¿FDtion (à l’exception du troisième roulement d’arbre arrière, qui peut être libéré ou totalement démonté) et doit être XWLOLVpWHOTXHIRXUQL/HVpOpPHQWVGXFKkVVLVSHXYHQWrWUH ajustés en utilisant uniquement les réglages mécaniques de base. Le rapport de transmission (couronne arrière) doit être celui indiqué par le Fournisseur des karts, avec une tolérance de + ou -1 dent. The kart unit comprising all the elements delivered by WKHVLQJOH6XSSOLHUFDQQRWXQGHUJRDQ\PRGL¿FDWLRQV ZKDWVRHYHUH[FHSWIRUWKHWKLUGUHDUD[OHEHDULQJZKLFK can be freed or totally dismounted) and must be used as supplied. The chassis elements can be set up only by using the basic mechanical settings. The transmission ratio (rear crown) must be the one indicated by the kart Supplier, with a tolerance of + or -1 cog. &KDTXH3LORWHDXUDOHGURLWGHSUpVHQWHUDX[9pUL¿FDtions Techniques le matériel suivant : Nombre de châssis: 1 (celui qui lui aura été attribué par tirage au sort pour le Trophée). Nombre de moteurs: 1 (celui qui lui aura été attribué par tirage au sort pour la Compétition). Trains de pneus « slick » : *, de la marque prescrite pour le Championnat 20) Each Driver will be entitled to submit to Scrutineering the following equipment: Number of chassis: 1 (the one allocated to him by drawing lots for the Trophy). Les karts devront être présentés complets (châssis, carrosseries et accessoires montés) avec le moteur. 7KHNDUWPXVWEHSUHVHQWHGLQIXOOFRQ¿JXUDWLRQDVVHPEOHGFKDVVLVERG\ZRUNH[WUDFRPSRQHQWVZLWKWKH engine. A partir des Essais Libres, chaque Pilote pourra disposer du matériel suivant : Nombre de châssis : 1 (celui marqué aux 9pUL¿FDWLRQV7HFKQLTXHV Nombre de moteurs : 1 (celui marqué aux 9pUL¿FDWLRQV7HFKQLTXHV Trains de pneus « slicks » : * (nombre maximum de pneus) As from the Free Practice, each Driver may have the following equipment: Number of chassis : 1 (the one marked at Scrutineering) Number of engines : 1 (the one marked at Scrutineering) 6HWVRI©VOLFNªW\UHV PD[LPXPQXPEHU of tyres) Trains de pneus « pluie » : 2 trains de pneus « pluie » QHXIVSRXUOHV(VVDLV4XDOL¿FDWLIVOHV0DQFKHV4XDOL¿FDWLYHVOD0DQFKHGHUHSrFKDJHHWODSKDVH¿QDOH Le nombre de pneus « pluie » réservés aux Essais Libres et aux Warm-Ups n’est pas limité. Sets of « wet weather » tyres : 2 sets of new «wet weather» tyres for Qualifying Practice, Qualifying Heats, 6HFRQG&KDQFH+HDWDQG¿QDOSKDVH The number of «wet weather» tyres reserved for Free Practice and Warm-Ups is not limited 120%5(0$;,080'(31(866/,&.6 a) Pouvant être utilisés lors des Essais Libres et des WarmUps : WUDLQGHSQHXV©VOLFNVªQHXIVWUDLQGHSQHXV «slicks» usés de la Compétition précédente , excepté lors 0$;,080180%(52)6/,&.7<5(6 D5HVHUYHGIRUXVHLQ)UHH3UDFWLFHDQG:DUPXSV Number of engines: Sets of « slick » tyres : 1 (the one allocated to him by drawing lots for the Competition). *, of the prescribed make for the Championship - 1 set of new «slick» tyres + 1 set of previously allocated ©VOLFNªW\UHVIURPWKHSUHYLRXV&RPSHWLWLRQH[FHSWIRUWKH TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY de la la première Compétition (le train de pneus «slicks» de la Journée de Test); ¿UVW&RPSHWLWLRQWKHVHWRI©VOLFNªW\UHVIURPWKH7HVW Day) E3RXYDQWrWUHXWLOLVpVGHSXLVOHV(VVDLV4XDOL¿FDWLIV jusqu’à la Finale : WUDLQGHSQHXV©VOLFNVªQHXIV E5HVHUYHGIRUXVHIURP4XDOLI\LQJ3UDFWLFHXQWLOWKH Final: - 1 set of new «slick» tyres c) Distribution : /RUVGHFKDTXH&RPSpWLWLRQHWFRQIRUPpPHQWDXSURJUDPPHXQERQGRLWrWUHDFKHWpDXSUqVGX0DQXIDFWXULHU GHSQHXV'LVWULEXWHXU/DGLVWULEXWLRQGHVSQHXV©VOLFNVª VHIHUDGDQVOH3DUFG¶$VVLVWDQFHHWDXUDOLHXSDUWLUDJHDX sort. Les codes-barres correspondant aux pneus attribués à chaque Pilote seront reproduits sur le Passeport Technique du Pilote concerné. c) Distribution: At the respective Competition and according to the timetable, a voucher must be acquired from the tyre Manufacturer/Distributor.Tyres will be distributed and allocated by random draw in the Servicing Park. The bar codes corresponding to each Driver will be reproduced on the Technical Passport of the Driver concerned. d) Dépôt : Les pneus seront stockés sous la responsabilité du ConcurUHQW3LORWH d) Stocking: Tyres will be stocked under the responsability of the Entrant/Driver. Après l’attribution des pneus par tirage au sort, le numéro du Pilote sera marqué sur les pneus par le personnel du Parc d’Assistance. Les Pilotes seront libres de décider de monter leurs pneus pluie sur jantes. Tout pneu «pluie» DWWULEXpOHVHUDFRQWUHXQERQGX0DQXIDFWXULHUGHSQHXV 'LVWULEXWHXU,OVHUDGpEDOOpVLHPEDOODJHLO\DPDUTXp du numéro du Pilote et monté sur jante. Tout pneu pluie PRQWpRXGpEDOOpQHVHUDSDVUHSULVSDUOH0DQXIDFWXULHU GHSQHXV'LVWULEXWHXUPrPHV¶LOQ¶DSDVpWpXWLOLVp/HV pneus pluie non montés et non déballés seront repris au WHUPHGHOD&RPSpWLWLRQSDUOHV0DQXIDFWXULHUV'LVWULEXteurs, en présence du Délégué Technique de la CIK-FIA. After the tyres have been allocated by random draw, the Driver’s number will be marked on them by the Servicing 3DUNVWDII'ULYHUVDUHIUHHWRGHFLGHWR¿WWKHLUZHWZHDther tyres on rims. Any «wet-weather» tyre will be allocaWHGLQH[FKDQJHIRUD9RXFKHUIURPWKHW\UH0DQXIDFWXUHU Dealer. It will be unwrapped (if it was wrapped), marked ZLWKWKH'ULYHU¶VQXPEHUDQG¿WWHGRQDULP)LWWHGRU unwrapped wet-weather tyres will not be taken back by the tyre Manufacturer/Dealer, even if they have not been XVHG:UDSSHGDQGQRQ¿WWHGZHWZHDWKHUW\UHVZLOO be taken back at the end of the Competition by the tyre Manufacturers/Dealers, in the presence of the CIK-FIA Technical Delegate. e) Changement : En cas de crevaison d’un pneu «slick» pendant les Essais 4XDOL¿FDWLIV0DQFKHV4XDOL¿FDWLYHV5HSrFKDJHpYHQWXHO 3Up)LQDOHHW)LQDOHXQ3LORWHSRXUUDXWLOLVHUHWIDLUHHQUHgistrer, sous le contrôle du Délégué Technique, un pneu de secours (un des pneus «slicks» utilisés lors des Essais Libres). e) Change: In case a «slick» tyre is punctured during Qualifying Practice, Qualifying Heats, possible Second Chance Heat, Pre-Final and Final, a Driver will be allowed to use a spare tyre (one of the «slick» tyres used during Free Practice) and have it registered under the supervision of the Technical Delegate. 7RXWFKkVVLVHQGRPPDJpORUVG¶XQIDLWGHFRXUVH constaté par la Direction de Course ou par le Collège des &RPPLVVDLUHV6SRUWLIVSRXUUDrWUHVLJQDOpDX'pOpJXp 7HFKQLTXHOHTXHOVHUDOHVHXO2I¿FLHOKDELOLWpjDXWRULser ou non le remplacement du châssis accidenté par un FKkVVLVQRQHQUHJLVWUpORUVGHV9pUL¿FDWLRQV7HFKQLTXHV et prélevé parmi les châssis de la marque correspondante initialement marqués par la CIK-FIA. 21) Any chassis damaged in a racing incident ascertained E\5DFH'LUHFWLRQRUE\WKH3DQHORIWKH6WHZDUGVPD\EH pointed out to the Technical Delegate, who will be the only 2I¿FLDOHQWLWOHGWRDOORZRUUHIXVHWKHUHSODFHPHQWRIWKH damaged chassis by a chassis that was not registered at Scrutineering and that will be taken from among chassis of the make concerned initially marked by the CIK-FIA. 6XUGpFLVLRQGHV&RPPLVVDLUHV6SRUWLIVOHV&RPPLVsaires Techniques pourront à tout moment de la Compétition inter-changer le matériel d’un Concurrent (châssis, moteur, carburateur, allumage, silencieux d’aspiration, arbre, accessoires) avec le matériel d’un autre Concurrent ou avec du matériel de substitution équivalent tiré au sort dans le stock du Fournisseur concerné. 22) On decision of the Stewards, the Scrutineers will be authorised at any time of the Competition to interchange Entrants’ equipment (chassis, engine, carburettor, ignition, LQOHWVLOHQFHUD[OHDFFHVVRULHVZLWKDQRWKHU(QWUDQW¶V equipment or with equivalent substitution equipment taken, by drawing lots, from the stock of the Supplier concerned. /¶DSSDUHLOGHPHVXUH0LQL5$(/LWHGHODVRFLpWp©5$( 6\VWHPV,QF86$ªVHUDXWLOLVpHQ(VVDLV4XDOL¿FDWLIV 0DQFKHV4XDOL¿FDWLYHV5HSrFKDJHHW3KDVH)LQDOHSRXU 7KHPHDVXULQJGHYLFH0LQL5$(/LWHRIWKHFRPSDQ\ ©5$(6\VWHPV,QF86$ªZLOOEHXVHGLQ4XDOLI\LQJ Practice, Qualifying Heats, Second Chance Heat and Final TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY YpUL¿HUTXHOHVSQHXVVRQWHQFRQIRUPLWpDYHFOHUqJOHment. La mesure COV des pneus ne devra pas dépasser 15 ppm (valeur limite maximale) en toutes circonstances. Note : La pollution des pneus, par ex. par spray pour FKDvQHGRLWrWUHpYLWpHFDUHOOHSHXWHQWUDvQHUOHGpSDVVHment de la valeur limite. Phase to check that the tyres are in conformity with the regulations. 7KH92&PHDVXUHPHQWRIWKHW\UHVPD\QRWH[FHHG SSPPD[LPXPOLPLWLQJYDOXHXQGHUDQ\FLUFXPVWDQFHV Note: Pollution of the tyres, e.g. by chain spray, must be avoided since this can result in the limiting value being H[FHHGHG Si le contrôle permet d’établir qu’un ou plusieurs pneus QHVRQWSDVHQFRQIRUPLWpDYHFOHUqJOHPHQWOH3LORWH concerné ne sera pas autorisé à accéder à la Pré-grille (et par conséquent ne participera pas à la partie corresponGDQWHGHODFRPSpWLWLRQ(VVDLV4XDOL¿FDWLIV0DQFKHV 4XDOL¿FDWLYHV5HSrFKDJH3Up)LQDOHHW)LQDOH/HV réclamations à l’encontre de cette procédure ne sont pas admises. Les réclamations et appels en la matière n’ont SDVG¶HIIHWVXVSHQVLI Should the check establish that one or more tyres are not in conformity with the regulations, the relevant Driver will not be allowed access to the Assembly Area: consequently no participation in the corresponding part of the competition (Qualifying Practice, Qualifying Heats, Second Chance Heat, Pre-Final and Final). Protests against this procedure are not admitted. Protests and Appeals in this regard do not have a suspensive effect. )RXUQLVVHXUH[FOXVLIGHSQHXV ([FOXVLYHW\UHVXSSOLHU %5,'*(6721(HVWOHIRXUQLVVHXUH[FOXVLIGHSQHXV/HV SQHXVIRXUQLVVHURQWOHVVXLYDQWV %5,'*(6721(LVWKHH[FOXVLYHVXSSOLHURIWKHW\UHV7KH tyres supplied will be as follows: <0+'5)=2SWLRQ;DYDQWHW<0+'5)= 2SWLRQ;DUULqUHSRXUOHVSQHXVVOLFNV</3:(5 ;DYDQWHW</3:(5;DUULqUHSRXU les pneus «pluie». <0+'5)=2SWLRQ;IURQWDQG<0+'5 )=2SWLRQ;UHDUIRUVOLFNW\UHV</3:(5 ;IURQWDQG</3:(5;UHDUIRU©ZHW weather» tyres. Le prix proposé par Bridgestone est de 165 € le train de pneus slicks et de 185 € le train de pneus «pluie» (TTC). The price proposed by Bridgestone is 165 € per set of slick W\UHVDQG¼SHUVHWRI©ZHWZHDWKHUªW\UHVLQFOWD[ Coordonnées de Bridgestone : %ULGJHVWRQH0RWRUVSRUW+ROODQG2I¿FH Mme Annemiek Bonnenkamp Bulkstraat 70, 4158 EC DEIL, Pays-Bas 7pOpSKRQH PRELOH - E-mail: [email protected] Address of Bridgestone: %ULGJHVWRQH0RWRUVSRUW+ROODQG2I¿FH Mrs Annemiek Bonnenkamp %XONVWUDDW(&'(,/WKH1HWKHUODQGV - Phone: +31/345 650 115 +31/653 264 353 (mobile) - E-mail: [email protected] CARBURANT FUEL 5qJOHPHQWGHGLVWULEXWLRQ Le Conseil Mondial du Sport Automobile de la FIA a décidé GHGpVLJQHU3$17$DSUqVXQHSURFpGXUHG¶DSSHOG¶RIIUHV FRPPHIRXUQLVVHXUH[FOXVLIGXFDUEXUDQW.$57521 type) devant être utilisé par chaque Pilote. 25) Distribution regulations The FIA World Motor Sport Council has decided to designate PANTA, following a tender procedure, as the H[FOXVLYHVXSSOLHURIIXHO.$57521W\SHWREHXVHG by each Driver. /HFDUEXUDQWGHPDUTXH3DQWDVHUDIRXUQLSDU3DQWDDX prix de 4,27 € (TTC) le litre sur le lieu des Compétitions et sans commande préalable par les Concurrents. The fuel of the Panta make will be supplied by Panta at the SULFHRI¼DOOWD[HVLQFOXGHGSHUOLWUHDWWKHYHQXHRI the Competitions, without its being necessary for Competitors to order it previously. The appointed fuel Supplier’s lorry will arrive at the circuit WKHGD\EHIRUHWKH¿UVW)UHH3UDFWLFHVHHVFKHGXOH7KLV SURJUDPPHLVVXEMHFWWRPRGL¿FDWLRQV$Q\PRGL¿FDWLRQ shall be published. Le camion du Fournisseur de carburant désigné arrivera sur le circuit la veille des premiers Essais Libres (voir horaire). &HSURJUDPPHHVWVXMHWjPRGL¿FDWLRQV7RXWHPRGL¿FDWLRQ doit être publiée. Le Pilote achète des Bons de 25 litres au Fournisseur de carburant. Les Pilotes doivent impérativement remettre un Bon du Fournisseur de carburant pour obtenir la quantité de carburant sollicitée. 7KH'ULYHUEX\VOLWUH9RXFKHUVIURPWKHIXHO6XSSOLHU 'ULYHUVVKDOOKDQGRYHUD9RXFKHUIURPWKHIXHO6XSSOLHULQ order to obtain the desired fuel quantity. L’huile destinée au mélange du carburant 2-temps sera 7KHOXEULFDQWIRUWKHVWURNHIXHOPL[WXUHZLOOEHGHWHUPL- TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY GpWHUPLQpSDUOHIRXUQLVVHXUXQLTXHGHPRWHXUVHWDJUpp par la CIK-FIA. ned by the single-supplier of engines and agreed by the CIK-FIA. L’essence sera livrée dans des tonnelets de 30 litres, remplis de 25 litres. Les tonnelets seront livrés capsulés. 7KHIXHOVKDOOEHVXSSOLHGLQOLWUHGUXPV¿OOHGZLWK litres. Drums shall be delivered capped. &RRUGRQQpHVGH3DQWD3DQWD'LVWULEX]LRQH63$00 *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/,( 7pO )D[ (PDLOFULVWRIDQLOOLJLRYDQQL#SDQWDLWPRQLFROXFD# panta.it Address of Panta : Panta Distribuzione S.P.A., Messrs *LRYDQQL&5,672)$1,//,/XFD021,&266.P %$*12/2&5(0$6&2&5,7$/< - Phone: +39/0373 235 141 )D[ - E mail: [email protected]; monico.luca@ panta.it SÉCURITÉ GÉNÉRALE GENERAL SAFETY 26) Article 2.14 des Prescriptions Générales. 26) Article 2.14 of the General Prescriptions. DÉROULEMENT DE LA COMPÉTITION RUNNING OF THE COMPETITION 27) Chaque Compétition se composera d’Essais Libres, G¶(VVDLV4XDOL¿FDWLIVGH0DQFKHV4XDOL¿FDWLYHVG¶XQ 5HSrFKDJHpYHQWXHOHWG¶XQHSKDVH¿QDOH 27) Each Competition will comprise Free Practice, Qualifying Practice, Qualifying Heats, possible Second Chance +HDWDQGD¿QDOSKDVH D(VVDLV/LEUHV$UWLFOH$GHV3UHVFULSWLRQV6SpFL¿TXHV D)UHH3UDFWLFH$UWLFOH$RIWKH6SHFL¿F3UHVFULSWLRQV E(VVDLV4XDOL¿FDWLIV$UWLFOH%GHV3UHVFULSWLRQV 6SpFL¿TXHV E4XDOLI\LQJ3UDFWLFH$UWLFOH%RIWKH6SHFL¿F3UHVcriptions. F0DQFKHV4XDOL¿FDWLYHV$UWLFOH&GHV3UHVFULSWLRQV 6SpFL¿TXHV F4XDOLI\LQJ+HDWV$UWLFOH&RIWKH6SHFL¿F3UHVFULStions. G0DQFKHGH5HSrFKDJH$UWLFOH'GHV3UHVFULSWLRQV 6SpFL¿TXHV G6HFRQG&KDQFH+HDW$UWLFOH'RIWKH6SHFL¿F3UHVcriptions. H3KDVH¿QDOH$UWLFOH(GHV3UHVFULSWLRQV6SpFL¿TXHV H)LQDOSKDVH$UWLFOH(RIWKH6SHFL¿F3UHVFULSWLRQV GRILLES DE DÉPART STARTING GRIDS 28) Article 2.19 des Prescriptions Générales. 28) Article 2.19 of the General Prescriptions. PROCÉDURE DE DÉPART STARTING PROCEDURE 29) Article 2.20 des Prescriptions Générales. 29) Article 2.20 of the General Prescriptions. 30) Type de départs : départs lancés pour karts à prise GLUHFWHDYHFHPEUD\DJHWHOVTXHGp¿QLVjO¶$UWLFOH des Prescriptions Générales. 30) Type of starts: rolling starts for direct-drive karts ZLWKDFOXWFKDVGH¿QHGLQ$UWLFOHRIWKH*HQHUDO Prescriptions. /HV&RPPLVVDLUHV6SRUWLIVSRXUURQWXWLOLVHUWRXW système vidéo ou électronique susceptible de les aider à prendre une décision. Les décisions des Commissaires 6SRUWLIVSRXUURQWSUpYDORLUVXUFHOOHVGHV-XJHVGH)DLW 7RXWHLQIUDFWLRQDX[GLVSRVLWLRQVGX&RGHRXGXSUpVHQW 5qJOHPHQW6SRUWLIUHODWLYHVjODSURFpGXUHGHGpSDUW SRXUUDHQWUDvQHUO¶H[FOXVLRQGX3LORWHFRQFHUQpGHOD&RPpétition. 31) The Stewards may use any video or electronic system likely to help them to take a decision. The Stewards’ decisions may supersede those taken by Judges of Fact. Any infringement of the provisions of the Code or of these 6SRUWLQJ5HJXODWLRQVUHODWLQJWRWKHVWDUWLQJSURFHGXUH PD\HQWDLOWKHH[FOXVLRQRIWKH'ULYHUFRQFHUQHGIURPWKH Competition. SUSPENSION D’UNE COURSE SUSPENDING A RACE 32) Article 2.21 des Prescriptions Générales. 32) Article 2.21 of the General Prescriptions. TROPHÉE ACADÉMIE DE KARTING DE LA CIK-FIA CIK-FIA KARTING ACADEMY TROPHY REPRISE D’UNE COURSE RESUMING A RACE 33) Article 2.22 des Prescriptions Générales. 33) Article 2.22 of the General Prescriptions. ARRIVÉE FINISH 34) Article 2.23 des Prescriptions Générales. 34) Article 2.23 of the General Prescriptions. PARC FERMÉ PARC FERMÉ 35) Article 2.13 des Prescriptions Générales. 35) Article 2.13 of the General Prescriptions. INCIDENTS INCIDENTS 36) Article 2.24 des Prescriptions Générales. 36) Article 2.24 of the General Prescriptions. DROITS D’ENGAGEMENT ET FONDS DE PRIX ENTRY FEES AND PRIZE FUND &KDTXH$61GRQWXQRXSOXVLHXUV3LORWHVV¶HVWVHVRQW engagé(s) au Trophée devra verser à la CIK-FIA 252 euros pour alimenter le Fonds de Prix commun récompensant les Championnats de la CIK-FIA. 37) Each ASN of which one or more Drivers have entered the Trophy must pay to the CIK-FIA the sum of 252 euros as a contribution to the common Prize Fund which rewards the CIK-FIA Championships. 38) Le droit d’engagement et l’inscription devront être payés et envoyés par le Concurrent. La CIK-FIA devra être en possession des inscriptions au plus tard à la date de FO{WXUH¿[pHDXPDUV/HGURLWG¶HQJDJHPHQWSDU3LORWH pour le Trophée est de 2’095 euros (dont 154 euros seront versés à chaque Organisateur). Ce droit comprend la IRXUQLWXUHSDUOD&,.),$G¶XQ$QQXDLUHHWOHGURLWGHORFDtion des tentes (1 tente 3 x 4,5 m par Pilote) qui seront installées par la CIK-FIA dans le Paddock et sous lesquelles tous les Pilotes devront prendre place. 38) Entry fees and entries must be paid and sent by the Entrant. The CIK-FIA must have received entries at the latest on the closing date for entries, set at 31 March. The entry fee per Driver for the Trophy is 2,095 euros (154 euros of which will be paid to each Organiser). This fee LQFOXGHVWKHVXSSO\E\WKH&,.),$RID<HDUERRNDQGWKH IHHIRUWHQWVRQH[PWHQWSHU'ULYHUZKLFKZLOOEH pitched by the CIK-FIA in the Paddock and which every Driver must occupy. Commission Internationale de Karting - FIA LUBRIFIANTS AGREES PAR LA CIK-FIA POUR 2015 CIK-FIA AGREED LUBRICANTS FOR 2015 FabricantNom Référence ManufacturerName Reference Bel-Ray H1R Racing 100% Synthetic Ester 2T engine oil 114347/01 BRP-Powertrain Gmbh & Co KG XPS Kart Tec Full Synthetic 115059/01 Cogelsa (Global Racing Oil) Global Racing Oil (GRO) Kart-2 114364/01 Denicol Motor Oils SYN 100 Two Stroke 114359/01 ENI SpA (ENI Schmiertechnik GmbH) Kart 2T 114371/01 Exced di Carbone Nunzio Exced RSK Blue Print 2 Stroke Oil 114358/01 Exced di Carbone Nunzio Exced RSK Evolution 2 Stroke Oil 114358/03 Exced di Carbone Nunzio Exced RSK M 2 Stroke Oil 114358/02 Fuchs Lubricants Silkolene Pro KR2 2-Stroke Kart Racing Oil 114325/02 Fuchs Lubricants Silkolene Pro2 100% Synthetic Racing 2-Stroke Oil 114325/01 HP2 Laboratoire HP2 Phenix Triboxy-Line 809 HP 114373/01 Igol Igol Propuls Competition STS-R 114404/01 Igol Igol Propuls 2T Kart 114404/02 Lexoil Europe Division Lexoil 996 EVO 1 100% Synthese 115007/01 Liqui Moly Liqui Moly Pro Kart Oil 114341/01 Lubricants UK Castrol XR77 2T engine oil 114318/01 MaroilBardahl KXT Kart114357/01 Motul Motul Kart Grand Prix 2T 114360/01 Pakelo Motor Oil Pakelo Racing 2TS K Synthetic Lubricant 114378/01 Petromark Automotive Chemicals PM Xeramic Synmax Full Synthetic 2T Kart Racing Oil114337/02 Petromark Automotive Chemicals PM Xeramic Castor Evolution 2T Kart Racing Oil114337/01 Petronas Lubricants Int. Roklube DTF 114336/01 Putoline Oil / D Racing Putoline Kart 2 Nano Tech 114381/01 Putoline Oil / D Racing Putoline Kart Tech 2 Nano Tech 115006/01 PWG co, Ltd (MPR) Prestar Racing Oil S2T MC-002 115090/01 Ravensberger Schmierstoffvertrieb Ravenol Racing Kart 2T 114345/02 Ravensberger Schmierstoffvertrieb Ravenol Racing Castor 2T 114345/01 Solda’ Vladimiro Wladoil Racing K2T 114351/01 Total Lubs ELF HTX 976+ 114366/02 Total Lubs ELF HTX 909 114366/01 Valvoline Europe Valvoline Racing 2T 2-cycle motor oil 114320/01 Vrooam Powersports Lubricants Vrooam Factory Racing 2T Kart Engine Oil 114365/01 Wako Chemical Wako’s 2CR 114335/01 Yacco Yacco KVX RACE 2T 114386/01 Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 29/04/2015 5 Page 1 sur 1 Information Bulletin Concerning The Mounting Of The Front Fairing 24.04.2015 After thorough on-track testing, in varied situations reflecting race conditions as closely as possible, the CIK-FIA has now validated the new definition of the front fairing mounting kit in a bid to institute greater sportsmanship and respect in karting Competitions by punishing bad behaviour. As from Monday 4 May 2015, the front fairing mounting kit as defined in CIKFIA Bulletin N° 40 – 04/05-2015 must therefore be used on all categories of karts taking part in CIK-FIA Competitions and in all other international Competitions. For further information, please refer to CIK-FIA Bulletin N° 40 – 04/05-2015, which cancels and replaces the previous version. ******** Bulletin D'information Concernant Les Fixations De Carénage Avant A la suite de tests approfondis en piste dans des situations variées reflétant au plus près les conditions de course, la CIK-FIA vient de valider la nouvelle définition du kit de montage de carénage avant correspondant à sa volonté de d'instituer davantage de sportivité et de respect dans les Compétitions de karting en sanctionnant les mauvais comportements. A partir du lundi 4 mai 2015, le kit de montage de carénage avant tel que défini dans Bulletin N° 40 – 04/05-2015 de la CIK-FIA devra donc être utilisé dans toutes les catégories lors des Compétitions de la CIK-FIA ainsi que dans toutes les autres Compétitions internationales. Pour plus d'information, se référer au Bulletin N° 40 – 04/05-2015 de la CIK-FIA qui annule et remplace la précédente version. © 2015 CIKFIA | Private Area http://www.cikfia.com/newsroom/view/article/bulletin-dinformation-concernant-les-fi... 24.04.2015 DÉCISIONS DE LA FIA DECISIONS OF THE FIA texte supprimé = texte barré nouveau texte = texte en gras souligné deleted text = crossed out text new text = text in bold underlined Application : 04/05/2015 Publié le 24/04/2015 Implementation: 04/05/2015 Published on 24/04/2015 PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS * le 3e, le 2e et le vainqueur de la Compétition monteront successivement sur le podium ; * l’hymne national du Pilote vainqueur sera joué et le drapeau national des trois premiers sera hissé (la nationalité du Pilote étant celle de l’ASN ayant émis sa licence, sauf pour le Championnat du Monde, où la nationalité civile du Pilote prévaudra) ; * une coupe au minimum sera remise aux Pilotes. * the 3rd and 2nd placed Drivers and the winner of the Competition will climb on the podium in that order; * the winner’s national anthem will be played and the QDWLRQDOÀDJVRIWKHWRSFODVVL¿HG'ULYHUVZLOOEHKRLVWHG WKHQDWLRQDOLW\RIWKH'ULYHUEHLQJWKDWRIWKH$61ZKLFK delivered his licence, except for the World Championship where the civil nationality of the Driver will prevail); * at least a cup will be awarded to the Drivers. 28 - Droits de tournage et d’images animées de la FIA La couverture des Compétitions comptant pour les Championnats de la CIK-FIA doit être équitable et impartiale, conformément à l’Article 27 des Prescriptions Générales de la FIA. ),$¿OPLQJDQGPRYLQJSLFWXUHULJKWV 29 - Contrôle des courses par caméras embarquées (suivant la réglementation des championnats concernés) 5DFHFRQWUROV\VWHPZLWKRQERDUGFDPHUDV DFFRUGLQJWRWKHUHJXODWLRQVRIWKHFKDPSLRQVKLSVFRQFHU ned) 7KH&,.),$ZLOOLPSOHPHQWDUDFHFRQWUROV\VWHPZLWK RQERDUGFDPHUDVRQDOONDUWVH[FHSWLQ6XSHUNDUW(DFK FDPHUDDQGVPDUWFDUGZLOOEHWKHSURSHUW\RIWKH&,.),$ and they will be distributed in the Parc Fermé. The camera DWWDFKPHQWVZDWHUSURRIFDVLQJDQGVXSSRUWZLOOEHWKH property of the Competitors. It is their responsibility to LQVWDOOWKHVXSSRUWNLWFRUUHFWO\RQWKHNDUWEXWLWLVVWULFWO\ forbidden for Drivers and Mechanics to handle the cameras directly, under pain of exclusion. 7KHFRYHUDJHRI&RPSHWLWLRQVFRXQWLQJWRZDUGVWKH&,. ),$&KDPSLRQVKLSVPXVWEHIDLUDQGLPSDUWLDOLQDFFRU GDQFHZLWK$UWLFOHRIWKH),$*HQHUDO3UHVFULSWLRQV La CIK-FIA mettra en place un système de contrôle des courses par caméras embarquées sur tous les karts (sauf en Superkart). Chaque caméra et carte-mémoire sera la propriété de la CIK-FIA et distribuée en Parc Fermé. Les ¿[DWLRQVGHODFDPpUDERvWLHUpWDQFKHHWVXSSRUWVHURQW la propriété des Concurrents. Il est de leur responsabilité d’installer correctement le kit de support sur le kart ; en revanche, il est strictement interdit aux Pilotes et Mécaniciens de manipuler directement les caméras, sous peine d’exclusion. 30 - Matériels de contrôle Toute perte, détérioration ou tentative de manipulation du système de contrôle du régime du moteur sera sanctionnée au minimum d’une amende de 600 €. La perte ou la détérioration involontaire du système de contrôle des embrayages ou de la caméra embarquée sera facturée 200 € ; leur manipulation ou détérioration volontaire sera sanctionnée d’une amende minimum de 600 €. &RQWUROV\VWHPV $Q\ORVVGHWHULRUDWLRQRUDWWHPSWWRWDPSHUZLWKWKH HQJLQHVSHHGFRQWUROV\VWHPZLOOEHSXQLVKHGE\DPLQL PXP¿QHRI¼/RVVRULQYROXQWDU\GHWHULRUDWLRQRIWKH FOXWFKFRQWUROV\VWHPRURIWKHRQERDUGFDPHUDZLOOEH LQYRLFHG¼WDPSHULQJZLWKRUGHOLEHUDWHO\GHWHULRUD WLQJWKHPZLOOEHSXQLVKHGE\DPLQLPXP¿QHRI¼ 31 - Carénage avant et Kit de montage de carénage avant Dans tous les Championnats, Coupes et Trophées de la CIK-FIA (Superkart excepté), l’utilisation d’un carénage avant homologué et du kit de montage de carénage avant homologué de la période d’homologation de la carrosserie 2015 – 2020 est obligatoire. )URQW)DLULQJ)URQW)DLULQJ0RXQWLQJ.LW Installation du «Carénage avant» Le carénage avant (installé à l’aide du kit de montage de carénage avant) doit être en position correcte à tout moment lors d’une compétition (voir Dessin Technique n° 2d). Le drapeau noir à disque orange ne sera pas présenté à un pilote si son carénage avant n’est plus en position correcte. Si le juge de fait indique que le carénage avant sur un ou plusieurs karts n’était plus dans la bonne position au moment où le «drapeau à damier noir et blanc» était agité et où le(s) kart(s) concerné(s) franchissait(aient) la ligne G¶DUULYpHXQHSpQDOLWpHQWHPSVGHVHFRQGHVVHUDLQÀLgée au(x) pilote(s) concerné(s). Cette pénalité en temps n’est pas susceptible d’appel. &RUUHFWLQVWDOODWLRQRIWKH³)URQW)DLULQJ´ 7KHIURQWIDLULQJXVLQJWKHIURQWIDLULQJPRXQWLQJNLW PXVWEHLQWKHFRUUHFWSRVLWLRQDWDOOWLPHVGXULQJDFRP SHWLWLRQVHH7HFKQLFDO'UDZLQJ1RG Ż ,QDOO&,.),$&KDPSLRQVKLSV&XSVDQG7URSKLHVH[FHSW 6XSHUNDUWWKHXVHRIDKRPRORJDWHGIURQWIDLULQJDQG RIWKHKRPRORJDWHGIURQWIDLULQJPRXQWLQJNLWRIWKH ERG\ZRUNKRPRORJDWLRQSHULRG±LVPDQGDWRU\ 7KHEODFNÀDJZLWKDQRUDQJHGLVFZLOOQRWEHVKRZQWRD GULYHULIKLVIURQWIDLULQJLVQRORQJHULQWKHFRUUHFWSRVL tion. ,IWKHMXGJHRIIDFWUHSRUWVWKDWWKHIURQWIDLULQJRQRQH RUPRUHNDUWVZDVQRORQJHULQWKHFRUUHFWSRVLWLRQZKHQ WKH³EODFNDQGZKLWHFKHTXHUHGÀDJ´ZDVZDYHGDQGWKH NDUWVFRQFHUQHGFURVVHGWKH¿QLVKOLQHDWLPHSHQDOW\ RIVHFRQGVZLOOEHLPSRVHGRQWKHGULYHUVFRQFHUQHG This time penalty is not susceptible to appeal. 257 Bulletin CIK (40 - Avril-Mai 2015 / April-May 2015) DÉCISIONS DE LA FIA DECISIONS OF THE FIA texte supprimé = texte barré nouveau texte = texte en gras souligné deleted text = crossed out text new text = text in bold underlined Application : 04/05/2015 Publié le 24/04/2015 Implementation: 04/05/2015 Published on 24/04/2015 RÈGLEMENT TECHNIQUE TECHNICAL REGULATIONS DESSIN TECHNIQUE N°2c TECHNICAL DRAWING No. 2c Kit de montage de carénage avant Front fairing mounting kit Ż A Aucune partie (des vis par exemple) n’est admise dans cette zone. No parts (of the screws for example) are admitted in this area. B Brides à crochet à ouvrir et fermer à la main uniquement sans aucun outil Hook clamps are to be opened and closed by hand only without any tools. ,OQ¶HVWSHUPLVGH¿[HUOHFDUpQDJHDYDQWVXUOHNDUWTX¶DX PR\HQGXNLWGHPRQWDJHGHFDUpQDJHDYDQW$XFXQDXWUH dispositif n’est autorisé. Le carénage avant doit pouvoir reculer librement en direction du châssis sans aucune obstruction d’une partie quelconque pouvant limiter le mouvement. Les pare-chocs avant (tubes inférieur et supérieur) doivent rWUHULJLGHPHQW¿[pVDXFKkVVLVHWSUpVHQWHUXQHVXUIDFH lisse. Toute intervention mécanique ou autre destinée à augmenter la friction des pare-chocs avant est strictement interdite. 'p¿QLWLRQ©.LWGHPRQWDJHGHFDUpQDJHDYDQWª 1. Kit de support de montage pour carénage avant (2 pièces + 8 vis au total). 2. Support de pare-chocs avant (2 demi-coques + 2 vis au total). 3. Brides à crochet réglables (les 2 pièces doivent être fabriquées en métal). ,WLVRQO\SHUPLWWHGWR¿[WKHIURQWIDLULQJRQWRWKHNDUW using the front fairing mounting kit. No other device is authorised. It must be possible for the front fairing to move freely back in the direction of the chassis without any obstruction from any part that may restrict movement. The front bumpers (lower and upper tube) must be rigidly connected with the chassis and must have a smooth surface. Any mechanical work or other intervention to maximize the friction of the front bumpers is strictly forbidden. 'H¿QLWLRQ©)URQWIDLULQJPRXQWLQJNLWª 1. Mounting bracket kit for front fairing (2 pieces + 8 screws in total). 2. Front bumper support (2 half shells + 2 screws in total). Le logo de la CIK et le numéro d’homologation doivent être estampillés sur chaque pièce. 1. Kit de support de montage pour carénage avant (les 2 pièces doivent être fabriquées en plastique). 2. Support de pare-chocs avant (les 2 demi-coques doivent être fabriquées en plastique). CIK Logo & Homologation number shall be embossed on each of the following pieces: 1. Mounting bracket kit for front fairing (the 2 pieces shall be made of plastic). 2. Front bumper support (the 2 half shells shall be made of plastic). Ż 3. Adjustable hook clamps (the 2 pieces, shall be made of metal). 416 Bulletin CIK (40 - Avril-Mai 2015 / April-May 2015) RÈGLEMENT TECHNIQUE TECHNICAL REGULATIONS DESSIN TECHNIQUE N° 2d TECHNICAL DRAWING No. 2d ,QVWDOODWLRQFRUUHFWHGX©&DUpQDJH$YDQWª Correct installation of the “Front Fairing” Position correcte / Correct position Postion acceptable / Acceptable position Ż Position non aceptable si une quelconque partie du des tubes inférieur du pare-chocs avant se trouve dans la les zones marquées (A). Not acceptable position if any part of the lower tubes of the front bumper is are in the marked areas (A). Ż Ż 417 Bulletin CIK (40 - Avril-Mai 2015 / April-May 2015) 6 PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS 4 - RÉGLEMENTATION GÉNÉRALE 4 - GENERAL REGULATIONS Article 4.1 : Prescriptions Générales (Compétitions CIKFIA & Compétitions Internationales) $UWLFOH 3UHVFULSWLRQV6SpFL¿TXHV&RPSpWLWLRQV&,. FIA) Article 4.1: General Prescriptions (CIK-FIA Competitions & International Competitions) $UWLFOH 6SHFL¿F3UHVFULSWLRQV&,.),$&RPSHWLWLRQV 4.1 PRESCRIPTIONS GÉNÉRALES (COMPÉTITIONS DE LA CIK-FIA & COMPÉTITIONS INTERNATIONALES) 4.1 GENERAL PESCRIPTIONS (CIK-FIA COMPETITIONS & INTERNATIONAL COMPETITIONS 1) Objectifs 1) Aims La COMMISSION INTERNATIONALE DE KARTING-FIA (ci-après désignée «CIK-FIAªHVWXQH&RPPLVVLRQ VSpFLDOLVpHGHOD),$UpJLHSDUOHV6WDWXWVGHOD),$HWOH 5qJOHPHQW,QWpULHXUGHOD),$ The COMMISSION INTERNATIONALE DE KARTING-FIA (hereafter referred to as the « CIK-FIA») is a specialised Commission of the FIA governed by the Statutes of the FIA and the FIA Internal Regulations. Le contrôle et la bonne marche des Compétitions internationales (ci-après dénommées «CompétitionsªSRXUOHV YpKLFXOHVGpQRPPpV©kartsªGHYURQWrWUHDVVXUpVGDQV FKDTXHSD\VSDUO¶$XWRULWp6SRUWLYH1DWLRQDOH©ASN») GpWHQDQWOHSRXYRLUVSRUWLIHQYHUWXGHVRQDI¿OLDWLRQjOD FIA. The control and good running of international Competitions (hereafter referred to as « Competitions») for vehicles called « karts» shall be ensured in each country by the National Sporting Authority (« ASN») holding the sporting power in accordance with its FIA membership. 2) Prescriptions Sportives 2) Sporting Prescriptions 2.1 - Application des Prescriptions Générales 7RXVOHV5qJOHPHQWV3DUWLFXOLHUVGHV&RPSpWLWLRQVLQVFULWHV DX&DOHQGULHU6SRUWLI,QWHUQDWLRQDOGHOD&,.),$GRLYHQW rWUHFRQIRUPHVDX&RGH6SRUWLI,QWHUQDWLRQDOFLDSUqV dénommé «le CodeªHWjVHV$QQH[HVDX[%XOOHWLQV2I¿FLHOVGHOD),$HWGHOD&,.),$HWDX[SUpVHQWHV3UHVFULStions Générales («les Prescriptions»). 2.1 - Application of the General Prescriptions All Supplementary Regulations of Competitions entered on the CIK-FIA International Sporting Calendar must comply with the International Sporting Code (hereafter referred to DV©WKH&RGHªDQGLWV$SSHQGLFHVWRWKH2I¿FLDO%XOOHWLQV of the FIA and of the CIK-FIA and to these General Prescriptions (« the Prescriptions »). 2.2 - Statut des Compétitions 7RXWH&RPSpWLWLRQGRLWrWUHLQVFULWHDX&DOHQGULHU6SRUWLI ,QWHUQDWLRQDOGHOD&,.),$GDQVOHUHVSHFWGX&RGH 2.2 - Statute of Competitions All Competitions must be entered on the CIK-FIA International Sporting Calendar in the respect of the Code. 2.3 - Karts admis 1HSHXYHQWrWUHDGPLVjXQH&RPSpWLWLRQTXHOHVNDUWV FRQIRUPHVDX5qJOHPHQW7HFKQLTXHGH.DUWLQJGHOD&,. ),$DX5qJOHPHQWGH5HFRQQDLVVDQFHRXjGpIDXWjWRXW UqJOHPHQWGHO¶$61FRQFHUQpHVRXPLVjO¶DSSUREDWLRQGH OD&,.),$/HVSUHVFULSWLRQVGHVpFXULWpGHOD&,.),$ GRLYHQWWRXMRXUVrWUHG¶DSSOLFDWLRQ$UWLFOHGX5qJOHPHQW7HFKQLTXHGHOD&,.),$6pFXULWpGHV.DUWVHWGHV (TXLSHPHQWV 2.3 - Eligible karts Only karts complying with the CIK-FIA Karting Technical Regulations, with the Recognition Regulations or, failing this, with any regulations of the ASN concerned submitted to the approval of the CIK-FIA, may be accepted in a Competition. The safety prescriptions of the CIK-FIA must always be applied (Article 3 of the Technical Regulations of the CIK-FIA, Safety of Karts and Equipement). 2.4 - Inscription des Compétitions /HV&RPSpWLWLRQVQHSHXYHQWVHGpURXOHUTXHVXUXQFLUFXLW KRPRORJXpSDUOD&,.),$GpWHQDQWXQHOLFHQFHFLUFXLW DSSURSULpHDX[W\SHVGHNDUWVXWLOLVpVGDQVOHFDGUHGHFHV Compétitions. 2.4 - Entry of Competitions Competitions may be held only on circuits homologated by the CIK-FIA and holding a circuit licence, appropriate to the types of karts used in these Competitions. ¬FRQGLWLRQTX¶XQH&RPSpWLWLRQUpSRQGHHQWRXVSRLQWV DX[GLVSRVLWLRQVGX&RGHHWGHVHV$QQH[HVOD&,.),$ O¶LQVFULUDDX&DOHQGULHU6SRUWLI,QWHUQDWLRQDOGHOD&,.),$ VXUGHPDQGHGHO¶$61FRQFHUQpH $XFDVRXQH$61GpOpJXHUDLWVRQRUJDQLVDWLRQjXQWLHUV O¶$61GHPHXUHUDLWUHVSRQVDEOHYLVjYLVGHOD&,.),$HQ FHTXLFRQFHUQHOHUHVSHFWGHWRXVOHVUqJOHPHQWV Providing that a Competition meets in every respect the provisions of the Code and its Appendices, the CIK-FIA will enter it on the CIK-FIA International Sporting Calendar on request of the ASN concerned. Should an ASN delegate its organisation to a third party, the ASN would remain responsible vis-à-vis the CIK-FIA as regards the respect of all regulations. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS /H&DOHQGULHU6SRUWLI,QWHUQDWLRQDOGHOD&,.),$VHUDSUpSDUpFKDTXHDQQpHSDUOH*URXSHGH7UDYDLO©5qJOHPHQWV VSRUWLIV&DOHQGULHU&KDPSLRQQDWVªHWVHUDVRXPLVj OD&,.SXLVDX&RQVHLO0RQGLDOGX6SRUW$XWRPRELOHHWj O¶$VVHPEOpH*pQpUDOHGHOD),$ORUVGHOHXUVUpXQLRQVGH décembre. The CIK-FIA International Sporting Calendar will be prepared every year by the Sporting Regulations - Calendar - Championships’ Working Group, and will be submitted to the CIK, then to the World Motor Sport Council and the FIA General Assembly at their December meetings. 7RXWOLWLJHUpVXOWDQWGXWUDYDLOGX*URXSHGH7UDYDLO©5qJOHPHQWVVSRUWLIV&DOHQGULHU&KDPSLRQQDWVªVHUDUpJOp SDUOD&,.GRQWOHVGpFLVLRQVVRQWWRXMRXUVVRXPLVHVDX FRQWU{OHGX&RQVHLO0RQGLDOGX6SRUW$XWRPRELOHGHOD ),$&RQIRUPpPHQWDX[6WDWXWVHWDX&RGHODMXULGLFWLRQ FRPSpWHQWHSRXUWUDQFKHUOHVOLWLJHVHQGHUQLHUUHVVRUWHVW OD&RXUG¶$SSHO,QWHUQDWLRQDOH&$,GHOD),$ Any dispute resulting from the work of the «Sporting Regulations - Calendar - Championships» Working Group will be settled by the CIK, whose decisions are always submitted to the control of the World Motor Sport Council of the FIA. In accordance with the Statutes and the Code, WKHFRPSHWHQWMXULVGLFWLRQWRVHWWOHGLVSXWHVDQG¿QDOFRXUW is the International Court of Appeal (ICA) of the FIA. /HV$61V¶HQJDJHQWjDGRSWHUHWjGpYHORSSHUGDQVOHXU SD\VOHVFODVVHVGHVFDWpJRULHVLQWHUQDWLRQDOHV¿[pHVSDU OD&,.),$(OOHVSRXUURQWpWDEOLUGHVFDWpJRULHVGLWHV ©1DWLRQDOHVGH3URPRWLRQªD\DQWXQHUpJOHPHQWDWLRQSDUWLFXOLqUHGpFRXODQWGHFULWqUHVWHFKQLTXHVHWpFRQRPLTXHV SURSUHVDXSD\VFRQVLGpUp &HVFDWpJRULHVGHYURQWIDYRULVHUO¶DFFqVGHV3LORWHVDX[ FDWpJRULHVLQWHUQDWLRQDOHVHWUHVSHFWHUOHVH[LJHQFHVWHFKQLTXHVGHOD&,.),$HQPDWLqUHGHVpFXULWp ASNs undertake to adopt and develop in their countries the classes of the international categories established by the CIK-FIA. They may introduce categories called ©1DWLRQDO3URPRWLRQªZLWKVSHFL¿FUHJXODWLRQVUHVXOWLQJ IURPWKHLUWHFKQLFDODQGHFRQRPLFDOFULWHULDVSHFL¿FWRWKH country considered. These categories must favour Drivers’ access to international categories and meet the technical requirements of the CIK-FIA as regards safety. 2.5 - Déplacement ou annulation d’une Compétition $/HGpSODFHPHQWRXO¶DQQXODWLRQG¶XQH&RPSpWLWLRQ GRLYHQWrWUHQRWL¿pVSDUpFULWSDUO¶$61jOD&,.),$DX PRLQVWURLVPRLVDYDQWODGDWHSUpYXHSRXUOD&RPSpWLWLRQ 'DQVFHFDVXQGURLWGHGpSODFHPHQWpJDOjGXGURLW G¶LQVFULSWLRQGHOD&RPSpWLWLRQDX&DOHQGULHU6SRUWLI,QWHUQDWLRQDOGHOD&,.),$RXXQGURLWG¶DQQXODWLRQGHGH FHGURLWVHUDH[LJp 2.5 - Change of date or cancellation of a Competition A. The change of date or cancellation of a Competition PXVWEHQRWL¿HGLQZULWLQJE\WKH$61WRWKH&,.),$DW least three months before the date scheduled for the Competition. In that case, a change of date fee equal to 15% of the CIK-FIA International Sporting Calendar entry fee of the Competition or a cancellation fee equal to 10% of that fee will be required. %6LO¶DYLVGHGpSODFHPHQWRXG¶DQQXODWLRQHVWFRPPXQLTXpSDUO¶$61jOD&,.),$PRLQVGHWURLVPRLVDYDQWOD GDWHSUpYXHSRXUOD&RPSpWLWLRQLOVHUDUpFODPpjO¶$61 XQGURLWGHGpSODFHPHQWRXG¶DQQXODWLRQpJDOjGX GURLWG¶LQVFULSWLRQ %,IWKHQRWL¿FDWLRQRIWKHFKDQJHRIGDWHRUFDQFHOODWLRQ is communicated by the ASN to the CIK-FIA less than three months before the date scheduled for the Competition, the ASN will be required to pay a change of date fee or cancellation fee equal to 15% of the entry fee. 2.6 - Publication du Règlement Particulier $/HV2UJDQLVDWHXUVVRQWWHQXVG¶LQGLTXHUGDQVOHXU 5qJOHPHQW3DUWLFXOLHUV¶LOH[LVWHGHVSUREOqPHVG¶LPSRUWDWLRQGHNDUWVGHFRPSpWLWLRQRXGHSLqFHVGpWDFKpHV HWOHVPHVXUHVjSUHQGUHSRXUOLPLWHUOHVSUREOqPHVDLQVL rencontrés. 2.6 - Publication of the Supplementary Regulations A. Organisers must indicate in their Supplementary Regulations whether there are problems of importation of competition karts or of spare parts, and what measures to take in order to limit such problems. %7RXWHPRGL¿FDWLRQRXGLVSRVLWLRQVXSSOpPHQWDLUH DSSRUWpHDXUqJOHPHQWG¶XQH&RPSpWLWLRQGRLWrWUHLQWURGXLWHGDQVOHUHVSHFWGX&RGHSDUO¶LQFOXVLRQG¶DGGLWLIV QXPpURWpVHWGDWpVTXLGHYLHQGURQWSDUWLHLQWpJUDQWHGX 5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQ %$Q\PRGL¿FDWLRQRUVXSSOHPHQWDU\SURYLVLRQWRWKH regulations of a Competition must be introduced in the respect of the Code, by the inclusion of numbered and dated bulletins, which will become an integral part of the Supplementary Regulations of the Competition. 2.7 - Pilotes admis 3RXUSDUWLFLSHUjXQH&RPSpWLWLRQWRXW3LORWHGRLWrWUHHQ SRVVHVVLRQG¶XQH/LFHQFH,QWHUQDWLRQDOHGH&RQFXUUHQW &RQGXFWHXU$UWLFOHGX&RGHYDODEOHSRXUOH.DUWLQJHW SRXUO¶DQQpHHQFRXUVGpOLYUpHSDUO¶$61DI¿OLpHjOD),$ DLQVLTXHGHO¶DXWRULVDWLRQSUpDODEOHGHFHWWH$61VLHOOH Q¶HVWSDVRUJDQLVDWULFH$UWLFOHGX&RGH /HVOLFHQFHVGH&RQFXUUHQWVQHSRXUURQWHQDXFXQFDVrWUH GpOLYUpHVjGHVSHUVRQQHVQ¶D\DQWSDVDWWHLQWO¶kJHGHOD 2.7 - Eligible Drivers In order to participate in a Competition, any Driver must be the holder of an International Entrant’s/Driver’s Licence (Article 9.1 of the Code) valid for Karting and for the curUHQW\HDULVVXHGE\WKH$61DI¿OLDWHGWRWKH),$DVZHOO as of the authorisation previously granted by that ASN if it is not the Organiser (Article 3.9 of the Code). Entrants’ licences may not be delivered to persons who are still under age and do not have full legal capacity. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS PDMRULWpOpJDOHOHXUFRQIpUDQWHQWLqUHFDSDFLWpMXULGLTXH 2.8 - Acceptation des engagements 'DQVVRQ5qJOHPHQW3DUWLFXOLHUO¶2UJDQLVDWHXUSHXWVWLSXOHUOHQRPEUHPLQLPDOGHNDUWVHQJDJpV; si ce nombre Q¶HVWSDVDWWHLQWO¶2UJDQLVDWHXUHVWHQGURLWG¶DQQXOHUOD Compétition. 2.8 - Acceptation of entries In his Supplementary Regulations, the Organiser may stipulate the minimum number of karts entered ; if this number is not reached, the Organiser has the right to cancel the Competition. 2.9 - Conditions générales $,OLQFRPEHDX&RQFXUUHQWG¶DVVXUHUTXHWRXWHVOHV SHUVRQQHVFRQFHUQpHVSDUOHXUHQJDJHPHQWREVHUYHQW WRXWHVOHVGLVSRVLWLRQVGX&RGHGX5qJOHPHQW7HFKQLTXHHWGX5qJOHPHQW6SRUWLI6LXQ&RQFXUUHQWHVWGDQV O¶LPSRVVLELOLWpG¶rWUHSUpVHQWHQSHUVRQQHjOD&RPSpWLWLRQ LOGRLWGpVLJQHUVRQUHSUpVHQWDQWSDUpFULW¬WRXWPRPHQW G¶XQH&RPSpWLWLRQODSHUVRQQHFKDUJpHG¶XQNDUWHQJDJp HVWUHVSRQVDEOHFRQMRLQWHPHQWHWVROLGDLUHPHQWDYHFOH &RQFXUUHQWGXUHVSHFWGHO¶HQVHPEOHGHVGLVSRVLWLRQVGX Code et de la réglementation CIK-FIA. 2.9 - General conditions A. It is the Entrant’s responsibility to ensure that all persons concerned by his entry observe all the requirements of the Code, the Technical Regulations and the Sporting Regulations. If an Entrant is unable to be present in person at the Competition, he must nominate his representative in writing. The person having charge of an entered kart during any part of a Competition is responsible jointly and severally with the Entrant for the respect of all the provisions of the Code and of the CIK-FIA Regulations. %/HV&RQFXUUHQWVGRLYHQWDVVXUHUTXHOHXUVNDUWVUHVSHFWHQWOHVFRQGLWLRQVGHFRQIRUPLWpHWGHVpFXULWpSHQGDQW WRXWHODGXUpHGHVHVVDLVHWGHODFRXUVH %(QWUDQWVPXVWHQVXUHWKDWWKHLUNDUWVFRPSO\ZLWKWKH conditions of eligibility and safety throughout practice and the race. &7RXWHVOHVSHUVRQQHVFRQFHUQpHVGHTXHOTXHIDoRQTXH FHVRLWSDUXQNDUWHQJDJpRXVHWURXYDQWSRXUWRXWHDXWUH UDLVRQGDQVOD]RQHGX3DGGRFNGHV3DUFVG¶$VVLVWDQFHRX VXUODSLVWHGRLYHQWSRUWHUjWRXWPRPHQWXQODLVVH] passer approprié. C. All persons concerned in any way by an entered kart or present in any other capacity whatsoever in the Paddock, Servicing Parks or on the track must wear an appropriate pass at all times. 9pUL¿FDWLRQV7HFKQLTXHVHW6SRUWLYHV $3HQGDQWOHV9pUL¿FDWLRQV7HFKQLTXHVHW6SRUWLYHVSUpOLPLQDLUHVTXLLQWHUYLHQGURQWDX[GDWHVHWOLHX[SUpFLVpV GDQVOH5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQOH3LORWH HWOH&RQFXUUHQWGHYURQWWHQLUGLVSRQLEOHVWRXVOHVGRFXPHQWVHWLQIRUPDWLRQVH[LJpV 2.10 - Scrutineering and Sporting Checks A. During the initial Scrutineering and Sporting Checks, which will take place on the dates and at the locations VSHFL¿HGLQWKH6XSSOHPHQWDU\5HJXODWLRQVRIWKH&RPSHtition, each Driver and each Entrant must have all required documents and information available. %/HV3LORWHVHW&RQFXUUHQWVTXLQ¶DXURQWSDVUHVSHFWp OHVOLPLWHVGHWHPSVLPSRVpHVQHVHURQWSDVDXWRULVpV jSDUWLFLSHUjOD&RPSpWLWLRQVDXIGpURJDWLRQDFFRUGpH SDUOHV&RPPLVVDLUHV6SRUWLIVGDQVGHVFLUFRQVWDQFHV SDUWLFXOLqUHV %8QOHVVDZDLYHULVJUDQWHGE\WKH6WHZDUGVLQSDUWLFXODU circumstances, Drivers and Entrants who do not keep to the time limits imposed will not be allowed to take part in the Competition. &,OQHSRXUUDrWUHH[LJpG¶XQ&RQFXUUHQWG¶XQ3LORWHRX GHWRXWHDXWUHSHUVRQQHFRQFHUQpHSDUXQNDUWTX¶LOVLJQH XQHGpFKDUJHRXWRXWDXWUHGRFXPHQWTXLQ¶DXUDLWSDVpWp SUpDODEOHPHQWDSSURXYpSDUOD&,.),$ C. An Entrant, a Driver or any other person concerned by a kart may not be required to sign a discharge or any other document which has not previously been approved by the CIK-FIA. '/H'LUHFWHXUGH&RXUVHRXOH0pGHFLQ&KHISHXWGHPDQGHUjXQ3LORWHGHVHVRXPHWWUHjXQH[DPHQPpGLFDOj WRXWPRPHQWG¶XQH&RPSpWLWLRQ '7KH&OHUNRIWKH&RXUVHRUWKH&KLHI0HGLFDO2I¿FHU may ask a Driver to undergo a medical examination at any time during a Competition. ($XFXQNDUWQHSRXUUDSUHQGUHSDUWjXQH&RPSpWLWLRQ WDQWTX¶LOQ¶DXUDSDVpWpFRQWU{OpSDUOHV&RPPLVVDLUHV 7HFKQLTXHV E. No kart may participate in a Competition unless it has been checked by the Scrutineers. )/HV&RPPLVVDLUHV7HFKQLTXHVSHXYHQWjWRXWPRPHQW G¶XQH&RPSpWLWLRQ: DYpUL¿HUODFRQIRUPLWpGXNDUWRXGHO¶pTXLSHPHQWGX 3LORWH EH[LJHUTX¶XQNDUWVRLWGpPRQWpSDUOH&RQFXUUHQWSRXU V¶DVVXUHUTXHOHVFRQGLWLRQVG¶DGPLVVLRQRXGHFRQIRUPLWp F. At any time during a Competition, the Scrutineers may : a) check the eligibility of the kart or of the Driver’s equipment, b) require a kart to be dismounted by the Entrant to make sure that the conditions of eligibility and conformity are PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS VRQWSOHLQHPHQWUHVSHFWpHV FGHPDQGHUjXQ&RQFXUUHQWGHOHXUIRXUQLUWHOpFKDQWLOORQ RXWHOOHSLqFHTX¶LOVSRXUUDLHQWMXJHUQpFHVVDLUHV IXOO\VDWLV¿HG c) require an Entrant to supply them with such parts or samples as they may deem necessary. *7RXWNDUWTXLDSUqVDYRLUpWpDSSURXYpSDUOHV&RPPLVVDLUHV7HFKQLTXHVHVWGpPRQWpPRGL¿pRXUpSDUp GHWHOOHPDQLqUHTXHFHODSXLVVHDIIHFWHUVDVpFXULWpRX PHWWUHHQTXHVWLRQVDFRQIRUPLWpRXTXLHVWLPSOLTXpGDQV XQDFFLGHQWDYHFGHVFRQVpTXHQFHVVLPLODLUHVGRLWrWUH SUpVHQWpGHQRXYHDXDX[&RPPLVVDLUHV7HFKQLTXHVSRXU approbation. G. Any kart which, after being passed by the Scrutineers, LVGLVPDQWOHGPRGL¿HGRUPHQGHGLQDZD\WKDWPLJKW affect its safety or call into question its eligibility, or which is involved in an accident with similar consequences, must be re-presented for Scrutineering approval. +/H'LUHFWHXUGH&RXUVHSHXWGHPDQGHUTXHWRXWNDUW LPSOLTXpGDQVXQDFFLGHQWVRLWDUUrWpHWFRQWU{Op H. The Clerk of the Course may require that any kart involved in an accident be stopped and checked. ,/HVFRQWU{OHVHW9pUL¿FDWLRQV7HFKQLTXHVVHURQW HIIHFWXpVSDUGHVRI¿FLHOVGPHQWGpVLJQpVTXLVHURQW UHVSRQVDEOHVGHO¶RUJDQLVDWLRQGHV3DUFVG¶$VVLVWDQFHHWRX GX3DUF)HUPpHWTXLVHURQWVHXOVDXWRULVpVjGRQQHUGHV LQVWUXFWLRQVDX[&RQFXUUHQWV I. Checks and Scrutineering shall be carried out by duly DSSRLQWHGRI¿FLDOVZKRVKDOODOVREHUHVSRQVLEOHIRUWKH organisation of the Servicing Parks and/or the Parc Fermé, and who alone are authorised to give instructions to the Entrants. -/HV&RPPLVVDLUHV6SRUWLIVSXEOLHURQWOHVUpVXOWDWVSRXU FKDTXHNDUWYpUL¿pHWjODGHPDQGHOHVPHWWURQWjOD GLVSRVLWLRQGHVDXWUHV&RQFXUUHQWV&HVUpVXOWDWVQHFRPSUHQGURQWSDVGHGRQQpHVFKLIIUpHVSDUWLFXOLqUHVVDXIHQFH TXLFRQFHUQHO¶DQDO\VHGXFDUEXUDQW -7KH6WHZDUGVZLOOSXEOLVKWKH¿QGLQJVRIWKH6FUXWLQHHUV concerning every karts controlled and will place them at WKHGLVSRVDORIRWKHU(QWUDQWVRQUHTXHVW7KHVH¿QGLQJV ZLOOQRWLQFOXGHDQ\VSHFL¿F¿JXUHVH[FHSWFRQFHUQLQJIXHO tests. ./DSUpVHQWDWLRQG¶XQNDUWDX[9pUL¿FDWLRQV7HFKQLTXHV VHUDFRQVLGpUpHFRPPHXQHGpFODUDWLRQLPSOLFLWHGH FRQIRUPLWp K. Submitting a kart to Scrutineering shall be considered as an implicit statement of conformity. /&KDTXH3LORWHUHFHYUDORUVGHV9pUL¿FDWLRQV6SRUWLYHVXQ «3DVVHSRUW7HFKQLTXHª7RXVOHVGpWDLOVUHODWLIVDXPDWpULHO FRPSOHWGRLYHQWrWUHLQVFULWVVXUFHIRUPXODLUHDYDQWTX¶LO QHVRLWSUpVHQWpDX[9pUL¿FDWLRQV7HFKQLTXHV8Q©PasseSRUW7HFKQLTXHªLQFRPSOHWVHUDUHIXVp L. At the Sporting Checks, each Driver will receive an «Technical Passport ». All details relating to the full equipment must be entered on this form before submission to Scrutineering. An incomplete « Technical Passport » will be rejected. 0/HVQXPpURVGHFRXUVHHWOHVVLJQHVSXEOLFLWDLUHVpYHQWXHOVGHYURQWrWUHHQSODFHVXUOHNDUWORUVGHODSUpVHQWDWLRQGXPDWpULHODX[9pUL¿FDWLRQV7HFKQLTXHV M. Racing numbers and possible advertising signs shall be on the kart when the equipment is submitted to Scrutineering. 18Q3LORWHQHSRXUUDFKDQJHUVRQPDWpULHODSUqVTXH FHOXLFLDLWpWpLGHQWL¿pORUVGHV9pUL¿FDWLRQV7HFKQLTXHV N. A Driver shall not be allowed to change his/her equipPHQWDIWHULWKDVEHHQLGHQWL¿HGDW6FUXWLQHHULQJ 2'HVV\VWqPHVGHPHVXUHGXUpJLPHPD[LPXPHWRXGH FRQWU{OHGXIRQFWLRQQHPHQWGHO¶HPEUD\DJHSRXUURQWrWUH XWLOLVpVGDQVOHVFDWpJRULHVRGHVOLPLWHVGHUpJLPHHW RXGHIRQFWLRQQHPHQWGHO¶HPEUD\DJHVRQWSUHVFULWHV,OV GHYURQWrWUHLQVWDOOpVGDQVOHVWULFWUHVSHFWGHVLQVWUXFWLRQV \DIIpUHQWHV O. Systems for the measuring of the maximum engine revs and/or for the control of the clutch functioning may be used in categories where engine speed limits and/or limits regarding clutch functioning are prescribed. They shall be installed in the strict respect of the relevant instructions. 36XUGpFLVLRQGHV&RPPLVVDLUHV6SRUWLIVOHV&RPPLVVDLUHV7HFKQLTXHVSRXUURQWLQWHUFKDQJHUO¶DOOXPDJHGHV &RQFXUUHQWVFRQWUHFHOXLIRXUQLSDUOD&,.RXSDUO¶$61 FRQFHUQpH/¶DOOXPDJHGHVXEVWLWXWLRQGHYUDrWUHGHOD PrPHPDUTXHHWGXPrPHPRGqOHTXHFHOXLXWLOLVpSDUOH &RQFXUUHQWFRQFHUQp P. On decision of the Stewards, the Scrutineers will be authorised to interchange Entrants’ ignition systems for the system supplied by the CIK or the ASN concerned. The substitution ignition system will have to be of the same make and same model as the one used by the Entrant concerned. 2.11 - Accès à la piste 6HXOVOHV2I¿FLHOVSUpYXVGDQVO¶RUJDQLJUDPPHGX5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQDXURQWOHGURLWG¶DFFpGHU jODSLVWH 2.11 - Access to the track 2QO\WKH2I¿FLDOVSURYLGHGIRURQWKH2I¿FLDOV¶OLVWLQWKH Supplementary Regulations of the Competition will have access to the track. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS /HVUHSUpVHQWDQWVGHODSUHVVHQHSRXUURQWDFFpGHUjOD SLVWHTXHV¶LOVHQRQWIDLWODGHPDQGHH[SUHVVHDXSUqVGH O¶2UJDQLVDWHXUHWTX¶LOVHQRQWREWHQXO¶DXWRULVDWLRQ,OOHXU IDXGUDHQRXWUHUHVSHFWHUOHVFRQVLJQHVGHVpFXULWpGLFWpHV SDUOHV2I¿FLHOV Representatives of the press may be given access to the track only if they have expressly asked the Organiser to do so and if the authorisation has been granted to them. They must also respect any safety instructions given by WKH2I¿FLDOV 2.12 - Carburant /HFDUEXUDQWXWLOLVpGHYUDrWUHFRQIRUPHDX[SUHVFULSWLRQV GX5qJOHPHQW7HFKQLTXH$UWLFOHGHV3UHVFULSWLRQV *pQpUDOHVGX5qJOHPHQW7HFKQLTXH 2.12 - Fuel The fuel used must comply with the prescriptions of the Technical Regulations (Article 2.21 of the Technical Regulations General Prescriptions). 2.13 - Parc Fermé $6HXOVOHV2I¿FLHOVFKDUJpVGHVFRQWU{OHVSHXYHQWSpQpWUHUGDQVOH3DUF)HUPp$XFXQHLQWHUYHQWLRQGHTXHOTXH QDWXUHTXHFHVRLWQHSHXW\rWUHHIIHFWXpHVDQVO¶DXWRULVDWLRQGHFHV2I¿FLHOV 2.13 - Parc Fermé $2QO\WKRVH2I¿FLDOVFKDUJHGZLWKWKHFKHFNVPD\ enter the Parc Fermé. No intervention whatsoever may be carried out therein without the authorisation of these 2I¿FLDOV %'qVSUpVHQWDWLRQGXGUDSHDXjGDPLHU$UULYpHOD UpJOHPHQWDWLRQGX3DUF)HUPpV¶DSSOLTXHUDjOD]RQHFRPSULVHHQWUHOD/LJQHG¶$UULYpHHWO¶HQWUpHGX3DUF)HUPp %$VVRRQDVWKHFKHTXHUHGÀDJLVGLVSOD\HG)LQLVKWKH Parc Fermé regulations will apply for the area between the Finish Line and the entrance to the Parc Fermé. &/H3DUF)HUPpGHYUDrWUHVXI¿VDPPHQWJUDQGHWSURWpJpSRXUDVVXUHUTX¶DXFXQHSHUVRQQHQRQDXWRULVpHQH SXLVVH\DFFpGHU C. The Parc Fermé shall be large and protected enough to ensure that no unauthorised person may have access to it. 2.14 - Sécurité générale $,OHVWVWULFWHPHQWLQWHUGLWDX[3LORWHVGHFRQGXLUHOHXU NDUWGDQVODGLUHFWLRQRSSRVpHjFHOOHGHODFRXUVHjPRLQV TXHFHODQHVRLWVWULFWHPHQWQpFHVVDLUHSRXUGpJDJHUOH NDUWG¶XQHSRVLWLRQGDQJHUHXVH 2.14 - General safety A. It is strictly forbidden for Drivers to drive their karts in a direction opposite that of the race, unless this is strictly necessary to remove the kart from a dangerous situation. %3HQGDQWOHV(VVDLV/LEUHVVXLYDQWODUpJOHPHQWDWLRQ GHVFKDPSLRQQDWVFRQFHUQpVOHV(VVDLV4XDOL¿FDWLIVOHV 0DQFKHV4XDOL¿FDWLYHVHWOHVFRXUVHVGHODSKDVH¿QDOH OHV3LORWHVQHSHXYHQWXWLOLVHUTXHODSLVWHHWGRLYHQWj WRXWPRPHQWREVHUYHUOHVGLVSRVLWLRQVGX&RGHUHODWLYHV DXSLORWDJHVXUFLUFXLW/HFLUFXLWHVWGp¿QLSDUOHVOLJQHV EODQFKHVGpOLPLWDQWODSLVWHGHVGHX[F{WpV/HV3LORWHV VRQWDXWRULVpVjHPSUXQWHUWRXWHODODUJHXUGHODSLVWH HQWUHFHVOLJQHV6LOHVTXDWUHURXHVG¶XQNDUWVHWURXYHQW jO¶H[WpULHXUGHFHVOLJQHVOHNDUWHVWFRQVLGpUpFRPPH étant sorti de la piste. %'XULQJ)UHH3UDFWLFHDFFRUGLQJWRWKHUHJXODWLRQVRI the championships concerned), Qualifying Practice, the 4XDOLI\LQJ+HDWVDQGWKHUDFHVRIWKH¿QDOSKDVH'ULYHUV may use the track only and must at all times observe the dispositions of the Code relating to driving on circuits. The FLUFXLWLVGH¿QHGE\WKHZKLWHOLQHVRQERWKVLGHVRIWKH track. Drivers are allowed to use the whole width of the track between these lines. If the four wheels of a kart are outside these lines, the kart is considered as having left the track. &3HQGDQWOHV(VVDLV/LEUHVVXLYDQWODUpJOHPHQWDWLRQ GHVFKDPSLRQQDWVFRQFHUQpVOHV(VVDLV4XDOL¿FDWLIVOHV 0DQFKHV4XDOL¿FDWLYHVHWOHVFRXUVHVGHODSKDVH¿QDOH XQNDUWTXLV¶DUUrWHGRLWrWUHGpJDJpGHODSLVWHOHSOXV UDSLGHPHQWSRVVLEOHD¿QTXHVDSUpVHQFHQHFRQVWLWXH SDVXQGDQJHURXQHJrQHSDVOHVDXWUHV3LORWHV6LOH 3LORWHHVWGDQVO¶LPSRVVLELOLWpGHGpJDJHUOHNDUWG¶XQH SRVLWLRQGDQJHUHXVHHQOHFRQGXLVDQWLOHVWGXGHYRLUGHV &RPPLVVDLUHVGH3LVWHGHOXLSUrWHUDVVLVWDQFHWRXWHIRLVVLOHNDUWUHGpPDUUHJUkFHjXQHWHOOHDVVLVWDQFHLO VHUDH[FOXGXFODVVHPHQWGHV(VVDLV4XDOL¿FDWLIVRXGH ODFRXUVHDXFRXUVGHVTXHOVFHWWHDVVLVWDQFHDXUDpWp IRXUQLH6DXIUDLVRQPpGLFDOHRXGHVpFXULWpOH3LORWHGRLW REOLJDWRLUHPHQWUHVWHUjSUR[LPLWpGHVRQNDUWMXVTX¶jOD ¿QGHV(VVDLV/LEUHVGHV(VVDLV4XDOL¿FDWLIVGHOD0DQFKH 4XDOL¿FDWLYHRXGHVFRXUVHVGHODSKDVH¿QDOH 'DQVOHFDVG¶XQHVpDQFHG¶(VVDLVFRXUXHHQGHX[SDUWLHV VpSDUpHVSDUXQLQWHUYDOOHWRXVOHVNDUWVDEDQGRQQpVVXU OHFLUFXLWORUVGHODSUHPLqUHSDUWLHGRLYHQWrWUHUDSSRUWpV C. During Free Practice (according to the regulations of the championships concerned), Qualifying Practice, the QuaOLI\LQJ+HDWVDQGWKHUDFHVRIWKH¿QDOSKDVHDNDUWWKDW stops must be removed from the track as rapidly as possible in order for its presence not to constitute a danger or be an impediment for other Drivers. If the Driver is unable to remove the kart from a dangerous position by driving it, it is the marshals’ duty to help him ; however, if the kart restarts as a result of such help, it will be excluded from WKHFODVVL¿FDWLRQRIWKH4XDOLI\LQJ3UDFWLFHRUWKHUDFHLQ which this help was provided. Except for medical or safety reasons, the Driver must stay close to his kart until the end of Free Practice, Qualifying Practice, the Qualifying +HDWRUWKHUDFHVRIWKH¿QDOSKDVH In the case of a Practice session run over two parts separated by an interval, all karts abandoned on the circuit GXULQJWKH¿UVWSDUWPXVWEHWDNHQEDFNWRWKH6HUYLFLQJ PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS DX3DUFG¶$VVLVWDQFHSHQGDQWO¶LQWHUYDOOHHWSHXYHQWSUHQGUHSDUWjODGHX[LqPHSDUWLHGHV(VVDLV Park during the interval and may participate in the second part of Practice. '7RXWHUpSDUDWLRQjO¶DLGHG¶RXWLOODJHHVWLQWHUGLWHHQ GHKRUVGHOD=RQHGH5pSDUDWLRQV,OHVWLQWHUGLWG¶HPEDUTXHUjERUGGXNDUWWRXWRXWLOODJHHWRXWRXWHVSLqFHVGH UHFKDQJH/H3LORWHQHSRXUUDUHFHYRLUXQHDVVLVWDQFHTXH dans la Zone de Réparations déterminée par le Règlement 3DUWLFXOLHURXORUVGX%ULH¿QJ D. Any repairs with tools are banned outside the Repairs Area. It is forbidden to take any tools and/or spare parts on board the kart. The Driver can receive help only in the Repairs Area determined by the Supplementary RegulaWLRQVRUGXULQJWKH%ULH¿QJ ('DQVOHFDVROHVUDYLWDLOOHPHQWVHQFDUEXUDQWVRQW DXWRULVpVLOVQHSHXYHQWrWUHSUDWLTXpVTXHGDQVXQH]RQH SUpYXHjFHWHIIHW E. If refuelling is authorised, it may be carried out only in an area provided for for this purpose. )6DXIGDQVOHVFDVH[SUHVVpPHQWSUpYXVSDUOH5qJOHPHQWRXSDUOH&RGHSHUVRQQHjO¶H[FHSWLRQGX3LORWH Q¶HVWDXWRULVpjWRXFKHUXQNDUWDUUrWpjPRLQVTX¶LOQHVH WURXYHGDQVOD=RQHGH5pSDUDWLRQV F. Except in cases expressly provided for by the Regulations or by the Code, no one except the Driver is authorised to touch a stopped kart unless it is in the Repairs Area. *4XDQGODSLVWHHVWIHUPpHSDUOD'LUHFWLRQGH&RXUVH SHQGDQWHWDSUqVOHV(VVDLVHWDSUqVO¶DUULYpHMXVTX¶j FHTXHWRXVOHVNDUWVFRQFHUQpVPRELOHVRXQRQVRLHQW DUULYpVDX3DUFG¶$VVLVWDQFH©ArrivéeªRXDX3DUF)HUPp SHUVRQQHQ¶HVWDXWRULVpjDFFpGHUjODSLVWHH[FHSWpOHV &RPPLVVDLUHVGH3LVWHGDQVO¶H[pFXWLRQGHOHXUPLVVLRQHW OH3LORWHORUVTX¶LOFRQGXLW G. When the track is closed by the Race Direction during DQGDIWHU3UDFWLFHDQGDIWHUWKH¿QLVKXQWLODOOFRQFHUQHG karts, whether they are mobile or not, have arrived at the « Finish» Servicing Park or at the Parc Fermé, no one is allowed to accede to the track, with the exception of marshals carrying out their duties and of Drivers when they are driving. +3HQGDQWOHV(VVDLV/LEUHVVXLYDQWODUpJOHPHQWDWLRQ GHVFKDPSLRQQDWVFRQFHUQpVOHV(VVDLV4XDOL¿FDWLIVOHV 0DQFKHV4XDOL¿FDWLYHVHWOHVFRXUVHVGHODSKDVH¿QDOH OHNDUWQHSHXWrWUHUHPLVHQPDUFKHTXHSDUOH3LORWH OXLPrPHVDXIV¶LOUHSDUWGHOD=RQHGH5pSDUDWLRQV/H 3LORWHQHSRXUUDUHFHYRLUDXFXQHDLGHH[WpULHXUHVXUOD SLVWHSHQGDQWOHGpURXOHPHQWG¶XQH&RPSpWLWLRQH[FHSWp HQ=RQHGH5pSDUDWLRQVTX¶LOQHSRXUUDUHJDJQHUTXHSDU VHVSURSUHVPR\HQV ,OHVWLQWHUGLWDX[SRXVVHXUVG¶DLGHUOH3LORWHDSUqVOH IUDQFKLVVHPHQWGHODOLJQHWUDFpHjODVRUWLHGHOD3Up Grille. H. During Free Practice (according to the regulations of the championships concerned), Qualifying Practice, the 4XDOLI\LQJ+HDWVDQGWKHUDFHVRIWKH¿QDOSKDVHWKHNDUW may be restarted only by the Driver himself, except if he restarts from the Repairs Area. The Driver may not receive any outside help on the track during the running of a Competition, except in the Repairs Area, which he may reach only by his own means. ,8QHOLPLWDWLRQGHYLWHVVHSHXWrWUHLPSRVpHVXUODYRLH GHVVWDQGVHWOD=RQHGH5pSDUDWLRQVSHQGDQWOHV(VVDLV OHVFRXUVHVHWOHV7RXUVGH)RUPDWLRQ7RXW3LORWHGpSDVVDQWFHWWHOLPLWDWLRQVHYHUUDLQÀLJHUXQHSpQDOLWpSUpYXH GDQVOH5qJOHPHQWRXOH&RGH I. A speed limit may be imposed in the pit lane and in the Repairs Area during Practice, races and the Formation Laps. Any Driver braking this speed limit will be imposed a penalty provided for in the Regulations or the Code. -6LXQ3LORWHHVWFRQIURQWpjGHVSUREOqPHVPpFDQLTXHV SHQGDQWOHV(VVDLVOHV0DQFKHV4XDOL¿FDWLYHVRXOHV &RXUVHVGHODSKDVH¿QDOHLOGRLWpYDFXHUODSLVWHGqVTXH SRVVLEOHSRXUGHVUDLVRQVGHVpFXULWp J. If a Driver is faced with mechanical problems during 3UDFWLFHWKH4XDOLI\LQJ+HDWVRUWKH5DFHVRIWKH¿QDO phase, he must evacuate the track as soon as possible for safety reasons. .6LXQ3LORWHHVWLPSOLTXpGDQVXQHFROOLVLRQLOQHGRLW SDVTXLWWHUOHFLUFXLWVDQVO¶DFFRUGGHV&RPPLVVDLUHV 6SRUWLIV K. If a Driver is involved in a collision, he must not leave the circuit without the Stewards’ agreement. /$XFXQ3LORWHQHSRXUUDTXLWWHUOD=RQHGH5pSDUDWLRQV VDQV\DYRLUpWpLQYLWpSDUOHV&RPPLVVDLUHVGH3LVWH L. No Driver may leave the Repairs Area without having been invited to do so by Marshals. 0/HVLQVWUXFWLRQVRI¿FLHOOHVVHURQWWUDQVPLVHVDX[3LORWHV DXPR\HQGHVVLJQDX[SUpYXVSDUOH&RGH/HVFRQFXUUHQWV QHGRLYHQWSDVXWLOLVHUGHGUDSHDX[VHPEODEOHVjFHX[FL GHTXHOTXHPDQLqUHTXHFHVRLW 02I¿FLDOLQVWUXFWLRQVZLOOEHWUDQVPLWWHGWRWKH'ULYHUVE\ means of the signals provided for in the Code. CompetiWRUVPXVWQRWXVHÀDJVVLPLODUWRWKHVHRQHVLQDQ\ZD\ whatsoever. Pushers are not allowed to help Drivers once they have crossed the line drawn at the exit of the Assembly Area. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS 17RXW3LORWHD\DQWO¶LQWHQWLRQGHTXLWWHUODSLVWHGH UHQWUHUDX3DUFG¶$VVLVWDQFHRXGHV¶DUUrWHUHQ=RQHGH 5pSDUDWLRQVHQPDQLIHVWHUDO¶LQWHQWLRQHQWHPSVXWLOHHW V¶DVVXUHUDTX¶LOSHXWOHIDLUHVDQVGDQJHU N. Any Driver who intends to leave the track, to return to the Servicing Park or to stop in the Repairs Area shall demonstrate his intention in due time and shall ensure that he may do so safely. 2(QFRXUVGH&RPSpWLWLRQHWVXURUGUHGX'LUHFWHXUGH &RXUVHRXGX'LUHFWHXUG¶eSUHXYHOH3LORWHTXLVHWURXYHUD HQLQIUDFWLRQYLVjYLVGX5qJOHPHQW7HFKQLTXHVDXIDX GHUQLHUWRXUGHYUDV¶DUUrWHUHQ=RQHGH5pSDUDWLRQVHW UHPpGLHUjFHWWHQRQFRQIRUPLWpDYDQWGHUHSUHQGUHOD piste. O. During the Competition and at the order of the Clerk of the Course or the Race Director, a Driver who breaches WKH7HFKQLFDO5HJXODWLRQVH[FHSWGXULQJWKH¿QDOODS must stop in the Repairs Area and remedy the breach before rejoining the track. 3/RUVTX¶LOVSDUWLFLSHQWDX[(VVDLV/LEUHVVXLYDQWOD UpJOHPHQWDWLRQGHVFKDPSLRQQDWVFRQFHUQpVRX(VVDLV 4XDOL¿FDWLIVDX[0DQFKHV4XDOL¿FDWLYHVRXDX[&RXUVHV GHODSKDVH¿QDOHOHV3LORWHVGRLYHQWHQWRXWHVFLUFRQVWDQFHVSRUWHUO¶pTXLSHPHQWFRPSOHWGp¿QLjO¶$UWLFOHGX 5qJOHPHQW7HFKQLTXH P. When they participate in Free Practice (according to the regulations of the championships concerned) or Qualifying 3UDFWLFHLQWKH4XDOLI\LQJ+HDWVRUWKH5DFHVRIWKH¿QDO phase, Drivers must at all times wear the full equipment GH¿QHGXQGHU$UWLFOHRIWKH7HFKQLFDO5HJXODWLRQV 4,OHVWLQWHUGLWGHFLUFXOHUGDQVOH3DGGRFNDYHFGHV PRWRVVFRRWHUVRXDXWUHVHQJLQVPRWRULVpV 'pPDUUHUURGHUFKDXIIHURXWHVWHUOHVPRWHXUVGHNDUWV dans le Paddock doit être réglementé. Ces opérations ne SRXUURQWHQDXFXQFDVVHSUDWLTXHUGDQVOHVDOOpHVHOOHV QHSRXUURQWO¶rWUHTXHGDQVXQH]RQHVpFXULVpHGDQVOH SpULPqWUHGHO¶HPSODFHPHQWDOORXpDX&RQFXUUHQWFRQFHUQp RXjO¶LQWpULHXUG¶XQHQFORVSUpYXjFHWHIIHWSDUO¶2UJDQLVDWHXU/¶KRUDLUHSRXUUDSDUDLOOHXUVSUpYRLUGHVSpULRGHVGH VLOHQFHjUHVSHFWHULPSpUDWLYHPHQW Q. It is forbidden to circulate with motorbikes, scooters or any other motorised devices in the Paddock. The starting up, running in, warming up or testing of kart engines in the Paddock must be controlled. These operations can under no circumstances be carried out in the Paddock lanes; they can be carried out only in a secured area within the perimeter of the unit allocated to the Entrant concerned, or inside an enclosure provided by the Organiser for this purpose. Additionally, the time schedule can provide for periods of silence to be imperatively respected. 5/¶2UJDQLVDWHXUV¶HQJDJHjDYRLUVXUODSLVWHGHSXLVOH GpEXWGHV(VVDLV/LEUHVMXVTX¶DXWHUPHGHOD&RPSpWLWLRQ WRXWOHGLVSRVLWLIGHVpFXULWpSUpYXSRXUOHVPDQLIHVWDWLRQV SDUOH5qJOHPHQWGHV&LUFXLWV3DUWLH R. The Organiser undertakes to have on the track all safety devices provided for for meetings in the Circuit Regulations, Part 2, from the beginning of Free Practice until the end of the Competition. S. En cas de «&RXUVHSDUWHPSVGHSOXLH» (condition VLJQDOpHSDUSDQQHDXSDUOD'LUHFWLRQGH&RXUVHRXOH 'LUHFWHXUG¶eSUHXYHOHFKRL[GHVSQHXVHVWODLVVpj O¶DSSUpFLDWLRQGHV3LORWHVOH'LUHFWHXUG¶eSUHXYHRXGH &RXUVHVHUpVHUYDQWOHGURLWGHUHFRXULUDXGUDSHDXQRLU V¶LOMXJHXQ3LORWHpTXLSpGHSQHXVLQDGpTXDWVWURSOHQWHW GDQJHUHX[SRXUOHVDXWUHV3LORWHV 'HIDLWO¶XWLOLVDWLRQGHSQHXV©VOLFNVªHVWREOLJDWRLUHGDQV WRXVOHVDXWUHVFDVGH¿JXUH S. In the case of a « wet race » (conditions signalled by means of a panel by the Race Direction or the Race Director), the choice of tyres will be left to the appreciation of the Drivers, the Race Director or Clerk of the Course UHVHUYLQJWKHULJKWWRXVHWKHEODFNÀDJLIKHGHHPVWKDWD 'ULYHU¶VNDUWLV¿WWHGZLWKWKHZURQJVHWRIW\UHVDQGWKDW the Driver is too slow and dangerous for other Drivers. The use of «slick» tyres is therefore mandatory in any other case. 6LJQL¿FDWLRQGHVGUDSHDX[ 6LJQDX[SDUGUDSHDX[GHYDQWrWUHXWLOLVpVSDUOH'LUHFWHXUG¶eSUHXYHOH'LUHFWHXUGH&RXUVHRXVRQDGMRLQWVXU la ligne de départ : 6LJQL¿FDWLRQRIÀDJV * Flag signals to be used by the Race Director, the Clerk of the Course or his deputy at the start line: D'UDSHDXQDWLRQDO &HGUDSHDXHVWQRUPDOHPHQWXWLOLVpSRXUGRQQHUOHGpSDUW GHODFRXUVH/HVLJQDOGHGpSDUWGRLWrWUHGRQQpHQDEDLVVDQWOHGUDSHDXTXLHQFHTXLFRQFHUQHOHV&RPSpWLWLRQV DYHFGpSDUWDUUrWpQHGRLWSDVrWUHOHYpDXGHVVXVGH ODWrWHDYDQWTXHWRXVOHVNDUWVQHVRLHQWjO¶DUUrWHWHQ DXFXQFDVSHQGDQWSOXVGHVHFRQGHV&HGUDSHDXQH VHUDXWLOLVpTXHGDQVFHUWDLQHVFLUFRQVWDQFHVSDUH[HPSOH DXFDVRODVLJQDOLVDWLRQOXPLQHXVHQHIRQFWLRQQHUDLWSOXV HWSRXUOHV(VVDLV4XDOL¿FDWLIV D1DWLRQDOÀDJ 7KLVÀDJLVQRUPDOO\XVHGWRVWDUWWKHUDFH7KHVWDUWLQJ signal must be given by lowering the signal which, for standing start Competitions, must not be raised above the head until all karts are stationary and in no case for more WKDQVHFRQGV7KLVÀDJVKDOORQO\EHXVHGLQFHUWDLQ circumstances (e.g. in the case where the light signals no longer function) and for Qualifying Practice. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS E'UDSHDXURXJH 'RLWrWUHDJLWpVXUODOLJQHGHGpSDUWTXDQGLODXUDpWp GpFLGpG¶DUUrWHUXQHVpDQFHG¶HVVDLVRXODFRXUVH /HGUDSHDXURXJHSHXWrWUHXWLOLVpSDUOH'LUHFWHXUGH &RXUVHRXVRQUHSUpVHQWDQWSRXUODIHUPHWXUHGHODSLVWH E5HGÀDJ 7KLVÀDJPXVWEHZDYHGDWWKHVWDUWOLQHZKHQLWKDVEHHQ GHFLGHGWRVWRSDSUDFWLFHVHVVLRQRUWKHUDFH7KHUHGÀDJ may also be used by the Clerk of the Course or his deputy to close the circuit. F'UDSHDXjGDPLHUQRLUHWEODQF 'RLWrWUHDJLWp,OVLJQL¿HOD¿QG¶XQHVpDQFHG¶HVVDLVRX G¶XQHFRXUVH F%ODFNDQGZKLWHFKHTXHUHGÀDJ 7KLVÀDJPXVWEHZDYHG,WVLJQL¿HVWKHHQGRIDSUDFWLFH session or a race. G'UDSHDXQRLU 'RLWrWUHXWLOLVpSRXULQIRUPHUOH3LORWHFRQFHUQpTX¶LOGRLW V¶DUUrWHUODSURFKDLQHIRLVTX¶LOV¶DSSURFKHUDGHO¶HQWUpH GX3DUF)HUPp6LSRXUXQPRWLITXHOFRQTXHOH3LORWHQH UHVSHFWHSDVFHWWHLQVWUXFWLRQFHGUDSHDXQHGRLWSDVrWUH SUpVHQWpSHQGDQWSOXVGHTXDWUHWRXUVFRQVpFXWLIV G%ODFNÀDJ 7KLVÀDJVKRXOGEHXVHGWRLQIRUPWKH'ULYHUFRQFHUQHG that he must stop at his pit or at the place designated in the Supplementary or Championship Regulations on the next approach to the Parc Fermé entrance. If a Driver fails WRFRPSO\IRUDQ\UHDVRQWKLVÀDJVKRXOGQRWEHVKRZQIRU more than four consecutive laps. 7KHGHFLVLRQWRVKRZWKLVÀDJUHVWVVROHO\ZLWKWKH Stewards of the meeting. The Entrant concerned will immediately be informed of the decision. /DGpFLVLRQGHSUpVHQWHUFHGUDSHDXHVWGXUHVVRUWH[FOXVLI GHV&RPPLVVDLUHV6SRUWLIVHWOH&RQFXUUHQWFRQFHUQpVHUD LPPpGLDWHPHQWLQIRUPpGHODGpFLVLRQ H'UDSHDXQRLUjGLVTXHRUDQJHGHFPGHGLDPqWUH 'RLWrWUHXWLOLVpSRXULQIRUPHUOH3LORWHFRQFHUQpTXHVRQ NDUWDGHVHQQXLVPpFDQLTXHVVXVFHSWLEOHVGHFRQVWLWXHU XQGDQJHUSRXUOXLPrPHRXSRXUOHVDXWUHV3LORWHVHWTX¶LO GRLWV¶DUUrWHUGDQVO¶DLUHGHUpSDUDWLRQDXSDVVDJHVXLYDQW /RUVTXHOHVSUREOqPHVPpFDQLTXHVRQWpWpUpVROXVOHNDUW SHXWUHJDJQHUODFRXUVH H%ODFNÀDJZLWKDQRUDQJHGLVFFPLQGLDPHWHU 7KLVÀDJVKRXOGEHXVHGWRLQIRUPWKH'ULYHUFRQFHUQHG that his kart has mechanical problems likely to endanger himself or others and means that the he must stop at the assembly area on the next lap. When the mechanical proEOHPVKDYHEHHQUHFWL¿HGWKHNDUWPD\UHMRLQWKHUDFH I'UDSHDXQRLUHWEODQFGLYLVpVXLYDQWGLDJRQDOH 1HGRLWrWUHSUpVHQWpTX¶XQHIRLV,OFRQVWLWXHXQDYHUWLVVHPHQWLQGLTXDQWDX3LORWHFRQFHUQpTX¶LODpWpVLJQDOpSRXU FRQGXLWHQRQVSRUWLYH I%ODFNDQGZKLWHÀDJGLYLGHGGLDJRQDOO\ 7KLVÀDJVKRXOGEHVKRZQRQO\RQFHDQGLVDZDUQLQJWR the Driver concerned that he has been reported for unsportsmanlike behaviour. /HVWURLVGUDSHDX[FLGHVVXVGHIGHYUDLHQWrWUH SUpVHQWpVLPPRELOHVHWDFFRPSDJQpVG¶XQSDQQHDXQRLU SRUWDQWXQQXPpUREODQFTXLGRLWrWUHSUpVHQWpDX3LORWH GXNDUWTXLSRUWHOHQXPpURDI¿FKp &HVGUDSHDX[SRXUURQWpJDOHPHQWrWUHSUpVHQWpVj G¶DXWUHVHQGURLWVTXHODOLJQHGHGpSDUWVLOH'LUHFWHXU G¶eSUHXYHRXGH&RXUVHOHMXJHQpFHVVDLUH 1RUPDOHPHQWODGpFLVLRQGHSUpVHQWHUOHVGHX[GHUQLHUV GUDSHDX[HIHVWGXUHVVRUWGX'LUHFWHXUG¶eSUHXYHRX GH&RXUVHFHSHQGDQWHOOHSRXUUDrWUHSULVHVXUGHPDQGH GHV&RPPLVVDLUHV6SRUWLIVSRXUDSSOLTXHUXQHVDQFWLRQ sportive. 7KHVHODVWWKUHHÀDJVLQGHIVKRXOGEHVKRZQ motionless and accompanied by a black board with a white number which should be shown to the Driver of whose kart the number is displayed. 7KHVHÀDJVPD\DOVREHGLVSOD\HGDWSODFHVRWKHUWKDQ the start line should the Race Director or the Clerk of the Course deem this necessary. 1RUPDOO\WKHGHFLVLRQWRVKRZWKHODVWWZRÀDJVLQHI rests with the Race Director or the Clerk of the Course; however, it may be taken on request of the Stewards of the meeting in order to impose a sporting sanction. J'UDSHDXEOHXHWURXJHGRXEOHGLDJRQDOHDYHF QXPpUR $UUrWSRXUXQ3LORWHDYDQWTX¶LOQHVRLWGRXEOpRXDXVVL TXDQGLODpWpGRXEOp &HGUDSHDXQHSHXWrWUHXWLOLVpTXHVLOH5qJOHPHQW6SRUWLI GX&KDPSLRQQDWGHOD&RXSHRXGX7URSKpHRXOH5qJOHPHQW3DUWLFXOLHUGHOD&RPSpWLWLRQOHSUpYRLW J%OXHDQGUHGÀDJGRXEOHGLDJRQDOZLWKQXPEHU 6LJQDOLVDWLRQSDUGUDSHDX[jXWLOLVHUDX[SRVWHVGH VXUYHLOODQFH * Flag signals to be used at observation posts: K'UDSHDXMDXQH &¶HVWXQVLJQDOGHGDQJHUHWLOGRLWrWUHSUpVHQWpDX[3LORWHVGHGHX[IDoRQVDYHFOHVVLJQL¿FDWLRQVVXLYDQWHV K<HOORZÀDJ This is a signal of danger and should be shown to Drivers in two ways with the following meanings: The Driver concerned must stop before being lapped or also when he has been lapped. 7KLVÀDJPD\RQO\EHXVHGLILWLVSURYLGHGIRULQWKH Championship, Cup or Trophy Sporting Regulations or in the Supplementary Regulations of the Competition. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS XQVHXOGUDSHDXDJLWpUpGXLVH]YRWUHYLWHVVHQHGRXEOH] SDVHWVR\H]SUrWjFKDQJHUGHGLUHFWLRQ,O\DXQGDQJHU VXUOHERUGRXVXUXQHSDUWLHGHODSLVWH GHX[GUDSHDX[DJLWpVUpGXLVH]YRWUHYLWHVVHQHGRXEOH] SDVHWVR\H]SUrWjFKDQJHUGHGLUHFWLRQRXGHYRXV DUUrWHU8QGDQJHUREVWUXHWRWDOHPHQWRXSDUWLHOOHPHQWOD piste. - single waved: reduce your speed, do not overtake and be prepared to change direction. There is a hazard on the edge or on part of the track. - double waved: reduce your speed, do not overtake and be prepared to change direction or stop. There is a hazard wholly or partly blocking the track. 1RUPDOHPHQWOHVGUDSHDX[MDXQHVQHGHYUDLHQWrWUHPRQWUpVTX¶DXSRVWHGHVFRPPLVVDLUHVGHFRXUVHVHWURXYDQW LPPpGLDWHPHQWDYDQWO¶HQGURLWGDQJHUHX[ /HVGpSDVVHPHQWVVRQWLQWHUGLWVHQWUHOHSUHPLHUGUDSHDX MDXQHHWOHGUDSHDXYHUWGpSOR\pDSUqVO¶LQFLGHQW <HOORZÀDJVVKRXOGQRUPDOO\EHVKRZQRQO\DWWKHPDUVhals’ post immediately preceding the hazard. 2YHUWDNLQJLVQRWSHUPLWWHGEHWZHHQWKH¿UVW\HOORZÀDJ DQGWKHJUHHQÀDJGLVSOD\HGDIWHUWKHLQFLGHQW L'UDSHDXMDXQHUD\pGHURXJH 'RLWrWUHSUpVHQWpLPPRELOHDX[3LORWHVSRXUOHVDYHUWLU G¶XQHGpWpULRUDWLRQGHO¶DGKpUHQFHGXHjODSUpVHQFH G¶KXLOHRXG¶HDXVXUODSLVWHGDQVOD]RQHHQDYDOGX GUDSHDX &HGUDSHDXGRLWrWUHSUpVHQWpSHQGDQWDXPRLQVWRXUVj PRLQVTXHOHUHYrWHPHQWQHUHGHYLHQQHQRUPDODXSDUDYDQWLOQ¶\DSDVOLHXGDQVOHVHFWHXUHQDYDOGHFHOXLR OHGUDSHDXHVWPRQWUpGHSUpVHQWHUXQGUDSHDXYHUW L<HOORZÀDJZLWKUHGVWULSHV 7KLVÀDJVKRXOGEHVKRZQPRWLRQOHVVWRLQIRUP'ULYHUV that there is a deterioration of adhesion due to oil or water RQWKHWUDFNLQWKHDUHDEH\RQGWKHÀDJ M'UDSHDXEOHX 'RLWQRUPDOHPHQWrWUHDJLWpSRXULQGLTXHUjXQ3LORWHTX¶LO HVWVXUOHSRLQWG¶rWUHGpSDVVp M%OXHÀDJ 7KLVÀDJVKRXOGQRUPDOO\EHZDYHGDVDQLQGLFDWLRQWRD Driver that he is about to be overtaken. N'UDSHDXEODQF 'RLWrWUHDJLWp,OHVWXWLOLVpSRXULQGLTXHUDX3LORWHTX¶LO \DXQYpKLFXOHEHDXFRXSSOXVOHQWVXUODSRUWLRQGHSLVWH FRQWU{OpHSDUFHSRVWHGHVXUYHLOODQFH N:KLWHÀDJ 7KLVÀDJVKRXOGEHZDYHGDQGLVXVHGWRLQGLFDWHWRWKH Driver that there is a much slower vehicle on the sector of WUDFNFRQWUROOHGE\WKDWÀDJSRLQW O'UDSHDXYHUW 'RLWrWUHXWLOLVpSRXULQGLTXHUTXHODSLVWHHVWGpJDJpHHW GRLWrWUHDJLWpDXSRVWHGHFRPPLVVDLUHVLPPpGLDWHPHQW DSUqVO¶LQFLGHQWD\DQWQpFHVVLWpO¶XWLOLVDWLRQG¶XQRXGH SOXVLHXUVGUDSHDX[MDXQHV ,OSRXUUDpJDOHPHQWLQGLTXHUOHGpSDUWG¶XQWRXUGH FKDXIIHRXOHGpEXWG¶XQHVpDQFHG¶HVVDLVVLOH'LUHFWHXU G¶eSUHXYHRXGH&RXUVHOHMXJHQpFHVVDLUH O*UHHQÀDJ 7KLVÀDJVKRXOGEHXVHGWRLQGLFDWHWKDWWKHWUDFNLVFOHDU and should be waved at the observation post immediately after the incident that necessitated the use of one or more \HOORZÀDJV It may also be used, if deemed necessary by the Race Director or the Clerk of the Course, to signal the start of a warm-up lap or the start of a practice session. ,QVWUXFWLRQVHWFRPPXQLFDWLRQVDX[ Concurrents 7RXVFODVVHPHQWVHWUpVXOWDWVGHVHVVDLVGHV0DQFKHV 4XDOL¿FDWLYHVHWGHVFRXUVHVGHODSKDVH¿QDOHDLQVLTXH WRXWHVGpFLVLRQVGHV2I¿FLHOVGHOD&RPSpWLWLRQVHURQW DI¿FKpVVXUOHWDEOHDXRI¿FLHOG¶DI¿FKDJH 2.16 - Instructions and communications to Entrants 2.17 - Essais $/DGLVFLSOLQHHQYLJXHXUGDQVOHV3DUFVG¶$VVLVWDQFHHW VXUODSLVWHDLQVLTXHOHVPHVXUHVGHVpFXULWpVHURQWOHV PrPHVSRXUWRXWHVOHVVpDQFHVG¶HVVDLVTXHFHOOHVHQ YLJXHXUSHQGDQWOHV0DQFKHV4XDOL¿FDWLYHVHWOHVFRXUVHV GHODSKDVH¿QDOH 2.17 - Practice A. The discipline applied in the Servicing Parks and on the track as well as the safety measures will be the same for all practice sessions as those applied for Qualifying Heats DQGWKHUDFHVRIWKH¿QDOSKDVH %$XFXQ3LORWHQHSRXUUDSUHQGUHOHGpSDUWG¶XQH&RXUVH VDQVDYRLUSDUWLFLSpjDXPRLQVXQHVpDQFHG¶(VVDLV/LEUHV &/H'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYH SHXWLQWHUURPSUHOHV(VVDLVDXVVLVRXYHQWHWSRXUDXVVL ORQJWHPSVTX¶LOO¶HVWLPHQpFHVVDLUHSRXUGpJDJHUODSLVWH RXSHUPHWWUHO¶HQOqYHPHQWG¶XQNDUW(QRXWUHVLGHO¶DYLV %1R'ULYHUPD\WDNHWKHVWDUWRID5DFHZLWKRXWKDYLQJ participated in at least one Free Practice session. C. The Clerk of the Course or the Race Director may interrupt Practice as often and for as long as he deems it necessary for the clearance of the track or the removal of a kart. Further, if, in the Stewards’ opinion, the stop is 7KLVÀDJVKRXOGEHGLVSOD\HGIRUDWOHDVWODSVXQOHVVWKH surface returns to normal beforehand. However, it is not necessary for marshals in the sector beyond the place ZKHUHWKLVÀDJLVEHLQJVKRZQWRVKRZDJUHHQÀDJ $OOFODVVL¿FDWLRQVDQGUHVXOWVRISUDFWLFHWKH4XDOLI\LQJ +HDWVDQGWKHUDFHVRIWKH¿QDOSKDVHDVZHOODVDQ\ GHFLVLRQVRIWKH2I¿FLDOVRIWKH&RPSHWLWLRQZLOOEHSRVWHG RQWKHRI¿FLDOSRVWLQJERDUG PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS GHV&RPPLVVDLUHV6SRUWLIVO¶DUUrWHVWFDXVpGpOLEpUpPHQW SDUXQ3LORWHOHVWHPSVTX¶LODXUDUpDOLVpVGDQVFHWWH VpDQFHSRXUURQWrWUHDQQXOpVHWLOSRXUUDVHYRLUUHIXVHU O¶DXWRULVDWLRQGHSDUWLFLSHUjWRXWHDXWUHVpDQFHG¶(VVDLV 'DQVOHFDVG¶(VVDLV/LEUHVH[FOXVLYHPHQWOH'LUHFWHXU G¶eSUHXYHRXGH&RXUVHDYHFO¶DFFRUGGHV&RPPLVVDLUHV 6SRUWLIVSHXWGpFLGHUGHQHSDVUHSUHQGUHODSpULRGH G¶(VVDLVDSUqVXQHWHOOHLQWHUUXSWLRQ deliberately caused by a Driver, the times he has achieved in that session may be cancelled and he may be refused the authorisation to participate in any other Practice session. In the case of Free Practice only, the Race Director or the Clerk of the Course, with the Stewards’ agreement, may decide not to resume the Practice session after such an interruption. '$XFDVRXQHRXSOXVLHXUVVpDQFHVG¶(VVDLVVHUDLHQW DLQVLLQWHUURPSXHVDXFXQHUpFODPDWLRQUHODWLYHDX[HIIHWV SRVVLEOHVGHFHWWHLQWHUUXSWLRQVXUODTXDOL¿FDWLRQGHV Pilotes ne serait admise. D. Should one or several Practice sessions be interrupted in such manner, no protest relating to the possible effects RIWKLVLQWHUUXSWLRQRQWKHTXDOL¿FDWLRQRI'ULYHUVZRXOGEH accepted. (7RXVOHVWRXUVHIIHFWXpVSHQGDQWOHVVpDQFHVG¶(VVDLV 4XDOL¿FDWLIVVHURQWFKURQRPpWUpVSRXUGpWHUPLQHUODSRVLWLRQGHV3LORWHVDXGpSDUW E. Every lap completed during the Qualifying Practice sessions will be timed to determine the position of Drivers at the start. %ULH¿QJ $'p¿QLWLRQ/H%ULH¿QJGHV&RQFXUUHQWVHW3LORWHVHVW XQHUpXQLRQRUJDQLVpHSDUOH'LUHFWHXUGH&RXUVHRXOH 'LUHFWHXUG¶eSUHXYH SRXUWRXVOHV&RQFXUUHQWVHW3LORWHV HQJDJpVjOD&RPSpWLWLRQ %ULH¿QJ $'H¿QLWLRQ7KH(QWUDQWV¶and'ULYHUV¶%ULH¿QJLVD meeting organised by the Clerk of the Course or the Race Director for all Entrants and Drivers entered in the Competition. %2EMHWGX%ULH¿QJUDSSHOHUDX[&RQFXUUHQWVHW Pilotes OHVSRLQWVVSpFL¿TXHVGX5qJOHPHQW3DUWLFXOLHUFRQFHUQDQW O¶RUJDQLVDWLRQGHOD&RPSpWLWLRQOHXUUDSSHOHUOHVQRWLRQV GHVpFXULWpVRLWJpQpUDOHVVRLWVSpFL¿TXHVDXFLUFXLW XWLOLVpDSSRUWHUWRXWHSUpFLVLRQFRQFHUQDQWO¶LQWHUSUpWDWLRQ GX5qJOHPHQW %$LPRIWKH%ULH¿QJWRUHPLQG(QWUDQWVDQG Drivers RIWKHVSHFL¿FSRLQWVRIWKH6XSSOHPHQWDU\5HJXODWLRQV concerning the organisation of the Competition ; to remind WKHPRIWKHVDIHW\QRWLRQVHLWKHUJHQHUDORUVSHFL¿FWR WKHFLUFXLWXVHGWRJLYHDQ\FODUL¿FDWLRQFRQFHUQLQJWKH interpretation of the Regulations. &/¶KHXUHGX%ULH¿QJHVWPHQWLRQQpHGDQVOHSURJUDPPH GHOD&RPSpWLWLRQ/¶KHXUHHVWFRQVLGpUpHFRPPHFHOOHGX FRPPHQFHPHQWGX%ULH¿QJHWODSRUWHG¶HQWUpHHWO¶DFFqV DX%ULH¿QJVHURQWIHUPpV/DUpXQLRQGHYUDWRXMRXUVVH GpURXOHUDYDQWOHV(VVDLV4XDOL¿FDWLIVRXODSUHPLqUHGHV 0DQFKHV4XDOL¿FDWLYHV 'HVUpXQLRQVVXSSOpPHQWDLUHVSHXYHQWrWUHRUJDQLVpHVVL FHODHVWMXJpQpFHVVDLUH &7KHWLPHRIWKH%ULH¿QJLVPHQWLRQHGLQWKHSURJUDPPH of the Competition. The time is considered as that of the EHJLQQLQJRIWKH%ULH¿QJDQGWKHHQWUDQFHGRRUDQGDFFHVV WRWKH%ULH¿QJZLOOEHFORVHG7KHPHHWLQJVKDOODOZD\VEH KHOGEHIRUH4XDOLI\LQJ3UDFWLFHRUWKH¿UVW4XDOLI\LQJ+HDW '/DSUpVHQFHGHWRXVOHV&RQFXUUHQWVHW3LORWHVFRQFHUQpVHVWREOLJDWRLUHSHQGDQWWRXWHODGXUpHGX%ULH¿QJ VRXVSHLQHGHVDQFWLRQYRLUHG¶XQHSRVVLEOHH[FOXVLRQ GHOD&RPSpWLWLRQ'HX[/LVWHVGH3UpVHQFHGHYURQWrWUH signéesXQHSDUOHV3LORWHVHWO¶DXWUHSDUOHV&RQFXUUHQWV D. The presence of all concerned Entrants and Drivers is PDQGDWRU\WKURXJKRXWWKH%ULH¿QJXQGHUSDLQRIDVDQFtion or even of a possible exclusion from the Competition. Two Attendance Sheets shall be signed, one by Drivers and the other by Entrants. 2.19 - Grille de départ $¬O¶LVVXHGHODGHUQLqUHVpDQFHG¶(VVDLV4XDOL¿FDWLIVOD OLVWHGHV3LORWHVTXDOL¿pVVHUDRI¿FLHOOHPHQWSXEOLpHDLQVL TXHOHVJULOOHVGHGpSDUW 2.19 - Starting grid $$WWKHHQGRIWKH¿QDO4XDOLI\LQJ3UDFWLFHVHVVLRQWKH OLVWRITXDOL¿HG'ULYHUVDVZHOODVWKHVWDUWLQJJULGVZLOOEH RI¿FLDOO\SXEOLVKHG %6HXOVFHV3LORWHVVHURQWDXWRULVpVjSUHQGUHOHGpSDUW GHV0DQFKHV4XDOL¿FDWLYHVHWRXGHODSKDVH¿QDOH %2QO\WKHVH'ULYHUVZLOOEHDOORZHGWRWDNHWKHVWDUWRI WKH4XDOLI\LQJ+HDWVDQGRURIWKH¿QDOSKDVH &7RXW&RQFXUUHQWGRQWOHVNDUWVHVWVRQWGDQV O¶LPSRVVLELOLWpGHSUHQGUHOHGpSDUWSRXUTXHOTXHUDLVRQ TXHFHVRLWRXTXLDGHERQQHVUDLVRQVGHFURLUHTXHVRQ VHVNDUWVQHVHUDVHURQWSDVSUrWVjSUHQGUHOH GpSDUWGRLWHQLQIRUPHUOH5HVSRQVDEOHGHOD3Up*ULOOHTXL DYLVHUDOH'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYH GqVTX¶LOHQDXUDO¶RFFDVLRQ C. Any Entrant whose kart(s) is (are) unable to take the start for any reason whatsoever or who has good reasons to believe that his/her kart(s) will not be ready to take the VWDUWPXVWLQIRUPWKH2I¿FLDOLQFKDUJHRIWKH$VVHPEO\ Area, who will advise the Clerk of the Course or the Race Director as soon as he has the opportunity. Extra meetings may be organised if this is deemed necessary. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS '/HVJULOOHVVHURQWpWDEOLHVHQIRQFWLRQGXWHPSVOHSOXV UDSLGHUpDOLVpSDUFKDTXH3LORWHHQWHQDQWFRPSWHGHOD GHVVpDQFHVG¶(VVDLV4XDOL¿FDWLIV6LXQRXSOXVLHXUV 3LORWHVREWLHQQHQWXQWHPSVLGHQWLTXHLOVVHURQWGpSDUWDJpVVXUEDVHGHOHXUGHX[LqPHPHLOOHXUWHPSVHWDLQVL GHVXLWH D. The grids will be drawn up in accordance with the fastest time achieved by each Driver, taking into account the Qualifying Practice session(s). Should one or several Drivers achieve the same time, the tie will be settled on the basis of their second best time, and so on. (/H3LORWHHQWrWHGHFKDTXHJULOOHDXUDOHFKRL[GH O¶HPSODFHPHQWGHODSROHSRVLWLRQVXUODSDUWLHJDXFKH RXODSDUWLHGURLWHGHODSLVWHjFRQGLWLRQG¶HQDYLVHUOH 'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYHGqVVRQ DUULYpHVXUOD3Up*ULOOH&HFKRL[QHPRGL¿HUDTXHODSUHPLqUHOLJQHjO¶H[FOXVLRQGHVDXWUHV¬GpIDXWOH3LORWHHQ WrWHGHFKDTXHJULOOHSUHQGUDOHGpSDUWGHOD&RXUVHVXUOD SRVLWLRQGHODJULOOHGpVLJQpHGDQVOH5qJOHPHQW3DUWLFXOLHU GHOD&RPSpWLWLRQRXV¶LOV¶DJLWG¶XQQRXYHDXFLUFXLWVXU FHOOHD\DQWpWpGpVLJQpHFRPPHWHOOHSDUOD&,.),$ E. The pole position Driver of each grid will have the choice of the pole position (on the left or right side of the track), providing that he advises the Clerk of the Course or the Race Director as soon as he reaches the Assembly $UHD7KLVFKRLFHZLOORQO\PRGLI\WKH¿UVWURZWRWKH exclusion of the others. Failing this, the pole position Driver of each grid will take the start of the Race from the grid position designated in the Supplementary Regulations of the Competition or if it is a new circuit, on that which was designated as such by the CIK-FIA. )L/¶DFFqVjOD3UpJULOOHSUHQGUD¿QFLQTPLQXWHVDYDQW O¶KHXUHSUpYXHSRXUOHGpSDUWGHOD&RXUVH7RXWNDUWTXL Q¶DXUDDORUVSDVSULVVDSRVLWLRQVXUOD3UpJULOOHQHVHUD SOXVDXWRULVpjOHIDLUHVDXIFLUFRQVWDQFHVH[FHSWLRQQHOOHVODLVVpHVjO¶DSSUpFLDWLRQGX&ROOqJHGHV&RPPLVVDLUHV 6SRUWLIV /HVNDUWVSODFpVVXUOD3UpJULOOHGRLYHQWrWUHSUrWVj FRXULULOHVWVWULFWHPHQWLQWHUGLWG¶HIIHFWXHUTXHOTXHVWUDYDX[HWRXUpJODJHVTXHFHVRLWVXUOHNDUWVXUOD3UpJULOOH jO¶H[FHSWLRQGHVSUHVVLRQVGHSQHXVTXLSHXYHQWrWUH DMXVWpHVSDUOH3LORWHRXVRQ0pFDQLFLHQSDUVHVSURSUHV PR\HQV )L$FFHVVWRWKH$VVHPEO\$UHDZLOOHQG¿YHPLQXWHV before the time scheduled for the start of the Race. Any kart which has not taken its position on the Assembly Area at that moment shall not be allowed to do so, except under exceptional circumstances left to the appreciation of the Panel of Stewards. The karts placed on the Pre-grid must be ready to race; it is strictly forbidden to carry out any work and/or set-up on the kart on the Pre-grid, with the exception of tyre pressures, which can be adjusted by the Driver or his/her Mechanic and by using his/her own means. LL'DQVOHVFDWpJRULHVGRQWOHVPRWHXUVVRQWpTXLSpV G¶XQGpPDUUHXUHPEDUTXpOHV0pFDQLFLHQVVHURQWWHQXV GHTXLWWHUOD3UpJULOOHWURLVPLQXWHVDYDQWO¶KHXUHSUpYXH SRXUOHGpSDUWGHOD&RXUVH7RXW3LORWHTXLQHSRXUUDLW GpPDUUHUGHOD3UpJULOOHDSUqVODSUpVHQWDWLRQGXGUDSHDX YHUWHWTXLGHPDQGHUDLWO¶LQWHUYHQWLRQG¶XQ0pFDQLFLHQ QHVHUDDXWRULVpjTXLWWHUOD3UpJULOOHTXHVXURUGUHG¶XQ &RPPLVVDLUHGHSLVWHHWSUHQGUDOHGpSDUWjO¶DUULqUHGHOD IRUPDWLRQTXHOTXHVRLWOHQRPEUHGH7RXUVGH)RUPDWLRQ (QFDVGHFRQGLWLRQVFOLPDWLTXHVFKDQJHDQWHVOHVGHX[ FKkVVLVGHYURQWrWUHSUrWVjO¶HPSORLHWPRQWpVGDQVGHX[ FRQ¿JXUDWLRQVGLIIpUHQWHVO¶XQHGHW\SH©VHFªO¶DXWUHGH W\SH©SOXLHª3RXUrWUHDXWRULVpVOHVGHX[FKkVVLVGHYURQW DYRLUpWpLQWURGXLWVHQ3DUFG¶$VVLVWDQFH©'pSDUWª&KDTXH 3LORWHVpOHFWLRQQHUDO¶XQGHVGHX[FKkVVLVSRXUO¶DSSRUWHU HQ3UpJULOOHHWFHFKRL[VHUDGp¿QLWLI$XFXQGpODLVXSSOpPHQWDLUHQHVHUDDOORXpjXQ3LORWHQ¶D\DQWSDVUHVSHFWp cette consigne. ii) In the categories where engines are equipped with an on-board starter, the Mechanics will have to clear the Assembly Area three minutes before the time scheduled for the start of the Race. If a Driver is unable to start from WKH$VVHPEO\$UHDDIWHUWKHGLVSOD\RIWKHJUHHQÀDJDQG if he requests the intervention of a Mechanic, he will be authorised to leave the Assembly Area only on the orders of a Marshal and he will take the start from the back of the formation, irrespective of the number of Formation Laps. In case of changing weather conditions, the two chassis must be ready for use and set up in two different FRQ¿JXUDWLRQVRQHRIWKH³GU\ZHDWKHU´W\SHWKHRWKHURI WKH³ZHWZHDWKHU´W\SH,QRUGHUWREHDXWKRULVHGWKHWZR FKDVVLVPXVWEHSODFHGLQWKH³6WDUW´6HUYLFLQJ3DUN(DFK Driver will select one of the two chassis to take it to the $VVHPEO\$UHDDQGWKLVFKRLFHZLOOEH¿QDO1RDGGLWLRQDO time will be allowed to a Driver who has not respected these instructions. LLL7RXWHIRLVODVXEVWLWXWLRQGXFKkVVLVVpOHFWLRQQpVHUD DXWRULVpHVXUGpFLVLRQGX'LUHFWHXUG¶eSUHXYHHQFDVGH ©67$57'(/$<('ªFHTXLLPSOLTXHUDXQHSURORQJDWLRQGH ODSURFpGXUHGHGpSDUWGHPLQXWHVWRXW3LORWHQHGLVSRVDQWSDVRXSOXVG¶XQGHX[LqPHNDUWGHYUDUHWRXUQHUHQ 3DUFG¶$VVLVWDQFH©'pSDUWªSRXUHIIHFWXHUOHVLQWHUYHQWLRQV PpFDQLTXHVQpFHVVDLUHVHWVHUDLQYLWpjV¶pODQFHUGHOD 3UpJULOOHDSUqVTXHWRXVOHVDXWUHVNDUWVDLHQWTXLWWpOD 3UpJULOOHSRXUGpPDUUHUOHXU7RXUGH)RUPDWLRQHWUHVWHUD REOLJDWRLUHPHQWjO¶DUULqUHGHODIRUPDWLRQ'DQVOHV FDWpJRULHVGRQWOHVPRWHXUVVRQWpTXLSpVG¶XQGpPDUUHXU HPEDUTXpOHV0pFDQLFLHQVVHURQWWHQXVGHTXLWWHUOD3Up iii) However, the substitution of the selected chassis will be authorised by decision of the Race Director, in the ComSHWLWLRQWKDW³67$57'(/$<('´LVDQQRXQFHG, which will entail lengthening the starting procedure by 5 minutes. Any Driver who does not dispose (or no longer disposes) of a second kart shall return to the «Start» Servicing Park in order to carry out the necessary mechanical interventions; he will be invited to leave the Assembly Area only once all the other karts have left the Assembly Area to start their Formation Lap, and he will have to stay at the back of the formation. In the categories where engines are equipped with an on-board starter, the Mechanics will have to clear PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS JULOOHGHX[PLQXWHVDYDQWO¶KHXUHSUpYXHSRXUOHGpSDUWGH OD&RXUVH the Assembly Area two minutes before the time scheduled for the start of the Race. *7RXW3LORWHSUpVHQWDYHFVRQNDUWVXUODJULOOHGDQVOHV délais sera considéré comme partant. G. Any Driver who is present, with his/her kart, on the grid within the time limit will be considered as a starter. +0LVHHQJULOOHVXUODSLVWH 1) 'DQVFHUWDLQHVFLUFRQVWDQFHVOHVNDUWVVHURQWLQYLWpV jVHPHWWUHHQJULOOHVXUODSLVWH&HFDVGH¿JXUHVHUD VSpFL¿TXHPHQWSUpFLVpGDQVO¶KRUDLUHGHOD&RPSpWLWLRQ/D SURFpGXUHVSpFL¿TXHTXLVXLWHVWDSSOLFDEOHHQOLHXHWSODFH GHVGLVSRVLWLRQVGXSRLQW) H. Starting grid procedure on the track: 1) In certain circumstances, the karts will have to be placed on the grid on the track. This scenario will be VSHFL¿HGLQWKHWLPHVFKHGXOHRIWKH&RPSHWLWLRQInstead RIWKHSURYLVLRQVRISRLQW)LWLVWKHVSHFL¿FSURFHGXUH below which is applied. 2) (QFDVGHFRQGLWLRQVFOLPDWLTXHVFKDQJHDQWHVOHVGHX[ FKkVVLVGHYURQWrWUHSUrWVjO¶HPSORLHWPRQWpVGDQVGHX[ FRQ¿JXUDWLRQVGLIIpUHQWHVO¶XQHGHW\SH©VHFªO¶DXWUHGH W\SH©SOXLHª3RXUrWUHDXWRULVpVOHVGHX[FKkVVLVGHYURQW DYRLUpWpLQWURGXLWVHQ3DUFG¶$VVLVWDQFH©'pSDUWª&KDTXH 3LORWHVpOHFWLRQQHUDO¶XQGHVGHX[FKkVVLVSRXUO¶DSSRUWHU HQ3UpJULOOHHWFHFKRL[VHUDGp¿QLWLI$XFXQGpODLVXSSOpPHQWDLUHQHVHUDDOORXpjXQ3LORWHQ¶D\DQWSDVUHVSHFWp cette consigne. 2) In case of changing weather conditions, the two chassis PXVWEHUHDG\IRUXVHDQGVHWXSLQWZRGLIIHUHQWFRQ¿JXUDWLRQVRQHRIWKH³GU\ZHDWKHU´W\SHWKHRWKHURIWKH ³ZHWZHDWKHU´W\SH,QRUGHUWREHDXWKRULVHGWKHWZR FKDVVLVPXVWEHSODFHGLQWKH³6WDUW´6HUYLFLQJ3DUN(DFK Driver will select one of the two chassis to take it to the $VVHPEO\$UHDDQGWKLVFKRLFHZLOOEH¿QDO1RDGGLWLRQDO time will be allowed to a Driver who has not respected these instructions. PLQXWHVDYDQWO¶KHXUHGXGpSDUWGX7RXUGH)RUPDWLRQFKDTXH3LORWHDYHFVRQNDUWSRVpVXUXQFKDULRWHW SRXVVpSDUVRQ0pFDQLFLHQ©$ªTXLWWHUDOH3DUFG¶$VVLVWDQFH©'pSDUWªSRXUDOOHUVHSODFHUjVDSRVLWLRQGHGpSDUW SRXUODFRXUVH ÀSDUWLUGHFHSRLQWOHVNDUWVGRLYHQWrWUHSUrWVjFRXULU LOHVWVWULFWHPHQWLQWHUGLWG¶HIIHFWXHUTXHOTXHVWUDYDX[ HWRXUpJODJHVTXHFHVRLWVXUOHNDUWjO¶H[FHSWLRQGHV SUHVVLRQVGHSQHXVVXUOHNDUW 3) 15 minutes before the starting time for the Formation Lap, each Driver with his kart placed on a trolley and SXVKHGE\KLV³$´0HFKDQLFZLOOOHDYHWKH³6WDUW´6HUYLFLQJ Park to take up their positions on the starting grid for the race. From this point, karts must be ready to race; any further work and/or adjusment (with the exception of tyre pressures) to the kart are strictly forbidden. 4)PLQXWHVDYDQWO¶KHXUHGXGpSDUWGX7RXUGH)RUPDWLRQXQVLJQDOVRQRUHUHWHQWLUDDQQRQoDQWTXHODIHUPHWXUHGHODVRUWLHGX3DUFG¶$VVLVWDQFH©'pSDUWªDXUDOLHX PLQXWHSOXVWDUG PLQXWHVDYDQWO¶KHXUHGHGpSDUWODVRUWLHGX3DUF G¶$VVLVWDQFH©'pSDUWªVHUDIHUPpHHWXQVHFRQGVLJQDO sonore retentira. 4) 13 minutes before the starting time for the Formation Lap, an audible warning will be sounded, announcing that WKHH[LWIURPWKH³6WDUW´6HUYLFLQJ3DUN6HUYLFLQJZLOOFORVH 1 minute later. 12 minutes before the starting time, the exit from the ³6WDUW´6HUYLFLQJ3DUNZLOOEHFORVHGDQGDVHFRQGDXGLEOH warning will be sounded. /HODQFHPHQWGX7RXUGH)RUPDWLRQVHUDSUpFpGpGHOD SUpVHQWDWLRQGHVSDQQHDX[DQQRQoDQW 5) The launching of the Formation Lap will be preceded by the showing of boards announcing: PLQXWHV PLQXWHV PLQXWHV PLQXWH VHFRQGHV 10 minutes, 5 minutes, 3 minutes, 1 minute, 30 seconds. &KDFXQGHFHVSDQQHDX[VHUDDFFRPSDJQpG¶XQVLJQDO sonore. Each of these boards will be accompanied by an audible warning. 6) 'DQVOHVVHXOHVFDWpJRULHVGRQWOHVPRWHXUVVRQWpTXLSpVG¶XQGpPDUUHXUHPEDUTXp/RUVTXHOHSDQQHDX PLQXWHVVHUDPRQWUpDFFRPSDJQpG¶XQSDQQHDX©0(&+$1,&6&/($57+(75$&.ªWRXVOHVNDUWVGHYURQWDYRLUpWp SRVpVDXVRO$FHPrPHPRPHQWOHV0pFDQLFLHQVTXLWWHURQWODJULOOHSRXUUHMRLQGUHOD3Up*ULOOHDYHFOHFKDULRWGX NDUW7RXWNDUWTXLQHVHUDLWSDVSRVpDXVROjFHWLQVWDQW GHYUDDXVVLW{WrWUHGpSODFpYHUVOD3UpJULOOHG¶RLOSUHQGUD le départ. 6) In the categories where engines are equipped with an on-board starter only: When the 10 minute signal is VKRZQDORQJZLWKD³0(&+$1,&6&/($57+(75$&.´ board, all karts must be laid down on the track. At this time, the Mechanics will leave the grid to go to the Assembly Area with the trolleys of the karts. Any kart which does not happen to be on the track at this time must immediately be moved to the assembly area, from where it will take the start. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS 'DQVFHFDVXQ&RPPLVVDLUHPXQLG¶XQGUDSHDXMDXQH GRQQHUDO¶RUGUHDX[NDUWVFRQFHUQpVGHTXLWWHUOD3Up JULOOHORUVTXHWRXVOHVDXWUHVNDUWVDXURQWTXLWWpODJULOOH SRXUGpPDUUHUOH7RXUGH)RUPDWLRQ ,QWKDWFDVHD0DUVKDOKROGLQJD\HOORZÀDJZLOORUGHUWKH kart(s) concerned to leave the Assembly Area when all the other karts have left the grid to start the Formation Lap. 7) /HVLQWHUYLHZVQHSRXUURQWSOXVDYRLUOLHXDSUqVOH SDQQHDXWURLVPLQXWHV $YHFOHSDQQHDXWURLVPLQXWHVVHUDSUpVHQWpOHSDQQHDX ©&/($57+(75$&.ªWRXWHVOHVSHUVRQQHVDXWUHVTXHOHV 3LORWHVHW2I¿FLHOVGHYURQWDORUVTXLWWHUODJULOOH 7) Interviews may no longer take place once the threeminute board has been shown. :LWKWKHWKUHHPLQXWHERDUGWKH³&/($57+(75$&.´ ERDUGZLOOEHVKRZQHYHU\ERG\H[FHSW'ULYHUVDQG2I¿cials must leave the grid. 8) 6LJQDO©VHFRQGHVªVHFRQGHVDSUqVFHVLJQDOOH GUDSHDXYHUWVHUDSUpVHQWpjO¶DYDQWGHODJULOOHSRXULQGLTXHUTXHOHVNDUWVGRLYHQWHQWDPHUXQ7RXUGH)RUPDWLRQ HQUHVWDQWGDQVO¶RUGUHGHODJULOOHGHGpSDUWHWFRQIRUPpPHQWDX[3UHVFULSWLRQV*pQpUDOHV&,.),$ ³VHFRQG´VLJQDOVHFRQGVDIWHUWKLVVLJQDOWKH JUHHQÀDJZLOOEHVKRZQDWWKHIURQWRIWKHJULGWRLQGLFDWH that the karts must begin a Formation Lap, keeping to the order of the starting grid and in conformity with the CIKFIA General Prescriptions. 'DQVOHFDVRXQ3LORWHDXUDLWEHVRLQG¶DLGHDSUqVOH VLJQDO©VHFRQGHVªLOGHYUDO¶LQGLTXHUDX[&RPPLVVDLUHV GH3LVWHHWGqVTXHOHVDXWUHVNDUWVDXURQWTXLWWpODJULOOH LOVHUDSRXVVpYHUVOD3UpJULOOHHWOH0pFDQLFLHQSRXUUD LQWHUYHQLU'DQVFHFDVGHV&RPPLVVDLUHVGH3LVWHPXQLV GHGUDSHDX[MDXQHVVHWLHQGURQWjF{WpGXNDUWRXGHV NDUWVFRQFHUQpVSRXUSUpYHQLUOHV3LORWHVHQ7RXUGH Formation. /HV&RPPLVVDLUHVGH3LVWHUHFHYURQWO¶RUGUHGHSRXVVHU WRXWNDUWUHVWDQWVXUODJULOOHDSUqVOHGpSDUWGX7RXUGH )RUPDWLRQYHUVOD3UpJULOOHLPPpGLDWHPHQW7RXW3LORWHTXL GpPDUUHUDLWGHOD3UpJULOOHDSUqVO¶LQWHUYHQWLRQG¶XQ0pFDQLFLHQQHSRXUUDOHIDLUHTXHVXURUGUHG¶XQ&RPPLVVDLUH GHSLVWHHWSUHQGUDOHGpSDUWjO¶DUULqUHGHODIRUPDWLRQ TXHOTXHVRLWOHQRPEUHGH7RXUVGH)RUPDWLRQ 6KRXOGD'ULYHUUHTXLUHDVVLVWDQFHDIWHUWKH³VHFRQG´VLJQDOKHRUVKHPXVWLQGLFDWHWKLVWRWKH0DUVKDOV and, once the other karts have left the grid, it will be pushed to the Assembly Area, and the Mechanic may work RQWKHNDUW,QWKLVFDVH0DUVKDOVZLWK\HOORZÀDJVZLOO stand beside the kart (or karts) concerned to warn the drivers on the Formation Lap. /DVHXOHYDULDWLRQSHUPLVHGDQVFHWWHSURFpGXUHGH GpSDUWLQWHUYLHQGUDHQFDVGHSUpVHQWDWLRQVXUOD/LJQH GXSDQQHDX©67$57'(/$<('ªTXLLPSOLTXHUDXQHSURORQJDWLRQGHODSURFpGXUHGHPLQXWHV'DQVFHFDVOHV &RQFXUUHQWVDXURQWODSRVVLELOLWpGHFKDQJHUGHNDUW/D SURFpGXUHGHGpSDUWUHFRPPHQFHUDjSDUWLUGXSRLQW PLQXWHVD¿QGHSHUPHWWUHOHFKDQJHPHQWGHNDUW/HV 0pFDQLFLHQVDXURQWDORUVODSRVVLELOLWpG¶DSSRUWHUVXUOD JULOOHOHNDUWGHVXEVWLWXWLRQSRVpVXUXQFKDULRWSRXUURQW SURFpGHUDXFKDQJHPHQWGHNDUWHWUHWRXUQHURQWDXVVLW{W DX3DUFG¶$VVLVWDQFH©'pSDUWªDYHFOHNDUWQRQUHWHQX SRXUODFRXUVH7RXW3LORWHQHGLVSRVDQWSDVRXSOXVG¶XQ GHX[LqPHNDUWGHYUDUHWRXUQHUHQ3DUFG¶$VVLVWDQFH©'pSDUWªSRXUHIIHFWXHUOHVLQWHUYHQWLRQVPpFDQLTXHVQpFHVVDLUHVHWVHUDLQYLWpjV¶pODQFHUGHOD3UpJULOOHORUVTXHWRXV OHVDXWUHVNDUWVDXURQWTXLWWpODJULOOHSRXUGpPDUUHUVRQ 7RXUGH)RUPDWLRQHWSUHQGUDOHGpSDUWjO¶DUULqUHGHOD IRUPDWLRQTXHOTXHVRLWOHQRPEUHGH7RXUVGH)RUPDWLRQ 10) The only variation in the above start procedure will WDNHSODFHZKHQWKH³67$57'(/$<('´ERDUGLVVKRZQRQ the Line, which will entail lengthening the procedure by 5 minutes. In this case, the Competitors will have the possibility of changing karts. The starting procedure will begin again at the 5-minute signal, in order to allow the karts to be changed. The Mechanics will then have the possibility of bringing to the grid the substitution karts placed on trolleys, will be allowed to proceed to the change of karts and will have to return directly to the «Start» Servicing Park with the karts which were not selected for the race. Any Driver who does not dispose (or no longer disposes) of a second kart shall return to the «Start» Servicing Park in order to carry out the necessary mechanical interventions; he will be invited to leave the Assembly Area only once all the other karts have left the grid to start their Formation Lap, and he will take the start from the back of the formation, irrespective of the number of Formation Laps. 2.20a - Procédure de départ $/HVLJQDOGHGpSDUWVHUDGRQQpDXPR\HQGHIHX[ OXPLQHX[ 2.20a - Starting procedure A. The start signal shall be given by means of lights. %/HPRGHGHGpSDUWGRLWrWUHVWLSXOpGDQVOH5qJOHPHQW 3DUWLFXOLHUGHOD&RPSpWLWLRQ,OQHSHXWrWUHTXH©lancé» RX©arrêtéªODJULOOHpWDQWFRQVWLWXpHGHGHX[¿OHVGH NDUWV/HGpSDUWW\SH©Le MansªHVWLQWHUGLWVDXIGpURJDtion accordée par la CIK-FIA). %7KHW\SHRIVWDUWPXVWEHLQGLFDWHGLQWKH6XSSOHmentary Regulations of the Competition. It may only be «rolling» or « standing», the grid being constituted of two lines of karts. « Le Mans » type starts are forbidden (except waiver granted by the CIK-FIA). Marshals will be instructed to push any kart remaining on the grid after the start of the Formation Lap to the Assembly Area immediately. If a Driver starts from the Assembly Area after the intervention of a Mechanic, he will be authorised to do so only on the orders of a Marshal, and he will take the start from the back of the formation, irrespective of the number of Formation Laps. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS &3RXUGRQQHUOHGpSDUWOH'LUHFWHXUG¶eSUHXYHRX jGpIDXWOH'LUHFWHXUGH&RXUVHVHWURXYHUDVXUXQH SODWHIRUPHVLWXpHjDXPRLQVPqWUHVGXERUGGHODSLVWH HWGHUULqUHXQHEDUULqUHGHSURWHFWLRQSHUPDQHQWH$UWLFOH &GX5pJOHPHQWGHV&LUFXLWV3DUWLH C. To give the start, the Race Director (or, failing that, the Clerk of the Course) shall be placed on a platform located at least 5 metres from the trackside and behind a permanent protecting barrier (Article 7.7.1 C of the Circuit Regulations, Part 1). 'HX[FRXORLUVODUJHVGHPqWUHVHWERUGpVGHOLJQHVGH FRXOHXUEODQFKHVHURQWSHLQWVVXUOHVPqWUHVPD[LPXPPHQDQWMXVTX¶jOD/LJQHGH'pSDUWHWQHGpEXWDQW SDVDYDQWOD¿QGXGHUQLHUYLUDJHSUpFpGDQWOD/LJQH8QH /LJQH-DXQHVHUDSHLQWHPDYDQWOD/LJQHGH'pSDUW D. Two 2-metre wide lanes bordered by white lines will be painted over the maximum of 110 metres leading to the Start Line, beginning no earlier than the end of the last corner before the Line. A Yellow Line shall be painted 25 m prior to the Start Line. ('qVTXHOH'LUHFWHXUGH&RXUVHRXOH'LUHFWHXU G¶eSUHXYHLQGLTXHDXPR\HQGXGUDSHDXYHUWTXHOHV NDUWVSHXYHQWV¶pODQFHUOHV3LORWHVVRQW©DX[RUGUHVGX 'LUHFWHXUGH&RXUVHRXGX'LUHFWHXUG¶eSUHXYH» et ne SHXYHQWSOXVUHFHYRLUG¶DVVLVWDQFHH[WpULHXUH7RXW3LORWH TXLQHVHVHUDSDVPLVjWHPSVDYHFVRQNDUWHQRUGUHGH PDUFKHDX[RUGUHVGX'LUHFWHXUGH&RXUVHRXGX'LUHFWHXU G¶eSUHXYHQHSRXUUDTXLWWHUOD3Up*ULOOHTXHVXURUGUH GX'LUHFWHXUGH&RXUVHGX'LUHFWHXUG¶eSUHXYHRXGX Responsable de la Pré-Grille. E. As soon as the Clerk of the Course or the Race Director LQGLFDWHVZLWKWKHJUHHQÀDJWKDWWKHNDUWVPD\WDNHWKH start, the Drivers are « at the orders of the Clerk of the Course or of the Race Director » and may no longer receive any outside help. Any Driver who has not placed himself at the orders of the Clerk of the Course or of the Race Director in time with his kart in working order will be allowed to leave the Assembly Area only at the orders of the Clerk of WKH&RXUVHRIWKH5DFH'LUHFWRURURIWKH2I¿FHULQFKDUJH of the Assembly Area. )/HQRPEUHGH7RXUVGH)RUPDWLRQVHUDLQGLTXpORUVGX %ULH¿QJ6HORQOHVLQVWUXFWLRQVGRQQpHVORUVGX%ULH¿QJ OHVNDUWVHIIHFWXHURQWHQYLURQXQ7RXUGH)RUPDWLRQDYDQW TXHOHGpSDUWQHVRLWGRQQp,OHVWLQWHUGLWGHGpSDVVHUXQ DXWUH3LORWHVRXVSHLQHGHSpQDOLWpLQÀLJpHSDUOHV&RPPLVVDLUHV6SRUWLIVVHFRQGHVGHSpQDOLWpRXH[FOXVLRQ de la Manche). 6LXQ3LORWHV¶DUUrWHSRXUXQHUDLVRQTXHOFRQTXHSHQGDQW OH7RXUGH)RUPDWLRQLOQHSRXUUDSDVHVVD\HUGHUHSDUWLU DYDQWTX¶LOQ¶DLWpWpGpSDVVpSDUO¶HQVHPEOHGXSODWHDX,O UHSDUWLUDREOLJDWRLUHPHQWjO¶DUULqUHGHODIRUPDWLRQ$XFDV RLOWHQWHUDLWGHGpPDUUHUGHYDQWOHSODWHDXGDQVO¶HVSRLU TXHOHV3LORWHVGHWrWHOHGpSDVVHQWLOVHYHUUDLWSUpVHQWHU OHGUDSHDXQRLUHWVHUDLWH[FOXGHFHWWHFRXUVH F. The number of Formation Laps shall be indicated at WKH%ULH¿QJ$FFRUGLQJWRWKHLQVWUXFWLRQVJLYHQDWWKH %ULH¿QJNDUWVZLOOFRYHUDSSUR[LPDWHO\RQH)RUPDWLRQ/DS before the start may be given. It is forbidden to overtake DQRWKHU'ULYHUXQGHUSDLQRIDSHQDOW\LQÀLFWHGE\WKH Stewards (10 seconds or exclusion from the Heat). *,OHVWLQWHUGLWSRXUUHJDJQHUVDSODFHG¶HPSUXQWHUWRXW SDUFRXUVDXWUHTXHODSLVWHXWLOLVpHSRXUODFRXUVH 'DQVOHFDVGHVGpSDUWVODQFpVXQ3LORWHUHWDUGDWDLUHDXUD ODSRVVLELOLWpGHUHMRLQGUHVDSODFHGHJULOOHXQLTXHPHQW VLFHWWHPDQ°XYUHQHJrQHSDVOHVDXWUHV3LORWHVHWGDQV WRXVOHVFDVDYDQWG¶DYRLUDWWHLQWOD/LJQH5RXJHTXLVHUD PDWpULDOLVpHVXUODSLVWHpTXLSpHG¶XQHERXFOHGHFKURQRPpWUDJHHWLQGLTXpHSDUOHOH'LUHFWHXUG¶eSUHXYHRXOH 'LUHFWHXUGH&RXUVHORUVGX%ULH¿QJ 'DQVOHFDVGHVGpSDUWVDUUrWpVXQ3LORWHUHWDUGDWDLUHDOD SRVVLELOLWpGHUHMRLQGUHVDSODFHGHJULOOHMXVTX¶DXPRPHQW ROHVIHX[URXJHVGHGpSDUWVRQWDOOXPpV G. In order to regain one’s position, it is forbidden to use any course other than the track used during the race. In the case of rolling starts, a Driver who is delayed will have the possibility of regaining his grid position only if this manoeuvre does not impede other Drivers and in all cases before having reached the Red Line which will be materialised on the track, equipped with a timekeeping loop and indicated by the Race Director or the Clerk of the &RXUVHDWWKH%ULH¿QJ In the case of standing starts, a Driver who is delayed will have the possibility of regaining his grid position until the red starting lights are switched on. +6¶LOFRQVLGqUHTX¶XQ3LORWHDpWpLPPRELOLVpSDUOD IDXWHG¶XQDXWUHOH'LUHFWHXUGH&RXUVHRXOH'LUHFWHXU G¶eSUHXYHSHXWDUUrWHUOH7RXUGH)RUPDWLRQHWUHFRPPHQFHUOD3URFpGXUHGH'pSDUWDYHFODJULOOHRULJLQDOHRX DXWRULVHUOH3LORWHJrQpjUHSUHQGUHVDSODFH H. If he considers that a Driver has been immobilised as a result of another Driver’s mistake, the Clerk of the Course or the Race Director may stop the Formation Lap and start again the Starting Procedure on the basis of the original grid or allow the impeded Driver to regain his position. ,/H'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYHGRQQHUDOHGpSDUWGqVTX¶LOVHUDVDWLVIDLWGHODIRUPDWLRQ I. The Clerk of the Course or the Race Director will give WKHVWDUWDVVRRQDVKHLVVDWLV¿HGZLWKWKHIRUPDWLRQ -(QFDVGHIDX[GpSDUWVUpSpWpVRXG¶LQFLGHQWVDXFRXUV GXGHV7RXUVGH)RUPDWLRQOH'LUHFWHXUGH&RXUVHRX J. In the case of repeated false starts or of incidents during the Formation Lap(s), the Clerk of the Course or If a Driver stops for any reason during the Formation Lap, he will not be allowed to try and start again before he has EHHQSDVVHGE\WKHZKROH¿HOG+HVKDOOVWDUWDJDLQIURP the back of the formation. Should he try to start ahead of WKH¿HOGLQWKHKRSHWKDWWKHOHDGLQJ'ULYHUVRYHUWDNHKLP KHZRXOGEHVKRZQWKHEODFNÀDJDQGEHH[FOXGHGIURP that race. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS OH'LUHFWHXUG¶eSUHXYHDJLVVDQWHQTXDOLWpGH-XJHGH )DLWSRXUURQWDUUrWHUODSURFpGXUHGHGpSDUWDXPR\HQ GXGUDSHDXURXJHHWLQIRUPHUOHV&RPPLVVDLUHV6SRUWLIVTXLDXURQWOHGURLWG¶LQÀLJHUDX[IDXWLIVXQHSpQDOLWp FRQIRUPpPHQWjO¶$UWLFOHGHV3UHVFULSWLRQV*pQpUDOHV 8QHQRXYHOOHSURFpGXUHVHUDODQFpHVRLWLPPpGLDWHPHQW VRLWGDQVXQGpODLGHPLQXWHVPD[LPXPVHORQOHV FLUFRQVWDQFHV/DJULOOHGHGpSDUWVHUDODPrPHTXHSRXU ODSURFpGXUHLQLWLDOH7RXVOHV3LORWHVSUpVHQWVGDQVO¶DLUH GHGpSDUWRXGDQVO¶DLUHGHUpSDUDWLRQVDYDQWO¶DUUrWGHOD SURFpGXUHSRXUURQWSUHQGUHOHGpSDUWGXQRXYHDX7RXUGH Formation. the Race Director, acting as a Judge of Fact, may stop the VWDUWLQJSURFHGXUHE\PHDQVRIWKHUHGÀDJDQGLQIRUPWKH 6WHZDUGVZKRZLOOEHHQWLWOHGWRLQÀLFWRQWKHRIIHQGLQJ Drivers a penalty according to Article 2.24 of the General Prescriptions. A new procedure will begin either immediately or within 30 minutes, according to the circumstances. The starting grid will be the same as for the initial procedure. All the Drivers present in the starting area or in the repair area before the procedure was stopped will be allowed to take the start of the new Formation Lap. .7RXWHWHQWDWLYHSRXUDQWLFLSHUOHGpSDUWRXOHUHWDUGHU HWWRXWHVRUWLHGXFRXORLUDYDQWO¶H[WLQFWLRQGHVIHX[VHURQW VDQFWLRQQpHVFRQIRUPpPHQWjO¶$UWLFOHGHV3UHVFULStions Générales. K. Any attempts to jump the start or delay it and any karts leaving the lane before the lights are switched off shall be sanctioned according to Article 2.24 of the General Prescriptions. /'qVTXHOHGpSDUWDpWpGRQQpOHVFRQGLWLRQVGHOD FRXUVHHQWUHQWHQYLJXHXUHWTXHOTXHVRLWO¶HQGURLWR VHWURXYHXQNDUWVXUODSLVWHLOHVWLQWHUGLWGHOXLIRXUQLU XQHDVVLVWDQFHTXHOFRQTXHVDXIV¶LOV¶DJLWGHOHJDUHUjXQ HQGURLWVU L. As soon as the start has been given, racing conditions are applied and, irrelevant of the position of a kart on the track, it is forbidden to give it any assistance, except for parking it to a safe location. Départs lancés pour karts à prise directe avec ou sans embrayage $XWHUPHGHOHXU7RXUGH)RUPDWLRQOHV3LORWHVV¶DYDQFHURQWjYLWHVVHUpGXLWHHWFRQVWDQWHYHUVOD/LJQHGH'pSDUW UDQJpVHQGHX[¿OHVGHNDUWVFKDFXQHGHV¿OHVGHYDQW VHWHQLUGDQVOHVFRXORLUVWUDFpVVXUODSLVWH7RXWHVRUWLH GHFRXORLUSRXUUDrWUHVDQFWLRQQpHSDUOHV&RPPLVVDLUHV 6SRUWLIVjUDLVRQG¶XQHSpQDOLWpHQWHPSVGHVHFRQGHV SRXUXQHVRUWLHSDUWLHOOHGXFRXORLUHWGHVHFRQGHVSRXU XQHVRUWLHLQWpJUDOHGXFRXORLU'XUDQWODSKDVHG¶DSSURFKHOHVIHX[VHURQWDXURXJH/HVNDUWVPDLQWLHQGURQW OHXUSRVLWLRQMXVTX¶jFHTXHOHVLJQDOGHGpSDUWVRLWGRQQp 6¶LOHVWVDWLVIDLWGHODIRUPDWLRQOH'LUHFWHXUGH&RXUVH RXOH'LUHFWHXUG¶eSUHXYHGRQQHUDOHGpSDUWHQpWHLJQDQW OHVIHX[URXJHV6¶LOQ¶HVWSDVVDWLVIDLWGHODSURFpGXUH LODOOXPHUDOHIHXRUDQJHOHTXHOVLJQL¿HUDTX¶XQ7RXUGH )RUPDWLRQVXSSOpPHQWDLUHGHYUDrWUHHIIHFWXp Rolling starts for direct drive karts with or without clutches At the end of the Formation Lap, Drivers will proceed forward at a reduced and constant speed towards the Starting Line, lined up in two lines of karts, and each line shall remain within the lanes marked on the track. A Driver crossing the lanes is liable to be sanctioned by the Stewards, on the basis of a time penalty of 3 seconds for partly crossing the lanes and of 10 seconds for completely getting out of the corridor. When the karts approach, the red lights will be on. Karts must maintain their position until the start signal is given. ,IKHLVVDWLV¿HGZLWKWKHIRUPDWLRQWKH&OHUNRIWKH Course or the Race Director will give the start by switching RIIWKHUHGOLJKWV,IKHLVQRWVDWLV¿HGZLWKWKHSURFHGXUH he will switch on the orange light, which means that another Formation Lap must be covered. Départs arrêtés pour karts à boîte de vitesses (Circuits courts) $XWHUPHGHOHXU7RXUGH)RUPDWLRQOHV3LORWHVSUHQGURQW SODFHVXUOHXUHPSODFHPHQWGHGpSDUWOH'LUHFWHXUGH &RXUVHVRQDGMRLQWRXOH'LUHFWHXUG¶eSUHXYHVHWURXYDQW VXUOD/LJQHGH'pSDUWGUDSHDXURXJHOHYp7RXVOHVIHX[ UHVWHURQWpWHLQWVMXVTX¶jFHTXHOHGHUQLHUNDUWDLWSULV SODFHVXUODJULOOH 4XDQGWRXVOHVNDUWVVHURQWLPPRELOLVpVVXUODJULOOH XQ&RPPLVVDLUHSUpVHQWHUDXQGUDSHDXYHUWHQIRQGGH JULOOH/H'LUHFWHXUGH&RXUVHVRQDGMRLQWRXOH'LUHFWHXU G¶eSUHXYHHWOH&RPPLVVDLUHpYDFXHURQWHQVHPEOHODSLVWH et les 3LORWHVVHWURXYHURQWDORUVVRXVOHVRUGUHVGX'LUHFWHXUGH&RXUVHRXGX'LUHFWHXUG¶eSUHXYH /H'LUHFWHXU GH&RXUVHRXOH'LUHFWHXUG¶eSUHXYHODQFHUDODVpTXHQFH G¶DOOXPDJHDXWRPDWLVpHGHVIHX[URXJHVVpTXHQFH GXUDQWVHFRQGHV/HGpSDUWVHUDFRQVLGpUpFRPPH GRQQpjO¶H[WLQFWLRQGHVIHX[FRPPDQGpHPDQXHOOHPHQW SDUOH'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYHGDQV OHVVHFRQGHVVXLYDQWHV Standing starts for karts with gearboxes (short Circuits) At the end of their Formation Lap, Drivers will take their starting positions and the Clerk of the Course, his deputy or the Race Director will be on the Starting Line raising a UHGÀDJ$OOOLJKWVZLOOUHPDLQVZLWFKHGRIIXQWLOWKHODVW kart has taken its position on the grid. When all karts are immobile on the grid, a Marshal will GLVSOD\DJUHHQÀDJDWWKHHQGRIWKHJULG7KH&OHUNRIWKH Course, his deputy or the Race Director and the Marshal will evacuate the track together and the Drivers will then be at the orders of the Clerk of the Course or of the Race Director. The Clerk of the Course or the Race Director will launch the automated 4-red-light switching on sequence (which lasts 4 seconds). The start will be considered as given at the switching off of the red lights manually operated by the Clerk of the Course or the Race Director within the next 2 seconds. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS 7RXWPRXYHPHQWGXNDUWGXUDQWODSURFpGXUHGHGpSDUW PRXYHPHQWVREVHUYpVDORUVTXHOHVIHX[URXJHVVRQW DOOXPpVFRQVLGpUpFRPPHXQIDX[GpSDUWVHUDVDQFWLRQQp G¶XQHSpQDOLWpGHVHFRQGHVDXPLQLPXP 6¶LOQ¶HVWSDVVDWLVIDLWGHODSURFpGXUHLODOOXPHUDOHIHX RUDQJHOHTXHOVLJQL¿HUDTX¶XQ7RXUGH)RUPDWLRQVXSSOpPHQWDLUHGHYUDrWUHHIIHFWXp6LXQ3LORWHQHGpPDUUH SDVLOHVWGDQVO¶REOLJDWLRQGHUHVWHUGDQVVRQNDUWHWGHOH VLJQDOHUHQOHYDQWOHEUDV'DQVFHFDVXQ7RXUGH)RUPDWLRQVXSSOpPHQWDLUHSRXUUDrWUHDFFRUGpOHRXOHV3LORWHV TXLQ¶DXURQWSDVGpPDUUpQHSRXUURQWVRUWLUGHOHXUNDUW HWUHSDUWLUTXHSDUOHXUVSURSUHVPR\HQVDSUqVTXHWRXW OHSODWHDXOHVDXUDGpSDVVpV,OVQHVHURQWSDVDXWRULVpV jUHSUHQGUHOHXUSODFHGDQVODIRUPDWLRQHWSUHQGURQWOH GpSDUWjO¶DUULqUHGHFHOOHFL/HVSODFHVUHVWpHVYDFDQWHV QHSRXUURQWSDVrWUHRFFXSpHVSDUOHVDXWUHV3LORWHV 3HQGDQWOHV7RXUVGH)RUPDWLRQLOHVWLQWHUGLWG¶HIIHFWXHUGHVVLPXODWLRQVGHGpSDUW (QFDVG¶DUUrWGHODSURFpGXUHGHGpSDUWOH'LUHFWHXUGH &RXUVHRXG¶eSUHXYHSUpVHQWHUDXQGUDSHDXURXJHDJLWp VLJQDODQWDX[3LORWHVGHFRXSHUOHXUPRWHXUV Any movement of the kart during the starting procedure (movements while the red lights are on) that is evaluated as a false start will be punished with a minimum 5-second penalty. ,IKHLVQRWVDWLV¿HGZLWKWKHSURFHGXUHKHZLOOVZLWFKRQ the orange light, which means that an extra Formation Lap must be covered. If a Driver is unable to start, he must remain in his kart and notify this situation by raising his arm. In this case, an additional Formation Lap may be granted; any Drivers who have been unable to start will be allowed to get out of their karts and restart only by their RZQPHDQVDQGRQFHWKHZKROH¿HOGKDVSDVVHGWKHP They will not be authorised to regain their original position in the formation and will take the start from the back of it. No other Drivers will be allowed to occupy the places which have remained vacant. During the Formation Lap(s), it is forbidden to practise start simulations. If it is necessary to interrupt the starting procedure, the Clerk of the Course or the Race Director will show a waved UHGÀDJLQGLFDWLQJWRWKH'ULYHUVWKDWWKH\PXVWFXWWKHLU engines. Départs lancés pour karts à boîte de vitesses (Circuits longs) 'pSDUWVODQFpVSRXUNDUWVjERvWHGHYLWHVVHV&LUFXLWV ORQJVOHVNDUWVVHURQWSUpFpGpVG¶XQH9RLWXUH3LORWH URXODQWjXQHYLWHVVHGHjNPK HWVXLYLVG¶XQH YRLWXUHG¶LQWHUYHQWLRQ¬OD¿QGX7RXUGH)RUPDWLRQRXOH FDVpFKpDQWjOD¿QGXGHUQLHU7RXUGH)RUPDWLRQOD9RLWXUH3LORWHVHUHWLUHUDDYDQWOD/LJQHHWjFHPRPHQWOjOH NDUWD\DQWREWHQXODSROHSRVLWLRQGHYUDURXOHUjODPrPH YLWHVVHHWOHVDXWUHVNDUWVGHYURQWPDLQWHQLUOHXUSRVLWLRQ VXUGHX[OLJQHVMXVTX¶jFHTXHOHGpSDUWVRLWVLJQDOpSDU O¶H[WLQFWLRQGHVIHX[URXJHV ¬OD¿QGX7RXUGH)RUPDWLRQVLOHVFRQGLWLRQVO¶H[LJHQWOH 'LUHFWHXUGH&RXUVHRUGRQQHUDjOD9RLWXUH3LORWHG¶HIIHFWXHUXQRXSOXVLHXUV7RXUVGH)RUPDWLRQVXSSOpPHQWDLUHV 6LXQWHO7RXUGH)RUPDWLRQVXSSOpPHQWDLUHHVWHIIHFWXp OHGpSDUWGHOD&RXUVHVHUDFRQVLGpUpFRPPHD\DQWpWp GRQQpjOD¿QGXSUHPLHU7RXUGH)RUPDWLRQ Rolling starts for karts with gearboxes (long Circuits) Rolling start for karts with gearboxes (long Circuits): Karts will be preceded by a Pace Car (at a speed between 60 and 80 kph) and followed by a service car. At the end of the Formation Lap (or, as the case may be, at the end of the last Formation Lap), the Pace Car will drive aside before the Line and, at that time, the pole position kart shall drive at the same speed and the other karts shall keep their positions in two lines until the start is given by the switching off of the red lights. ELV1HXWUDOLVDWLRQG¶XQH0DQFKH4XDOL¿FDWLYH ou d’une Course (Circuits courts) D/H'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYH SRXUUDGpFLGHUGHQHXWUDOLVHUXQH0DQFKH4XDOL¿FDWLYH RXXQH&RXUVH&HWWHSURFpGXUHQHVHUDXWLOLVpHTX¶HQ FDVG¶HQFRPEUHPHQWGHOD3LVWHRXVLGHV3LORWHVRXGHV 2I¿FLHOVFRXUHQWXQGDQJHUSK\VLTXHLPPpGLDWGDQVGHV FLUFRQVWDQFHVQHMXVWL¿DQWQpDQPRLQVSDVO¶DUUrWGHOD 0DQFKH4XDOL¿FDWLYHRXGHOD&RXUVH 2.20b - Neutralisation of a Qualifying Heat or a Race (Short circuits) a) The Clerk of the Course or the Race Director may decide to neutralise a Qualifying Heat or a Race. This procedure will be used only if the Track is obstructed, or if the DrivHUVRU2I¿FLDOVDUHLQLPPHGLDWHSK\VLFDOGDQJHUEXWWKH FLUFXPVWDQFHVDUHQRWVXI¿FLHQWWRMXVWLI\VWRSSLQJWKH Qualifying Heat or Race. E4XDQGO¶RUGUHVHUDGRQQpGHQHXWUDOLVHUOD0DQFKH 4XDOL¿FDWLYHRXOD&RXUVHWRXVOHVSRVWHVGHVXUYHLOODQFH SUpVHQWHURQWGHVGUDSHDX[MDXQHVDJLWpVHWXQSDQQHDX ©6/2:ªSDQQHDXGHFRXOHXUMDXQHDYHFLQVFULSWLRQ ©6/2:ªHQQRLUTXLVHURQWPDLQWHQXVMXVTX¶jOD¿QGHOD QHXWUDOLVDWLRQ/HVIHX[RUDQJHFOLJQRWDQWVVHURQWDOOXPpV jKDXWHXUGHOD/LJQH b) When the order is given to neutralise the Qualifying Heat or Race, all observation posts will display waved \HOORZÀDJVDQGD³6/2:´ERDUG\HOORZERDUGZLWKWKH ZRUG³6/2:´ZULWWHQLQEODFNZKLFKVKDOOEHPDLQWDLQHG until the neutralisation is over. Flashing orange lights will be switched on at the Line. F7RXVOHVNDUWVHQFRXUVHGHYURQWVHPHWWUHHQ¿OH GHUULqUHOHNDUWGHWrWHHWLOVHUDDEVROXPHQWLQWHUGLWGH c) All the competing karts must then line up behind the leading kart, and overtaking is strictly forbidden. At the end of the Formation Lap, should conditions require it, the Clerk of the Course will order the Pace Car to cover one or several extra Formation Laps. If such an extra Formation Lap is covered, the start of the Race will be FRQVLGHUHGDVKDYLQJEHHQJLYHQDWWKHHQGRIWKH¿UVW Formation Lap. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS GpSDVVHU/HVGpSDVVHPHQWVVHURQWDXWRULVpVXQLTXHPHQW VLXQNDUWUDOHQWLWHQUDLVRQG¶XQSUREOqPHJUDYH Overtaking will be permitted only if a kart slows down because of a serious problem. G/HNDUWGHWrWHGRQQHUDODFDGHQFHGHVWRXUVGH QHXWUDOLVDWLRQjXQHDOOXUHPRGpUpHHWWRXVOHVDXWUHV NDUWVGHYURQWUHVWHUHQIRUPDWLRQDXVVLVHUUpHTXH possible. d) During the neutralisation laps, the leading kart will dictate the pace, at a moderate speed, and all the other karts must remain in as tight a formation as possible. H3HQGDQWODQHXWUDOLVDWLRQOHVNDUWVSRXUURQWHQWUHUHQ ]RQHGHUpSDUDWLRQVPDLVLOVQHSRXUURQWUHJDJQHUODSLVWH TXHORUVTX¶LOV\VHURQWDXWRULVpVSDUXQFRPPLVVDLUH8Q NDUWUHJDJQDQWODSLVWHDYDQFHUDjXQHYLWHVVHPRGpUpH MXVTX¶jFHTX¶LODWWHLJQHO¶H[WUpPLWpGHOD¿OHGHNDUWVVH WURXYDQWGHUULqUHOHNDUWGHWrWH e) The karts may enter the repair zone during the neutralisation, but they may rejoin the track only when authorised to do so by a marshal. A kart rejoining the track shall proceed at an moderate speed until it reaches the end of the line of karts behind the leading kart. I/RUVTXHOH'LUHFWHXUG¶eSUHXYHRXOH'LUHFWHXUGH &RXUVHGpFLGHUDGHPHWWUHXQWHUPHjODQHXWUDOLVDWLRQLO IHUDpWHLQGUHOHVIHX[RUDQJHFOLJQRWDQWVFHVHUDOHVLJQDO SRXUOHV3LORWHVTXHOD&RXUVHVHUDUHODQFpHGqVOHSDVVDJH VXLYDQWVXUOD/LJQH'DQVOHGHUQLHUWRXUGHQHXWUDOLVDWLRQ OHVSDQQHDX[©6/2:ªVHURQWPDLQWHQXVHWOHVGUDSHDX[ MDXQHVVHURQWSUpVHQWpVLPPRELOHV f) When the Race Director or the Clerk of the Course GHFLGHVWRHQGWKHQHXWUDOLVDWLRQKHZLOOKDYHWKHÀDVKLQJ orange lights switched off; this will be the signal to the Drivers that the Race is to resume next time the Line is FURVVHG,QWKHODVWQHXWUDOLVDWLRQODSWKH³6/2:´ERDUGV ZLOOEHPDLQWDLQHGDQGWKH\HOORZÀDJVZLOOEHVKRZQ immobile. J¬FHPRPHQWOjOHNDUWGHWrWHFRQWLQXHUDGHGRQQHU ODFDGHQFHjXQHDOOXUHPRGpUpH/DUHODQFHGHOD&RXUVH VHUDLQGLTXpHSDUOH'LUHFWHXUG¶eSUHXYHRXOH'LUHFWHXU GH&RXUVHDXPR\HQG¶XQGUDSHDXYHUWDJLWpjKDXWHXUGH OD/LJQH7DQWTXHOHVNDUWVQ¶DXURQWSDVIUDQFKLOD/LJQH jOD¿QGHODQHXWUDOLVDWLRQGHOD0DQFKH4XDOL¿FDWLYH RXGHOD&RXUVHWRXWGpSDVVHPHQWVHUDLQWHUGLW$X UHWRXUYHUVOD/LJQHRVHUDDJLWpXQGUDSHDXYHUWSDUOH 'LUHFWHXUG¶eSUHXYHRXOH'LUHFWHXUGH&RXUVHOHV3LORWHV QHSRXUURQWDFFpOpUHUTX¶jKDXWHXUGHODOLJQHMDXQH SUpFpGDQWOD/LJQH/HVGUDSHDX[MDXQHVHWOHVSDQQHDX[ ©6/2:ªDX[SRVWHVGHVXUYHLOODQFHVHURQWDORUVUHWLUpVHW UHPSODFpVSDUGHVGUDSHDX[YHUWVDJLWpV&HVGUDSHDX[ VHURQWGpSOR\pVSHQGDQWXQWRXUDXPD[LPXP g) At that moment, the leading kart will continue to set the pace, at a moderate speed. The Race Director or the Clerk of the Course will signal the resumption of the Race E\PHDQVRIDZDYHGJUHHQÀDJDWWKH/LQH2YHUWDNLQJ will remain prohibited until the karts have crossed the Line at the end of the neutralisation of the Qualifying Heat or 5DFH2QDSSURDFKLQJWKH/LQHZKHUHDJUHHQÀDJZLOOEH waved by the Race Director or the Clerk of the Course, the Drivers may accelerate only after crossing the yellow OLQHSUHFHGLQJWKH/LQH7KH\HOORZÀDJVDQGWKH³6/2:´ boards at the observers’ posts will then be withdrawn DQGUHSODFHGZLWKZDYHGJUHHQÀDJV7KHVHÀDJVZLOOEH displayed for a maximum of one lap. K&KDTXHWRXUDFFRPSOLSHQGDQWODQHXWUDOLVDWLRQVHUD FRPSWpFRPPHXQWRXUGHFRXUVH h) Each lap completed during the neutralisation will be counted as a racing lap. L6LODFRXUVHVHWHUPLQHDORUVTXHODQHXWUDOLVDWLRQHVWHQ FRXUVOHVNDUWVVHYHUURQWSUpVHQWHUOHGUDSHDXjGDPLHU VHORQODSURFpGXUHQRUPDOH/HVGpSDVVHPHQWVVHURQW DXWRULVpVXQLTXHPHQWVLXQNDUWUDOHQWLWHQUDLVRQG¶XQ problème grave. L,IWKHUDFH¿QLVKHVGXULQJWKHQHXWUDOLVDWLRQWKHNDUWV ZLOOWDNHWKHFKHTXHUHGÀDJDVXVXDO2YHUWDNLQJZLOOEH permitted only if a kart slows down because of a serious problem. 2.20c - Reprendre une Course selon la procédure «SLOW» 6LXQH&RXUVHHVWVXVSHQGXHHQDSSOLFDWLRQGHO¶$UWLFOH ODSURFpGXUHGHUHSULVHVHUDHIIHFWXpHVHORQXQH SURFpGXUH©6/2:ª $X[RUGUHVGX'LUHFWHXUG¶eSUHXYHOHV3LORWHVSURFpGHURQW jXQGpSDUWHQVLWXDWLRQGHQHXWUDOLVDWLRQSHQGDQWXQWRXU RXSOXV $X[3RVWHVGH&RPPLVVDLUHVGH3LVWHVHURQWSUpVHQWpV GHVSDQQHDX[©6/2:ªDFFRPSDJQpVGHGUDSHDX[MDXQHV immobiles. 6LODIRUPDWLRQHVWVDWLVIDLVDQWHOH'LUHFWHXUG¶eSUHXYHRX GH&RXUVHVLJQDOHUDODUHSULVHGHOD&RXUVHDXPR\HQG¶XQ GUDSHDXYHUWDJLWpVXUOD/LJQH,OGHPHXUHUDLQWHUGLWGH GpSDVVHUMXVTX¶jFHTXHOHVNDUWVDLHQWIUDQFKLOD/LJQH 2.20c - Resuming a Race with the “SLOW” process If a Race is suspended under Article 2.21, the resuming SURFHGXUHZLOOEHFRQGXFWHGZLWKWKH³6/2:´SURFHVV At the order of the Race Director, Drivers will proceed to start in a neutralised situation for one or more laps. 7KH0DUVKDOV¶3RVWVZLOOGLVSOD\³6/2:´ERDUGVZLWKVWDWLF \HOORZÀDJV If the formation is satisfactory, the Race Director or the Clerk of the Course will signal the resuming of the Race by PHDQVRIDZDYHGJUHHQÀDJDWWKH/LQH2YHUWDNLQJZLOO remain prohibited until the karts have crossed the Line. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS ¬O¶DSSURFKHGHOD/LJQHRXQGUDSHDXYHUWVHUDDJLWpSDU OH'LUHFWHXUG¶eSUHXYHRXGH&RXUVHOHV3LORWHVSRXUURQW DFFpOpUHUVHXOHPHQWDSUqVDYRLUIUDQFKLODOLJQHMDXQH précédant la Ligne. /HVGUDSHDX[MDXQHVHWOHVSDQQHDX[©6/2:ªSUpVHQWpV DX[3RVWHVGH&RPPLVVDLUHVGH3LVWHVHURQWDORUVUHWLUpV HWUHPSODFpVSDUGHVGUDSHDX[YHUWVDJLWpV&HVGUDSHDX[ VHURQWSUpVHQWpVSHQGDQWDXPD[LPXPXQWRXU 2QDSSURDFKLQJWKH/LQHZKHUHDJUHHQÀDJZLOOEHZDYHG by the Race Director or the Clerk of the Course, the Drivers may accelerate only after crossing the yellow line preceding the Line. 7KH\HOORZÀDJVDQGWKH³6/2:´ERDUGVDWWKH0DUVKDOV¶ Posts will then be withdrawn and replaced by waved green ÀDJV7KHVHÀDJVZLOOEHGLVSOD\HGIRUDPD[LPXPRIRQH lap. 2.21 - Suspension de la Course ou des Essais $6¶LOGHYLHQWQpFHVVDLUHGHVXVSHQGUHOD&RXUVHRXOHV (VVDLVjFDXVHGHO¶HQFRPEUHPHQWGXFLUFXLWjODVXLWHG¶XQ DFFLGHQWRXSDUFHTX¶jFHPRPHQWOHVFRQGLWLRQVDWPRVSKpULTXHVRXG¶DXWUHVUDLVRQVHQUHQGHQWODSRXUVXLWHGDQJHUHXVHOH'LUHFWHXUGH&RXUVHRXOH'LUHFWHXUG¶eSUHXYH RUGRQQHUDTX¶XQGUDSHDXURXJHVRLWGpSOR\pVXUOD/LJQH 6LPXOWDQpPHQWGHVGUDSHDX[URXJHVVHURQWGpSOR\pVDX[ SRVWHVGH&RPPLVVDLUHVGH3LVWHTXLHQVHURQWPXQLV/D GpFLVLRQGHVXVSHQGUHODFRXUVHRXOHVHVVDLVQHSRXUUD rWUHSULVHTXHSDUOH'LUHFWHXUGH&RXUVHRXV¶LODG V¶DEVHQWHUSDUVRQDGMRLQWRXOH'LUHFWHXUG¶eSUHXYH6LOH VLJQDOGHFHVVHUGHFRXULUHVWGRQQp: 2.21 - Suspending a Race or Practice A. Should it become necessary to suspend the Race or Practice because the circuit is blocked by an accident or because weather or other conditions make it dangerous to continue, the Clerk of the Course or the Race Director shall RUGHUDUHGÀDJWREHVKRZQRQWKH/LQH a) pendant les EssaisWRXVOHVNDUWVUpGXLURQWLPPpGLDWHPHQWOHXUYLWHVVHHWUHQWUHURQWOHQWHPHQWDX3DUF G¶$VVLVWDQFH©$UULYpHªHWWRXVOHVNDUWVDEDQGRQQpVVXUOD piste en seront enlevésOHV(VVDLVVHURQWUHODQFpVGqVTXH SRVVLEOHSRXUUHVSHFWHUO¶KRUDLUHRULJLQDOGHV(VVDLV a) during Practice : all karts shall immediately reduce speed and go back slowly to the «Finish» Servicing Park, and all karts abandoned on the track shall be removed ; Practice will be resumed as soon as possible to meet the original Practice time; ESHQGDQWOHV0DQFKHV4XDOL¿FDWLYHVWRXVOHVNDUWV GHYURQWLPPpGLDWHPHQWUpGXLUHOHXUYLWHVVHHWJDJQHU O¶HQWUpHGX3DUFG¶$VVLVWDQFH©$UULYpHªRXV¶LPPRELOLVHU VXUODSLVWHjO¶HQGURLWGpVLJQpORUVGX%ULH¿QJVDFKDQW TXH OHFODVVHPHQWGHOD0DQFKHVHUDOHFODVVHPHQWDXWHUPH GXWRXUSUpFpGDQWFHOXLDXFRXUVGXTXHOOHVLJQDOG¶DUUrW DXUDpWpGRQQp GHVNDUWVRXGHVYpKLFXOHVGHVHFRXUVSRXUURQWVHWURXYHUVXUODSLVWH OHFLUFXLWSRXUUDrWUHWRWDOHPHQWREVWUXpjFDXVHG¶XQ DFFLGHQW b) during the Qualifying Heats : all karts will immediately reduce their speed and go to the «Finish» Servicing Park entrance or stop on the track at the place designated GXULQJWKH%ULH¿QJFRQVLGHULQJWKDW OHVFRQGLWLRQVDWPRVSKpULTXHVDXURQWSXUHQGUHOHFLUFXLW LPSUDWLFDEOHjJUDQGHYLWHVVH - the weather conditions may have made it impossible to drive at high speed on the circuit. /DSURFpGXUHjVXLYUHYDULHVHORQOHQRPEUHGHWRXUV FRPSOHWVHIIHFWXpVSDUOH3LORWHHQWrWHGHOD0DQFKHDYDQW TXHOHVLJQDOG¶DUUrWQHVRLWGRQQp The procedure to be followed varies according to the number of laps completed by the Heat leader before the signal to stop was given : PRLQVGHGHODGLVWDQFHSUpYXHSRXUOD0DQFKH DUURQGLHDXQRPEUHHQWLHUVXSpULHXUGHWRXUV6LOD 0DQFKHSHXWrWUHUHSULVHO¶$UWLFOHV¶DSSOLTXHUD - less than 75% of the distance scheduled for the Heat (rounded up to the nearest higher whole number of laps). If the Heat can be resumed, Article 2.22 will apply; RXSOXVGHODGLVWDQFHSUpYXHSRXUOD0DQFKH DUURQGLHDXQRPEUHHQWLHUVXSpULHXUGHWRXUV/HVNDUWV seront directement dirigés vers le Parc Fermé et la Manche VHUDFRQVLGpUpHFRPPHV¶pWDQWWHUPLQpHORUVTXHOHNDUWGH WrWHDXUDIUDQFKLOD/LJQHDXWHUPHGXWRXUSUpFpGDQWFHOXL DXFRXUVGXTXHOOHVLJQDOG¶DUUrWDXUDpWpGRQQp - 75% or more of the distance scheduled for the Heat (rounded up to the nearest higher whole number of laps). The karts will be directly led to the Parc Fermé, and the Heat will be considered as having stopped when the leading kart crossed the Line at the end of the lap prior to that during which the signal to stop was given ; FSHQGDQWXQH&RXUVHGHODSKDVH¿QDOHWRXVOHVNDUWV GHYURQWLPPpGLDWHPHQWUpGXLUHOHXUYLWHVVHHWJDJQHU FGXULQJD5DFHRIWKH¿QDOSKDVHDOONDUWVPXVW immediately reduce speed and go to the entrance to the 6LPXOWDQHRXVO\UHGÀDJVZLOOEHVKRZQDWPDUVKDOV¶SRVWV SURYLGHGZLWKWKHVHÀDJV7KHGHFLVLRQWRVXVSHQGWKH race or practice may be taken only by the Clerk of the Course (or, if he had to leave, by his deputy) or the Race Director. If the signal to stop racing is given : WKHFODVVL¿FDWLRQRIWKH+HDWZLOOEHWKHFODVVL¿FDWLRQDW the end of the lap prior to that during which the signal to stop was given, - karts or rescue vehicles may be on the track, - the circuit may be totally blocked because of an accident, PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS O¶HQWUpHGX3DUFG¶$VVLVWDQFH©$UULYpHªRXV¶LPPRELOLVHU VXUODSLVWHjO¶HQGURLWGpVLJQpORUVGX%ULH¿QJVDFKDQW TXH OHFODVVHPHQWGHOD&RXUVHVHUDOHFODVVHPHQWDXWHUPH GXWRXUSUpFpGDQWFHOXLDXFRXUVGXTXHOOHVLJQDOG¶DUUrWGH OD&RXUVHDXUDpWpGRQQp GHVNDUWVRXGHVYpKLFXOHVGHVHFRXUVSRXUURQWVHWURXYHUVXUODSLVWH OHFLUFXLWSRXUUDrWUHWRWDOHPHQWREVWUXpjFDXVHG¶XQ DFFLGHQW OHVFRQGLWLRQVDWPRVSKpULTXHVDXURQWSXUHQGUHOHFLUFXLW LPSUDWLFDEOHjJUDQGHYLWHVVH «Finish» Servicing Park or stop on the track at the place GHVLJQDWHGGXULQJWKH%ULH¿QJFRQVLGHULQJWKDW %/DSURFpGXUHjVXLYUHYDULHVHORQOHQRPEUHGHWRXUV FRPSOHWVHIIHFWXpVSDUOH3LORWHHQWrWHGHOD&RXUVHDYDQW TXHOHVLJQDOG¶DUUrWGHOD&RXUVHQHVRLWGRQQp: %7KHSURFHGXUHWREHIROORZHGYDULHVDFFRUGLQJWRWKH number of laps completed by the Race leader before the signal to stop the Race was given : &DV$PRLQVGHWRXUV$XFXQSRLQWQHVHUDDWWULEXp6L OD0DQFKHSHXWrWUHUHSULVHXQQRXYHDXGpSDUWVHUDGRQQp GDQVOHVPLQXWHVDSUqVTXHOHGUDSHDXURXJHDXUDpWp SUpVHQWpGDQVOHVFRQGLWLRQVSUpYXHVjO¶$UWLFOH) /DORQJXHXUGHODQRXYHOOHFRXUVHVHUDODGLVWDQFHLQWpJUDOHSUpYXHSRXUODFRXUVHLQLWLDOH/HSUHPLHUGpSDUWVHUD FRQVLGpUpFRPPHQXOHWQRQDYHQX /DJULOOHGHGpSDUWVHUDODPrPHTXHSRXUODFRXUVHLQLWLDOH/HV3LORWHVD\DQWIUDQFKLOD/LJQHG¶$UULYpHSHQGDQW OHWRXUSUpFpGDQWO¶DUUrWHWFHX[TXLVHWURXYDLHQWHQ=RQH GH5pSDUDWLRQVDORUVTXHOHGUDSHDXURXJHpWDLWSUpVHQWp VHURQWDGPLVjSUHQGUHOHQRXYHDXGpSDUWVRLWDYHFOH NDUWLQLWLDOVRLWDYHFOHGHX[LqPHNDUW/HVSODFHVQRQ RFFXSpHVGHODJULOOHUHVWHURQWYDFDQWHV. Case A : less than 2 laps. No points will be awarded. If the Race can be resumed, a new start will be given ZLWKLQPLQXWHVDIWHUSUHVHQWDWLRQRIWKHUHGÀDJLQWKH conditions provided for under Article 2.19 F). The length of the new race will be the full original race distance. The original start will be deemed null and void. &DV%SOXVGHWRXUVPDLVPRLQVGHGHODGLVWDQFH SUpYXHSRXUOD&RXUVHDUURQGLHDXQRPEUHHQWLHUVXSpULHXUGHWRXUV6LOD0DQFKHSHXWrWUHUHSULVHO¶$UWLFOH V¶DSSOLTXHUD'DQVOHFDVFRQWUDLUHODPRLWLpGHV SRLQWVVHUDDWWULEXpH &DVH%PRUHWKDQODSVEXWOHVVWKDQRIWKHGLVtance scheduled for the Race (rounded up to the nearest whole number of laps). If the Race can be resumed, Article 2.22 will apply. Should this not be possible, half the points will be awarded. Cas CRXSOXVGHODGLVWDQFHSUpYXHSRXUOD&RXUVH DUURQGLHDXQRPEUHHQWLHUVXSpULHXUGHWRXUV/HVNDUWV VHURQWGLUHFWHPHQWGLULJpVYHUVOH3DUF)HUPpHWOD&RXUVH VHUDFRQVLGpUpHFRPPHV¶pWDQWWHUPLQpHORUVTXHOHNDUWGH WrWHDXUDIUDQFKLOD/LJQHDXWHUPHGXWRXUSUpFpGDQWFHOXL DXFRXUVGXTXHOOD&RXUVHDpWpDUUrWpH/DWRWDOLWpGHV SRLQWVVHUDDWWULEXpH Case C : 75% or more of the Race distance (rounded up to the nearest whole higher number of laps). The karts shall be sent directly to the Parc Fermé and the Race will be GHHPHGWRKDYH¿QLVKHGZKHQWKHOHDGLQJNDUWFURVVHGWKH Line at the end of the lap prior to that during which the Race was stopped. Full points will be awarded. 5HSULVHG¶XQHFRXUVH0DQFKH4XDOL¿FDWLYHRX &RXUVHGHODSKDVH¿QDOH $SUqVXQHVLWXDWLRQGHVXVSHQVLRQOHGpODLGRLWrWUHDXVVL FRXUWTXHSRVVLEOHHWGqVTXHO¶KHXUHGHODUHSULVHVHUD FRQQXHOHV3LORWHVHQVHURQWLQIRUPpV'DQVWRXVOHVFDV XQDYHUWLVVHPHQWVHUDGRQQpDXPLQLPXPPLQXWHV DYDQW'HVSDQQHDX[VHURQWSUpVHQWpVPLQXWHV PLQXWHVPLQXWHVPLQXWHHWVHFRQGHVDYDQWOD UHSULVH&KDTXHVLJQDOVHUDDFFRPSDJQpG¶XQDYHUWLVVHPHQWVRQRUH,OVHUDSHUPLVGHWUDYDLOOHUVXUOHVNDUWV XQLTXHPHQWDX3DUFG¶$VVLVWDQFHOHVVHXOVLQWHUYHQDQWV SDUNDUWSRXYDQWrWUHOH3LORWHOXLPrPHHWVRQ0pFDQLFLHQDWWLWUpGpWHQWHXUGXODLVVH]SDVVHUDGpTXDW6LOH UqJOHPHQWGHOD&RPSpWLWLRQOHSHUPHWLOVHUDSHUPLV G¶LQWURGXLUHGDQVFHPrPH3DUFG¶$VVLVWDQFHGXPDWpULHO GHVXEVWLWXWLRQXQLTXHPHQWFHOXLLGHQWL¿pGDQVOHFDVGH 2.22 - Resuming a race (Qualifying Heat or Race of WKH¿QDOSKDVH After a suspending situation, the delay will be kept as short as possible and as soon as a resuming time is known, Drivers will be informed. In all cases at least a 10 PLQXWHV¶ZDUQLQJZLOOEHJLYHQ%RDUGVZLOOEHSUHVHQWHG 10 minutes, 5 minutes, 3 minutes, 1 minute and 30 seconds before the resumption. Each signal will be accompanied by an audible warning. Working on karts will be allowed only in the Servicing Park; the only persons allowed to intervene on a kart are the Driver himself and his appointed Mechanic, holder of the appropriate pass. If the regulations of the Competition provide for this possibility, it will be allowed to introduce VSDUHHTXLSPHQWRQO\WKHHTXLSPHQWLGHQWL¿HGLQWKHFDVH of chassis and/or engines) in the Servicing Park. Refuelling WKHFODVVL¿FDWLRQRIWKH5DFHZLOOEHWKHFODVVL¿FDWLRQDW the end of the lap prior to that during which the signal to stop the Race was given, - karts or rescue vehicles may be on the track, - the circuit may be totally blocked because of an accident, - the weather conditions may have made it impossible to drive on the circuit at racing speed. The starting grid will be the same as for the original race. Those Drivers having crossed the Finish Line at the end of the lap prior to that during which the race was stopped and those who were in the Repairs Area when the red ÀDJZDVVKRZQZLOOEHHOLJLEOHWRWDNHWKHUHVWDUWHLWKHU LQWKHLURULJLQDONDUWRULQWKHLUVHFRQGNDUW8QRFFXSLHG places on the grid shall remain vacant. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS FKkVVLVHWRXPRWHXUV/HUDYLWDLOOHPHQWHQFDUEXUDQW VHUDDXWRULVp7RXVOHVNDUWVGRLYHQWrWUHSUrWVjODSUpVHQWDWLRQGXSDQQHDXPLQXWHV will be allowed. All karts must be ready at the 3 minutes board. /D&RXUVHRXOD0DQFKHVHUDUHSULVHVHORQODSURFpGXUH ©6/2:ªHWO¶$UWLFOHV¶DSSOLTXHUD/DORQJXHXUGHOD QRXYHOOHFRXUVHVHUDpJDOHjODGLIIpUHQFHHQWUHOHQRPEUH GHWRXUVSUpYXVHWOHQRPEUHGHWRXUVDFFRPSOLV/HV 3LORWHVD\DQWIUDQFKLOD/LJQHG¶$UULYpHjOD¿QGXWRXU SUpFpGDQWFHOXLDXFRXUVGXTXHOODFRXUVHDpWpDUUrWpH HWFHX[TXLVHWURXYDLHQWGDQVOD=RQHGH5pSDUDWLRQV H[FHSWpORUVG¶XQH&RXUVHGHODSKDVH¿QDOHTXDQGOH GUDSHDXURXJHDpWpGpSOR\pVHURQWDGPLVjSUHQGUHOH QRXYHDXGpSDUWVRLWjERUGGHOHXUNDUWG¶RULJLQHVRLWDYHF OHGHX[LqPHNDUW/HSUHPLHUNDUWHWOHGHX[LqPHNDUWVRQW DXWRULVpVGDQVOH3DUFG¶$VVLVWDQFH©Départ». /HVSODFHVORUVGHODUHSULVHVHURQWGpWHUPLQpVSDUO¶RUGUH G¶DUULYpHjOD¿QGXWRXUSUpFpGDQWFHOXLDXFRXUVGXTXHOOD FRXUVHDpWpVXVSHQGXH 7KH5DFHRU+HDWZLOOEHUHVXPHGZLWKWKH³6/2:´SURFHVV and Article 2.20 will apply. The length of the new race will be equal to the difference between the scheduled number of laps and the number of laps covered. The Drivers who have crossed the Finish Line at the end of the lap prior to that on which the race was stopped and those who were in WKH5HSDLUV$UHDH[FHSWLQD¿QDOSKDVH5DFHZKHQWKH UHGÀDJZDVVKRZQZLOOEHDOORZHGWRWDNHWKHQHZVWDUW either in their original kart, or with the second kart. The ¿UVWNDUWDQGWKHVHFRQGNDUWDUHDOORZHGLQWKH©6WDUWª Servicing Park. 2.23 - Arrivée $/HVLJQDOGH¿QGHFRXUVHVHUDGRQQpVXUOD/LJQHGqV TXHOHNDUWHQWrWHGHODFRXUVHDXUDSDUFRXUXVRLWODGLVWDQFHLQWpJUDOHSUpYXHSRXUODFRXUVHVRLWODSOXVJUDQGH GLVWDQFHSHQGDQWODGXUpHSUpYXHGHODFRXUVH 2.23 - Finish A. The signal indicating the end of the race shall be given on the Line as soon as the leading kart has covered either the full race distance or the greatest distance during the time scheduled for the race. %6LOHVLJQDOGH¿QGHFRXUVHHVWGRQQpSRXUXQHUDLVRQ DXWUHTXHFHOOHVSUpYXHVjO¶$UWLFOH$DYDQWTXH OHNDUWGHWrWHQ¶DLWHIIHFWXpOHQRPEUHGHWRXUVSUpYXV RXTXHOHWHPSVSUHVFULWQHVRLWpFRXOpODFRXUVHVHUD FRQVLGpUpHFRPPHWHUPLQpHORUVTXHOHNDUWGHWrWHDXUD IUDQFKLOD/LJQHSRXUODGHUQLqUHIRLVDYDQWTXHOHVLJQDO Q¶DLWpWpGRQQp6LOHVLJQDOGH¿QGHFRXUVHHVWUHWDUGp SRXUTXHOTXHUDLVRQTXHFHVRLWODFRXUVHVHUDFRQVLGpUpH FRPPHV¶pWDQWWHUPLQpHDXPRPHQWRGDQVGHVFRQGLWLRQVQRUPDOHVOD¿QGHFRXUVHDXUDLWpWpGpFLGpHV¶LOQ¶\ DYDLWSDVHXGHUHWDUG %6KRXOGIRUDQ\UHDVRQRWKHUWKDQXQGHU$UWLFOH$ the signal indicating the end of the race be given before the leading kart completes the scheduled number of laps or before the prescribed time has elapsed, the race will EHGHHPHGWRKDYH¿QLVKHGZKHQWKHOHDGLQJNDUWODVW crossed the Line before the signal was given. Should the signal indicating the end of the race be delayed for any UHDVRQWKH5DFHZLOOEHGHHPHGWRKDYH¿QLVKHGZKHQ under normal circumstances, the end of the race would have been decided if there had been no delay. &$SUqVDYRLUUHoXOHVLJQDOGH¿QGHFRXUVHWRXVOHV NDUWVGHYURQWDOOHUGLUHFWHPHQWDX3DUF)HUPpHQHPSUXQWDQWOHWUDFpQRUPDOGHODSLVWHVDQVUHWDUGLQXWLOHVDQV HIIHFWXHUGHVGpUDSDJHVVDQVV¶DUUrWHUHWVDQVDVVLVWDQFHjO¶H[FHSWLRQGHFHOOHGHV&RPPLVVDLUHVGH3LVWHVL nécessaire). 7RXWNDUWFODVVpVHWURXYDQWGDQVO¶LPSRVVLELOLWpGHJDJQHU OH3DUF)HUPpSDUVHVSURSUHVPR\HQVVHUDSODFpVRXVOH FRQWU{OHH[FOXVLIGHV&RPPLVVDLUHVGH3LVWHTXLYHLOOHURQWjFHTXHOHNDUWVRLWFRQGXLWDX3DUF)HUPpHQWRXWH UpJXODULWp C. After having received the signal indicating the end of the race, all karts shall directly go to the Parc Fermé, using the normal course of the track, without any unnecessary delay, without performing doughnuts, without stopping and without any help (except that of Marshals if necessary). $Q\FODVVL¿HGNDUWXQDEOHWRUHDFKWKH3DUF)HUPpE\LWV own means will be placed under the exclusive control of Marshals, who will supervise the taking of the kart to the Parc Fermé in a regular manner. '3RXUTX¶XQHDUULYpHVRLWMXJpHYDODEOHWRXW3LORWHGHYUD DYRLUIUDQFKLOD/LJQHG¶$UULYpHDVVLVDXYRODQWGHVRQNDUW ')RUD¿QLVKWREHFRQVLGHUHGYDOLGD'ULYHUPXVWKDYH crossed the Finish Line seated at the wheel of his kart. ((QFDVG¶H[ TXRVXUOD/LJQHG¶$UULYpHUpYpOpVSDUOH FKURQRPpWUDJHRXSDUXQV\VWqPHGHSKRWR¿QLVKOHTXHO SUpYDXGUDVXUOHFKURQRPpWUDJHHWRXOHUDSSRUWGX-XJH jO¶$UULYpHVLXQWHO-XJHDYDLWpWpQRPPpOHV3LORWHV jpJDOLWpVHURQWGpSDUWDJpVHQIRQFWLRQGXPHLOOHXUWRXU HQUHJLVWUpSDUFKDFXQG¶HX[ORUVGHODFRXUVHFRQFHUQpH E. In the case of a dead heat on the Finish Line revealed E\WLPHNHHSLQJRUE\DSKRWR¿QLVKV\VWHPZKLFKVKDOO prevail over timekeeping and/or a report from the Finish Line Judge, if such a Judge had been appointed), the rule for deciding between tying Drivers shall be the fastest lap WLPHUHFRUGHGE\HDFK'ULYHUGXULQJWKHUDFHFRQFHUQHG´ 2.24 - Incidents 8Q©IncidentªVLJQL¿HXQIDLWRXXQHVpULHGHIDLWVLPSOL- 2.24 - Incidents An « Incident» means a fact or a series of facts involving Resuming start positions will be determined by the ¿QLVKLQJRUGHUDWWKHHQGRIWKHODSEHIRUHWKHRQHRQ which the race was suspended. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS TXDQWXQRXSOXVLHXUV3LORWHVRXWRXWHDFWLRQG¶XQ3LORWH UDSSRUWpHDX[&RPPLVVDLUHV6SRUWLIVSDUOH'LUHFWHXUGH &RXUVHRXOH'LUHFWHXUG¶eSUHXYHRXQRWpVSDUOHV&RPPLVVDLUHV6SRUWLIVHWUDSSRUWpVDX'LUHFWHXUGH&RXUVHRX DX'LUHFWHXUG¶eSUHXYHSRXUHQTXrWHTXLDRXRQW: SURYRTXpO¶DUUrWG¶XQH&RXUVHHQDSSOLFDWLRQGHO¶$UWLFOH GX&RGH; YLROpOHVSUpVHQWHV3UHVFULSWLRQVRXOH&RGH SULVXQGpSDUWDQWLFLSp SULVOHGpSDUWGHSXLVXQHSRVLWLRQLQFRUUHFWHSDU H[GHYDQWOHSLORWHHQSROHSRVLWLRQORUVG¶XQ départ lancé); YLROpODVLJQDOLVDWLRQSDUGUDSHDX[ IDLWSUHQGUHXQIDX[GpSDUWjXQRXSOXVLHXUVNDUWV; FDXVpXQHFROOLVLRQ; IDLWTXLWWHUODSLVWHjXQ3LORWH; LOOpJLWLPHPHQWHPSrFKpXQHPDQ°XYUHGHGpSDVVHPHQW OpJLWLPHG¶XQ3LORWH; LOOpJLWLPHPHQWJrQpXQDXWUH3LORWHDXFRXUVG¶XQH PDQ°XYUHGHGpSDVVHPHQW one or several Drivers (or any Driver’s action reported to the Stewards by the Clerk of the Course or the Race Director or noted by the Stewards and reported to the Clerk of the Course or the Race Director for investigation), who: D,ODSSDUWLHQGUDDX[&RPPLVVDLUHV6SRUWLIVGHGpFLGHUVL XQRXGHV3LORWHVHVWVRQWPrOpVjXQ,QFLGHQW; il(s) ne GRLYHQWSDVTXLWWHUOHFLUFXLWVDQVOHFRQVHQWHPHQWGHV &RPPLVVDLUHV6SRUWLIV E6LXQ3LORWHHVWLPSOLTXpGDQVXQ,QFLGHQWHWTX¶LOHQD pWpLQIRUPpSDUOHV&RPPLVVDLUHV6SRUWLIVGDQVOHVWUHQWH PLQXWHVVXLYDQWOD¿QGHOD&RXUVHLOQHGRLWSDVTXLWWHUOH FLUFXLWVDQVOHXUDFFRUG F/HV&RPPLVVDLUHV6SRUWLIVSRXUURQWXWLOLVHUWRXW V\VWqPHYLGpRRXpOHFWURQLTXHVXVFHSWLEOHGHOHVDLGHUj SUHQGUHXQHGpFLVLRQ a) It will be the responsibility of the Stewards to decide if one or several Driver(s) is/are involved in an Incident; he/they must not leave the circuit without the Stewards’ agreement. b) If a Driver is involved in an Incident , and if he was informed of this by the Stewards within thirty minutes after the end of the Race, he must not leave the circuit without their agreement. c) The Stewards may use any video or electronic system likely to help them to take a decision. /HV&RPPLVVDLUHV6SRUWLIVGRLYHQWLQÀLJHUXQHSpQDOLWp HQWHPSVGHVHFRQGHVjWRXW3LORWHD\DQWFDXVpXQ ,QFLGHQW6LO¶,QFLGHQWHVWFDXVpDXFRXUVG¶XQHVpDQFH G¶(VVDLV4XDOL¿FDWLIVLOVGRLYHQWSURFpGHUjO¶DQQXODWLRQ GHVHVWURLVPHLOOHXUVWHPSVUpDOLVpVGDQVODVpDQFH FRQFHUQpH7RXWHIRLVSUHQDQWHQFRPSWHVDJUDYLWpOHV &RPPLVVDLUHV6SRUWLIVSRXUURQWGpFLGHUjODSODFHGHOD SpQDOLWpHQWHPSVGHVHFRQGHVG¶XQHVDQFWLRQSDUPL FHOOHVSUpYXHVGDQVO¶pFKHOOHGHVSpQDOLWpVjO¶$UWLFOH GX&RGH 7KH6WHZDUGVVKDOOLQÀLFWDVHFRQGWLPHSHQDOW\RQ any Driver having caused an Incident. If the Incident was caused during a Qualifying Practice session, they shall proceed to the cancellation of the three fastest times which he/she achieved in the session concerned. However, considering its serious nature, the Stewards may decide, instead of the 10-second time penalty, of a sanction among those provided for in the penalty scale of Article 12.3 of the Code. 2.25 - Classements $/¶2UJDQLVDWHXUSHXWSUpYRLUGDQVVRQ5qJOHPHQW3DUWLFXOLHUGHVVXEGLYLVLRQVSDUJURXSHVGHNDUWVGHVVXEGLYLVLRQVSDUFODVVHVGHF\OLQGUpHRXHQFRUHGHVFODVVHPHQWV VSpFLDX[IRQGpVVXUXQLQGLFHGHSHUIRUPDQFH &ODVVL¿FDWLRQV A. In his Supplementary Regulations, the Organiser may provide for subdivisions per groups of karts, subdivisions SHUF\OLQGHUFXELFFDSDFLW\FODVVHVRUVSHFLDOFODVVL¿FDWLRQV based on a performance rating. %/¶$61GHO¶2UJDQLVDWHXUG¶XQH&RPSpWLWLRQGRLWHQ HQYR\HUOHVUpVXOWDWVDX6HFUpWDULDWGHOD&,.),$GDQVOD VHPDLQHTXLVXLWOD&RPSpWLWLRQ %7KH$61RIWKH2UJDQLVHURID&RPSHWLWLRQPXVWVHQG its results to the Secretariat of the CIK-FIA in the week after the Competition. 2.26 - Réclamations et Appels /H5qJOHPHQW3DUWLFXOLHUGRLWFRPSUHQGUHWRXVOHVUHQVHLgnements nécessaires concernant le montant des droits de UpFODPDWLRQRXG¶DSSHO¿[pVSDUO¶$61 2.26 - Protests and Appeals The Supplementary Regulations shall include all the necessary information concerning the amount of the protest or appeal fees set by the ASN. 2.27 - Application et interprétation des Prescriptions Générales (QFDVGHGLIIpUHQGUHODWLIjO¶LQWHUSUpWDWLRQGHVSUpVHQWHV 2.27 - Application and interpretation of the General Prescriptions In the case of a dispute concerning the interpretation of - provoked the stopping of a Race in application of Article 11.11 of the Code ; - violated these Sporting Regulations or the Code ; - have jumped the start ; - started from an incorrect position (e.g. ahead of the pole sitter during a rolling start) KDYHQRWUHVSHFWHGÀDJVLJQDOOLQJ - have caused one or several karts to take a false start; - have caused a collision ; - have forced another Driver out of the track; - have illegally prevented a legitimate passing manoeuvre by a Driver ; - have illegally impeded another Driver during a passing manoeuvre. PRESCRIPTIONS GÉNÉRALES GENERAL PRESCRIPTIONS 3UHVFULSWLRQVVHXOHO¶$61GHO¶2UJDQLVDWHXUHVWTXDOL¿pH SRXUSUHQGUHXQHGpFLVLRQVDQVSUpMXGLFHGXGURLWG¶DSSHO FRQIRUPpPHQWDX&RGH WKHVH3UHVFULSWLRQVRQO\WKH2UJDQLVHU¶V$61LVTXDOL¿HG to take a decision, without prejudice of the right to appeal, in accordance with the Code. &RXYHUWXUHPpGLDVpTXLWDEOHHWLPSDUWLDOHGH la Compétition /¶2UJDQLVDWHXUG¶XQH&RPSpWLWLRQGHYUDV¶DVVXUHUTXHOD SHUVRQQHKDELOLWpHjH[SORLWHUOHVGURLWVGHUHWUDQVPLVVLRQ IHUDHQVRUWHTXHOD&RPSpWLWLRQVRLWFRXYHUWHGHIDoRQ pTXLWDEOHHWLPSDUWLDOHHWTXHOHVUpVXOWDWVGHFHWWHGHUQLqUHQHVRLHQWSDVGpIRUPpV 2.28 - Fair and impartial media coverage of the Competition The Organiser of a Competition shall ensure that the person entitled to exploit the broadcasting rights shall arrange for the Competition to be covered in a fair and impartial manner and for the results of the Competition not to be altered. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS 4.2 PRESCRIPTIONS SPÉCIFIQUES (COMPÉTITIONS DE LA CIK-FIA) 4.2 SPECIFIC PRESCRIPTIONS (CIK-FIA COMPETITIONS) Dans le cadre des Championnats, Coupes et Trophées CIKFIA de Karting, toutes les dispositions des Prescriptions Générales s’appliquent et se trouvent complétées par les SUpVHQWHV3UHVFULSWLRQV6SpFL¿TXHV Within the framework of the CIK-FIA Championships, Cups and Trophies, all provisions of the General Prescriptions DUHDSSOLHGDQGDUHFRPSOHWHGE\WKHVH6SHFL¿F3UHVFULStions. Le contrôle et la bonne marche des Compétitions de Championnats CIK-FIA pour les véhicules dénommés «karts» devront être assurés dans chaque pays par l’Autorité Sportive Nationale (« ASN») détenant le pouvoir sportif HQYHUWXGHVRQDI¿OLDWLRQjOD),$ The control and good running of the CIK-FIA Championship Competitions for vehicles called «karts» shall be ensured in each country by the National Sporting Authority («ASN») holding the sporting power in accordance with its FIA membership. La CIK-FIA organise les Championnats internationaux, ainsi que des Trophées et Coupes (ci-après dénommés «Championnats CIK-FIA ») qui sont la propriété de la CIK),$7RXWHVOHVSDUWLHVFRQFHUQpHV),$&,.),$$61 Organisateurs, Promoteur, Concurrents et circuits) s’enJDJHQWjDSSOLTXHUDLQVLTX¶jREVHUYHUOHVUqJOHVUpJLVVDQW OH&KDPSLRQQDW The CIK-FIA organises the international Championships, as well as Trophies and Cups (hereafter called «CIK-FIA Championships») which are the property of the CIK-FIA. All parties concerned (FIA, CIK-FIA, ASN, Organisers, Promoter, Entrants and circuits) undertake to apply and observe the rules governing the Championship. 1 - Règlement Dans le Règlement Sportif, les intitulés sont énoncés aux VHXOHV¿QVGHFRPPRGLWpHWQ¶RQWSDVG¶DXWRULWpUpJOHPHQWDLUH 1 - Regulations Headings in the Sporting Regulations are for ease of reference only and do not form part of these regulations. 2 - Organisation Les Championnats CIK-FIA se déroulent en une seule ou SOXVLHXUV&RPSpWLWLRQV 2 - Organisation The CIK-FIA Championships are held in either one or several Competitions. 3 - Karts admis 1HSHXYHQWrWUHDGPLVjXQH&RPSpWLWLRQGH&KDPSLRQQDW CIK-FIA que les karts conformes au Règlement Technique GH.DUWLQJGHOD&,.),$ 3 - Eligible karts Only karts complying with the Karting Technical Regulations may be accepted in a CIK-FIA Championship Competition. 4 - Inscription et organisation des Compétitions de Championnat CIK-FIA $6HXOHOD),$HVWKDELOLWpHjGpWHUPLQHUOHFDOHQGULHUGHV &RPSpWLWLRQVGHV&KDPSLRQQDWV&,.),$HWjHQFRQ¿HU O¶RUJDQLVDWLRQDX[$61 4 - Entry and organisation of CIK-FIA Championship Competitions A. Only the FIA is entitled to determine the calendar of the CIK-FIA Championship Competitions and to entrust ASNs with their organisation. %6HXOHOD),$HVWKDELOLWpHjDFFRUGHUO¶RUJDQLVDWLRQG¶XQ &KDPSLRQQDW&,.),$jXQH$61VHORQOHVUqJOHPHQWVSDUWLFXOLHUVG¶DWWULEXWLRQ B. Only the FIA is entitled to grant the organisation of a CIK-FIA Championship to an ASN in accordance with the VSHFL¿FDZDUGLQJUHJXODWLRQV &$XFDVRXQH$61GpOpJXHUDLWVRQRUJDQLVDWLRQjXQ WLHUVO¶$61GHPHXUHUDLWUHVSRQVDEOHYLVjYLVGHOD&,. ),$HQFHTXLFRQFHUQHOHUHVSHFWGHWRXVOHVUqJOHPHQWV Aucun Constructeur, aucune association de Constructeurs, DXFXQ&RQFXUUHQWQHSRXUUDRUJDQLVHURXrWUHDVVRFLpj XQH$61jXQFOXEDI¿OLpjFHWWH$61RXjXQ2UJDQLVDteur, pour l’organisation d’une Compétition de ChampionQDW&,.),$ C. Should an ASN delegate its organisation to a third party, the ASN would remain responsible vis-à-vis the CIK-FIA as regards the respect of all the regulations. No Manufacturer, no association of Manufacturers, no Entrant may organise or be associated with an ASN, with a club DI¿OLDWHGWRWKDW$61RUZLWKDQ2UJDQLVHUIRUWKHRUJDnisation of a Competition counting towards a CIK-FIA Championship. '/HV&KDPSLRQQDWV&,.),$QHSHXYHQWVHGpURXOHUTXH sur un circuit homologué par la CIK-FIA, détenant une Licence Circuit (pour les circuits courts) ou une Licence &LUFXLW),$GHGHJUpjSRXUOHVFLUFXLWVORQJV D. CIK-FIA Championships may be held only on circuits homologated by the CIK-FIA and holding a Circuit Licence (for short circuits) or a grade 1 to 4 FIA Circuit Licence (for long circuits). (7RXWHFDQGLGDWXUHSRXUO¶RUJDQLVDWLRQG¶XQH&RPSpWLWLRQ devra parvenir au Secrétariat de la CIK-FIA au plus tard E. Any application for the organisation of a Competition must reach the CIK-FIA Secretariat with a full dossier at PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS mi-mai de l’année précédant la date de la Compétition (excepté pour les Compétitions sur circuits longs, dont les candidatures pourront être soumises en septembre), DFFRPSDJQpHG¶XQGRVVLHUFRPSOHW7RXWHUpJOHPHQWDWLRQ QDWLRQDOHSDUWLFXOLqUHGRLWrWUHVRXPLVHjOD&,.),$DX moment de la candidature pour l’inscription de la ComSpWLWLRQDX&DOHQGULHU6SRUWLI,QWHUQDWLRQDOGHOD&,.),$ Seule l’approbation de la CIK-FIA peut rendre effectives de WHOOHVUpJOHPHQWDWLRQVSDUWLFXOLqUHVSRXUOD&RPSpWLWLRQ La CIK-FIA assurera que tous les candidats Concurrents soient informés de telles réglementations particulières DYDQWODGDWHGHFO{WXUHGHVHQJDJHPHQWV the latest in mid May of the year before the date of the Competition (except for Competitions held on long circuits, ZKLFKFDQEHDSSOLHGIRULQ6HSWHPEHU$Q\VSHFL¿FQDWLRnal regulations must be submitted to the CIK-FIA with the original application for inclusion of the Competition on the CIK-FIA International Sporting Calendar. Only with the DSSURYDORIWKH&,.),$FDQVXFKVSHFL¿FUHJXODWLRQVFRPH into force for the Competition. The CIK-FIA will ensure WKDWDOODSSOLFDQW(QWUDQWVDUHLQIRUPHGRIVXFKVSHFL¿F regulations before the closing date of entries. )7RXVOHV2UJDQLVDWHXUVGHV&RPSpWLWLRQVGH&KDPSLRQQDWV&,.),$V¶HQJDJHQWjUHVSHFWHUWRXVOHVWH[WHV régissant le Championnat par le fait même d’organiser la &RPSpWLWLRQ F. All Organisers of CIK-FIA Championship Competitions undertake to respect all texts governing the Championship by the very fact of organising the Competition. */HV&RPSpWLWLRQVG¶XQPrPH&KDPSLRQQDWGRLYHQW rWUHVpSDUpHVSDUGHX[VHPDLQHVDXPRLQV/D&,.),$VH réserve le droit de réduire cet intervalle en raison de cirFRQVWDQFHVSDUWLFXOLqUHV G. Competitions of one and the same Championship must be separated by at least two weeks. The CIK-FIA reserves the right to reduce this interval according to particular circumstances. +8QHSDUWLFLSDWLRQPLQLPDOHGHYLQJW3LORWHVSDUFDWpJRULHHVW¿[pHSRXUTXHOHWLWUHG¶XQ&KDPSLRQQDW&,.),$ VRLWDWWULEXp8QSDUWLFLSDQWHVWXQ3LORWHTXL¿JXUHVXU OD/LVWHGHV3DUWLFLSDQWVpWDEOLHjO¶LVVXHGHV9pUL¿FDWLRQV 6SRUWLYHVHW7HFKQLTXHV H. A minimum participation of twenty Drivers per category is set for the awarding of a CIK-FIA Championship title. A participant is a Driver whose name appears on the List of Participants drawn up at the end of the Sporting Checks and Scrutineering. ,8QH&RPSpWLWLRQSHXWrWUHDQQXOpHVLOHVNDUWVGHPRLQV GHGRX]H3LORWHVRQWVDWLVIDLWDX[9pUL¿FDWLRQV7HFKQLTXHV Si aucune formule de remplacement ne peut être trouvée, OD&,.),$pWXGLHUDWRXWHVROXWLRQSDOOLDWLYH I. A Competition may be cancelled if the karts of fewer than twelve Drivers have passed Scrutineering. If no alternative formula can be found, the CIK-FIA will study any palliative solution. -/HGURLWGHOLHUOHQRPG¶XQHHQWUHSULVHRUJDQLVDWLRQ RXPDUTXHFRPPHUFLDOHjXQ&KDPSLRQQDW&,.),$HVW UpVHUYpH[FOXVLYHPHQWjOD&,.),$6DXIDFFRUGpFULWSUpalable de la CIK-FIA, aucun Organisateur ou groupement d’Organisateurs dont la/les Compétition(s) fait/font partie d’un Championnat CIK-FIA ne peut indiquer ou faire croire TXHOHGLW&KDPSLRQQDWHVWVXEYHQWLRQQpRXDLGp¿QDQcièrement, soit directement, soit indirectement, par une HQWUHSULVHRXRUJDQLVDWLRQFRPPHUFLDOH J. The right to associate the name of a company, an organisation or a commercial make to a CIK-FIA Championship is exclusively reserved for the CIK-FIA. Unless there is a previous written agreement of the CIK-FIA, no Organiser or group of Organisers whose Competition(s) is/are part of a CIK-FIA Championship may indicate or make believe WKDWWKHVDLG&KDPSLRQVKLSLVVSRQVRUHGRU¿QDQFLDOO\ KHOSHGHLWKHUGLUHFWO\RULQGLUHFWO\E\DFRPPHUFLDO¿UP or organisation. .7RXWH$61TXLGpVLUHTX¶XQHQRXYHOOH&RPSpWLWLRQVRLW incluse dans un Championnat doit en aviser la CIK-FIA, qui désignera au moins un Observateur de la CIK-FIA devant rWUHSUpVHQWjOD&RPSpWLWLRQRUJDQLVpHGDQVOHFRXUDQWGH l’année qui précède celle au cours de laquelle la Compétition doit être inscrite au Calendrier Sportif International de OD&,.),$ K. Any ASN wishing a new Competition to be included in a Championship must advise the CIK-FIA, which will appoint at least one CIK-FIA Observer, who must be present at the Competition organised the year before that in which the Competition is to be entered on the CIK-FIA International Sporting Calendar. 5 - Déplacement ou annulation d’une Compétition de Championnat CIK-FIA $6XLWHjWRXWGpSODFHPHQWRXDQQXODWLRQOD&,.),$ pourra désigner une Compétition de remplacement en FKRLVLVVDQWSDUPLOHV&RPSpWLWLRQVGHUpVHUYHpYHQWXHOOHV 5 - Change of date or cancellation of a CIK-FIA Championship Competition A. The CIK-FIA may designate a replacement for a cancelled Competition or for an Competition the date of which has changed, by choosing among possible reserve Competitions. %/HGpSODFHPHQWRXO¶DQQXODWLRQG¶XQH&RPSpWLWLRQDYHF XQSUpDYLVLQIpULHXUjWURLVPRLVSRXUUDHQWUDvQHUOHUHIXV d’inscription de la Compétition ou d’une autre Compétition B. The change of date or cancellation of a Competition with less than three months notice may entail refusal of the entry of the Competition or of any other Competition PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS proposée par l’ASN pour le Championnat de l’année suivante, sauf s’il s’agit d’un cas de force majeure admis par OD&,.),$ proposed by the ASN for the Championship of the following year, except in cases of force majeure accepted by the CIK-FIA. 6 - Publication du Règlement Particulier $8QPRLVDYDQWOD&RPSpWLWLRQO¶$61RUJDQLVDWULFHGHYUD DGUHVVHUjWRXWHVOHV$61SDUWLFLSDQWHVGHVFRSLHVGX5qglement Particulier, qui devra être accepté par la CIK-FIA DXPRLQVGHX[PRLVDYDQWOD&RPSpWLWLRQ 6 - Publication of the Supplementary Regulations A. One month before the Competition, the organising ASN shall send to all participating ASNs copies of the Supplementary Regulations, which must have been approved by the CIK-FIA at least two months before the Competition. %/RUVTXHO¶2UJDQLVDWHXUHQYHUUDVRQ5qJOHPHQW 3DUWLFXOLHUjOD&,.),$SRXUDFFHSWDWLRQLOGHYUDMRLQGUH obligatoirement son attestation d’assurance Responsabilité Civile couvrant l’ensemble du déroulement de la manifesWDWLRQ B. When the Organiser sends his Supplementary Regulations to the CIK-FIA for approval, he must enclose his Civil /LDELOLW\LQVXUDQFHFHUWL¿FDWHFRYHULQJWKHHQWLUHPHHWLQJ &/HVUqJOHPHQWVVHURQWSXEOLpVHQIUDQoDLVHWHQ anglais; le cas échéant, ils pourront être traduits en G¶DXWUHVODQJXHV C. The regulations shall be published in French and in English; should the need arise, they can also be translated into other languages. 7 - Délégués CIK-FIA $3RXUFKDTXH&RPSpWLWLRQOD&,.),$SRXUUDGpVLJQHU les délégués suivants : - au moins un Délégué Technique, - un Délégué Médical, - un Délégué Media, - un Délégué Sécurité, - un Délégué Chronométreur, XQ0DvWUHGH&pUpPRQLH 7 - CIK-FIA Delegates A. For each Competition the CIK-FIA may nominate the following delegates: - at least one Technical Delegate, - a Medical Delegate, - a Media Delegate, - a Safety Delegate; - a Timekeeping Delegate, - a Master of Ceremony. %/HU{OHGHVGpOpJXpVGHOD&,.),$>H[FHSWpOHV Délégué(s) Technique(s), qui est/sont responsable(s) du Contrôle Technique] est de superviser dans leurs fonctions OHV2I¿FLHOVGHOD&RPSpWLWLRQGHYHLOOHUjFHTXHWRXVOHV règlements régissant le Championnat soient respectés, de formuler les remarques qu’ils jugeraient nécessaires et de dresser tout rapport nécessaire concernant le déroulement GHOD&RPSpWLWLRQGDQVOHXUFKDPSGHFRPSpWHQFH B. The role of the CIK-FIA delegates [except the Technical Delegate(s), who is/are responsible for Scrutineering] is to VXSHUYLVHWKH2I¿FLDOVRIWKH&RPSHWLWLRQLQWKHLUGXWLHV to see that all the regulations governing the Championship are respected, to make any comments they deem necessary and to draw up any necessary reports concerning the UXQQLQJRIWKH&RPSHWLWLRQLQWKHLU¿HOGRIFRPSHWHQFH 2I¿FLHOV /HV2I¿FLHOVVXLYDQWVVHURQWGpVLJQpVSDUOD&,.),$ - deux Commissaires Sportifs internationaux, dont l’un sera nommé Président du Collège, de nationalité différente de celle de l’Organisateur, choisis parmi la liste des &RPPLVVDLUHV6SRUWLIVpWDEOLHSDUOD&,.),$ - la CIK-FIA se réserve le droit de nommer également un Directeur d’Épreuve, au moins 2 Commissaires Techniques HWXQ&RRUGLQDWHXU 2I¿FLDOV 7KHIROORZLQJ2I¿FLDOVZLOOEHDSSRLQWHGE\WKH&,.),$ - two international Stewards, one of whom will be nominated Chairman of the Panel, of a nationality different from that of the Organiser, chosen from the list of Stewards drawn up by the CIK-FIA. - the CIK-FIA reserves the right also to appoint a Race Director, at least 2 Scrutineers and a Coordinator. /HV2I¿FLHOVVXLYDQWVVHURQWGpVLJQpVSDUO¶$61TXLRUJDnise la Compétition ou délivre le permis pour la CompétiWLRQHWOHXUVQRPVVHURQWFRPPXQLTXpVjOD&,.),$HQ même temps que le Règlement Particulier de la Compétition: - un Commissaire Sportif choisi parmi les licenciés de l’ASN, - un Commissaire Technique en chef, - un Directeur de Course qui sera choisi parmi ceux admis par la CIK-FIA, - un Directeur de Course adjoint, - un Secrétaire de la manifestation, - un Médecin en chef et un second médecin, 7KHIROORZLQJ2I¿FLDOVZLOOEHDSSRLQWHGE\WKH$61RUJDnising the Competition or delivering the permit to organise the Competition, and their names will be sent to the CIKFIA at the same time as the Supplementary Regulations of the Competition: - a Steward chosen from among the ASN’s licence-holders, - a Chief Scrutineer, - a Clerk of the Course chosen from those admitted by the CIK-FIA, - a deputy Clerk of the Course, - a Secretary of the meeting, D&KLHI0HGLFDO2I¿FHUDQGDVHFRQGGRFWRU PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS - un Chronométreur en chef (seulement si un Délégué &KURQRPpWUHXUQ¶HVWSDVQRPPpSDUOD&,.),$ - a Chief Timekeeper (only if a Timekeeping Delegate is not appointed by the CIK-FIA). Le Directeur d’Épreuve, le Directeur de Course, le(s) Délégué(s) Technique(s), le Délégué Chronométreur, le Coordinateur et les Commissaires Sportifs doivent être SUpVHQWVjOD&RPSpWLWLRQDXSOXVWDUGXQHKHXUHDYDQW O¶KHXUHGHFO{WXUHGHV9pUL¿FDWLRQV6SRUWLYHV The Race Director, the Clerk of the Course, the Technical Delegate(s), the Timekeeping Delegate, the Coordinator and the Stewards must be present at the Competition at the latest one hour before the closing of the Sporting Checks. /H'LUHFWHXUGH&RXUVHGRLWVHWHQLUjOD'LUHFWLRQGH Course et en contact avec tous les postes de Commissaires jWRXWPRPHQWORUVTXHOHVNDUWVVRQWDXWRULVpVjURXOHUVXU ODSLVWH/H3UpVLGHQWGX&ROOqJHGHV&RPPLVVDLUHV6SRUtifs, le Directeur d’Épreuve, le Directeur de Course et le(s) 'pOpJXpV7HFKQLTXHVRXjGpIDXWOH&RPPLVVDLUH7HFKQLTXHHQFKHIGRLYHQWrWUHHQFRQWDFWUDGLRSHUPDQHQW The Clerk of the Course must stay at Race Control and be in contact with all Marshals’ posts whenever karts are allowed to drive on the track. The Chairman of the Panel of Stewards, the Race Director, the Clerk of the Course and the Technical Delegate(s) or, failing that, the Chief Scrutineer, must be in permanent radio contact. 9 - Acceptation des engagements des Pilotes $/HVGHPDQGHVG¶HQJDJHPHQWVHURQWHQYR\pHVSDU OHV&RQFXUUHQWVjO¶DGUHVVH¿JXUDQWVXUOHVIRUPXODLUHV RI¿FLHOVLPSULPpVHWGLIIXVpVSDUOD&,.),$DSUqVTXH les Concurrents auront fait viser leur formulaire par leur $618QHLQVFULSWLRQVDQVYLVDGHO¶$61VHUDFRQVLGpUpH FRPPHQXOOHHWQRQDYHQXH6DXIUpJOHPHQWSDUWLFXOLHUOHV inscriptions seront clôturées au plus tard quatre semaines avant le déroulement de la Compétition ou l’ouverture du &KDPSLRQQDW 9 - Acceptation of Drivers’ entries A. Once Entrants have had their forms stamped by their ASNs, they shall send their entry applications to the adGUHVVDSSHDULQJRQWKHRI¿FLDOIRUPVSULQWHGDQGLVVXHGE\ the CIK-FIA. An entry application without a visa from the ASN will be considered as null and void. Except in the case RIVSHFL¿FUHJXODWLRQVHQWULHVZLOOEHFORVHGDWWKHODWHVW four weeks before the Competition is held or before the opening of the Championship. %/HQRPEUHWRWDOGHVHQJDJpVSHXYHQWrWUHOLPLWpVYRLU 3UHVFULSWLRQV6SpFL¿TXHVpYHQWXHOOHVFRQWHQXHVGDQVOHV 5qJOHPHQWV6SRUWLIVGHV&KDPSLRQQDWV&,.),$ B. The total number of entries may be limited (see posVLEOH6SHFL¿F3UHVFULSWLRQVLQFOXGHGLQWKH6SRUWLQJ5HJXODtions of the CIK-FIA Championships). &8Q3LORWHSRXUUDV¶HQJDJHUGDQVXQVHXO&KDPSLRQQDW DXFDVRSOXVLHXUV&KDPSLRQQDWVVHFRXUUDLHQWGDQVOH FDGUHG¶XQHPrPHPDQLIHVWDWLRQ C. A Driver may enter only one Championship if several Championships are held within the framework of one and the same meeting. '7RXWHVOHVFDQGLGDWXUHVVHURQWpWXGLpHVSDUOD&,.),$ qui publiera la liste des karts et des Pilotes acceptés, avec leurs numéros de compétition, au plus tard 15 jours après ODGDWHGHFO{WXUHGHVHQJDJHPHQWV D. All applications will be studied by the CIK-FIA, which will publish the list of karts and Drivers accepted, with their racing numbers, at the latest 15 days after the closing date of entries. 10 - Conditions générales $,OLQFRPEHDX[&RQFXUUHQWVG¶DVVXUHUTXHWRXWHVOHV personnes concernées par leur engagement observent toutes les dispositions du Code, du Règlement Technique HWGX5qJOHPHQW6SRUWLI6LXQ&RQFXUUHQWHVWGDQVO¶LPSRVVLELOLWpG¶rWUHSUpVHQWHQSHUVRQQHjOD&RPSpWLWLRQLO GRLWGpVLJQHUVRQUHSUpVHQWDQWSDUpFULW¬WRXWPRPHQW d’une Compétition, la personne chargée d’un kart engagé est responsable conjointement et solidairement avec le &RQFXUUHQWGHIDoRQjDVVXUHUO¶REVHUYDWLRQGHVGLVSRVLWLRQV 10 - General conditions A. It is the Entrant’s responsibility to ensure that every person concerned by his entry observes all the provisions of the Code, of the Technical Regulations and of the Sporting Regulations. If an Entrant is unable to be present in person at the Competition he must nominate his representative in writing. The person having charge of an entered kart during any part of a Competition is responsible jointly and severally with the Entrant for ensuring that the provisions are observed. %/HV&RQFXUUHQWVGRLYHQWDVVXUHUTXHOHXUVNDUWVUHVpectent les conditions de conformité et de sécurité penGDQWWRXWHODGXUpHGHOD&RPSpWLWLRQ B. Entrants must ensure that their karts comply with the conditions of conformity and safety throughout the Competition. &/DSUpVHQWDWLRQG¶XQNDUWDX[9pUL¿FDWLRQV7HFKQLTXHV sera considérée comme une déclaration implicite de FRQIRUPLWp '/HV&RQFXUUHQWV3LORWHVDVVLVWDQWVHWLQYLWpVGHYURQWj WRXWLQVWDQWSRUWHUOHVLQVLJQHVG¶LGHQWL¿FDWLRQDSSURSULpV C. The presentation of a kart for Scrutineering will be deemed an implicit statement of conformity. D. Entrants, Drivers, assistants and guests must at all WLPHVZHDUWKHDSSURSULDWHLGHQWL¿FDWLRQFUHGHQWLDOVZKLFK PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS qui leur auront été remis conformément aux prescriptions GHO¶$UWLFOHGHVSUpVHQWHV3UHVFULSWLRQV6SpFL¿TXHV have been handed to them in accordance with the presFULSWLRQVRI$UWLFOHRIWKHVH6SHFL¿F3UHVFULSWLRQV 9pUL¿FDWLRQV6SRUWLYHVHW7HFKQLTXHV $9RLUO¶$UWLFOHGHV3UHVFULSWLRQV*pQpUDOHV 11 - Sporting Checks and Scrutineering A. See Article 2.10 of the General Prescriptions. %/RUVGHODSUHPLqUH&RPSpWLWLRQOD&,.),$YpUL¿HUD WRXWHVOHVOLFHQFHV %$WWKH¿UVW&RPSHWLWLRQWKH&,.),$ZLOOFRQWURODOO licences. &/RUVGHV9pUL¿FDWLRQV7HFKQLTXHVGHOD&RPSpWLWLRQLO VHUDSURFpGpjXQPDUTXDJHGXFKkVVLVHWGHVSLqFHVSULQFLSDOHVGHVPRWHXUVFDUWHUHWF\OLQGUH/HVFKkVVLVHW PRWHXUVVHURQWPDUTXpVDXPR\HQGHFRGHVEDUUHV/HV FKkVVLVHWPRWHXUVVHURQWLGHQWL¿pVSDUGHVDXWRFROODQWVj codes-barres fournis et mis en place par les Commissaires 7HFKQLTXHV/HVPRWHXUVTXLVHURQWPDUTXpVGHGHX[ autocollants (un sur le cylindre, l’autre sur un 1/2 carter), GHYURQWFRPSRUWHUGHVHPSODFHPHQWVGH[PP totalement propres et dégraissés, et fraisés selon les posiWLRQVGpFULWHVVXUXQHDQQH[HjOD)LFKHG¶+RPRORJDWLRQ ¬tout moment de la Compétition, les marquages devront rWUHLQWDFWVHWSDUIDLWHPHQWOLVLEOHV,OHVWLQWHUGLWG¶DSSOLquer un matériau ou un produit quelconque sur les marTXDJHV8QPDUTXDJHGpWpULRUpRXLOOLVLEOHTX¶HOOHTX¶HQ soit la raison, sera passible pour le Pilote concerné de O¶H[FOXVLRQGHOD&RPSpWLWLRQ/DPrPHVDQFWLRQVHUD DSSOLFDEOHHQFDVG¶pFKDQJHGHPDWpULHOHQWUH3LORWHV/HV Concurrents concernés et tous les Pilotes qu’ils auront insFULWVSRXUURQWrWUHH[FOXVGHOD&RPSpWLWLRQFRQFHUQpH Avant et après chaque séance d’Essais, chaque Manche HWFKDTXH&RXUVHGHODSKDVH¿QDOHOHV&RPPLVVDLUHV 7HFKQLTXHVSRXUURQWYpUL¿HUVLOHPDUTXDJHGXPDWpULHO HVWFRQIRUPH¬OD¿QGHFKDTXHVpDQFHG¶(VVDLVGH FKDTXH0DQFKHHWGHFKDTXH&RXUVHGHODSKDVH¿QDOHOH 3LORWHGHYUDV¶DVVXUHUTXHOHVPDUTXDJHVVRQWLQWDFWV6L un marquage subit une altération ou une déformation, le Pilote devra en informer immédiatement le(s) Délégué(s) Technique(s) ou le Commissaire Technique en Chef avant GHTXLWWHUOH3DUFG¶$VVLVWDQFH C. At Scrutineering of the Competition, the chassis and the main engine parts (1/2 crankcase and cylinder) will be marked. The chassis and engines will be marked by means RIEDUFRGHV7KHFKDVVLVDQGHQJLQHVZLOOEHLGHQWL¿HGE\ means of bar code stickers to be supplied and applied by the Scrutineers. The engines, which will be marked by two stickers (one on the cylinder and the other on a 1/2 crankcase), shall comprise spaces of 28 x 20 mm, totally clean without any grease, and milled in accordance with the locations described on an appendix to the Homologation Form. At all times throughout the Competition these markings shall be intact and perfectly readable. It is forbidden to apply any material or product on the markings. A Driver with a marking that is damaged or unreadable for whatever reason will be liable to exclusion from the Competition. The same sanction will be applicable in the Competition of an exchange of equipment between Drivers. The Entrants concerned and all the Drivers they have entered may be excluded from the Competition concerned. Before and after every Practice session, every Heat and HYHU\5DFHRIWKH¿QDOSKDVHWKH6FUXWLQHHUVPD\FRQtrol whether the marking of the equipment complies with the rule. At the end of every Practice session, of every +HDWDQGRIHYHU\5DFHRIWKH¿QDOSKDVHWKH'ULYHUVKDOO ensure that his markings are intact. If a marking has undergone an alteration or a deformation, the Driver shall immediately inform the Technical Delegate(s) or the Chief Scrutineer before leaving the Servicing Park. '/¶pFKDQJHGHPRWHXUVGHFKkVVLVGHO¶HQVHPEOHGX FKkVVLVPRWHXUHWGHVSQHXVHVWLQWHUGLWHQWUHOHVGLIIpUHQWV3LORWHV$XFXQFKDQJHPHQWGXFKkVVLVGXPRWHXURX GHO¶HQVHPEOHGXFKkVVLVPRWHXUQHSRXUUDrWUHHIIHFWXp pendant la procédure de départ ni entre le départ et l’arriYpHGHV(VVDLV4XDOL¿FDWLIV0DQFKHV4XDOL¿FDWLYHV5HSrFKDJHRX3Up)LQDOHVHW)LQDOH/HVFRQWUHYHQDQWVVHURQW H[FOXVGHOD&RPSpWLWLRQFRQFHUQpH D. Changing engines, chassis, the chassis/engine unit and tyres between the various Drivers is forbidden. No change of the chassis, of the engine or of the chassis/ engine unit may be carried out during the starting proceGXUHRUEHWZHHQWKHVWDUWDQG¿QLVKRIWKH4XDOLI\LQJ3UDFWLFH4XDOLI\LQJ+HDWV6HFRQG&KDQFH+HDWRU3UH)LQDOV and Final. Offenders will be excluded from the Competition concerned. (/HV\VWqPHGHPHVXUHGXUpJLPHPD[LPXPIRXUQLSDU OD&,.),$SRXUUDrWUHXWLOLVpGDQVOHVFDWpJRULHVRXQH OLPLWHGHUpJLPHHVWSUHVFULWH&HV\VWqPHVHUYLUDjOD transmission en temps réel et au stockage des données GHUpJLPHVPD[LPDDFTXLVHV,OGHYUDrWUHLQVWDOOpGDQV OHVWULFWUHVSHFWGHVLQVWUXFWLRQV\DIIpUHQWHV,OVHUDGHOD responsabilité des Concurrents de l’installer et de le faire IRQFWLRQQHUFRUUHFWHPHQW,OVHUDpJDOHPHQWGHODUHVSRQsabilité des Concurrents de s’assurer que le moteur ne GpSDVVHSDVOHUpJLPHPD[LPDODXWRULVp$FKDTXHUHWRXU GDQVOD]RQHGX3DUF)HUPpOHVNDUWVGHYURQWrWUHPLVj GLVSRVLWLRQSRXUYpUL¿FDWLRQHWWpOpFKDUJHPHQWGHVGRQQpHV7RXWHYpUL¿FDWLRQVHIHUDHQSUpVHQFHGX3LORWHHWRX E. The maximum RPM measurement system supplied by the CIK-FIA may be used in categories where an engine speed limit is prescribed. This system shall be used for real time transmission and for the storage of the logged maximum RPM data. It must be installed in strict accordance with the corresponding instructions. All Entrants are themselves responsible for the correct installation and the correct functioning thereof. It will also be the Entrants’ responsibility to ensure that the engine does not exceed the maximum authorised engine speed. At each return to the Parc Fermé area, the karts must be available for checking and downloading the data. Every check will be carried out in the presence of the Driver and/or of the «A» PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS GX0pFDQLFLHQ©$ªFRQFHUQp Mechanic concerned. )&RQWU{OHGHVHPEUD\DJHVGHVPRWHXUV.)SDUV\VWqPH d’acquisition de données embarqué sur les karts et fourni SDUOD&,.),$ Ce système doit être utilisé pendant les Compétitions et VHUYLUDXQLTXHPHQWDXVWRFNDJHGHVGRQQpHVDFTXLVHV&H système doit être installé dans le strict respect des instructions de montage communiquées par la CIK-FIA et doit IRQFWLRQQHUjWRXWPRPHQWSHQGDQWOHV(VVDLV0DQFKHVHW &RXUVHV Il est de la responsabilité de tous les Concurrents d’installer dans le Parc d’Assistance «Départ» le système distribué SDUOD&,.),$HWGHOHIDLUHIRQFWLRQQHUFRUUHFWHPHQW F. Control of KF engine clutches by means of a data logging system carried on board the karts and supplied by the CIK-FIA. This system must be used during the Competitions, exclusively for the storing of the data logged. This system must be installed in strict accordance with the mounting instructions given by the CIK-FIA and must work at all times during Practice, Heats and Races. Le poids du système est inclus dans le poids minimum du .DUW Il est de la responsabilité des Concurrents de s’assurer que le patinage de l’embrayage ne dépasse pas le seuil maxiPDODXWRULVpHPEUD\DJHHQSULVHGLUHFWHj WUPLQPD[LPXPHQWRXWHVFRQGLWLRQV ¬OD¿QGHFKDTXHVpDQFHG¶(VVDLV0DQFKHHWRX&RXUVH OHVNDUWVGRLYHQWrWUHPLVjGLVSRVLWLRQGHV&RPPLVVDLUHV Techniques dans le Parc d’Assistance «Arrivée» pour récuSpUDWLRQHWYpUL¿FDWLRQGHVV\VWqPHVG¶DFTXLVLWLRQHWSRXU H[SRUWDWLRQGHVGRQQpHV &HV\VWqPHG¶DFTXLVLWLRQGHGRQQpHVYpUL¿HDXPLQLPXP - le régime moteur ; ODYLWHVVHGHVURXHVDUULqUH Ce système d’acquisition de données permet d’analyser au minimum: - le régime moteur ; - la vitesse des roues arrière ; OHUDWLRHQWUHFHVGRQQpHV Après exportation des données par un Commissaire Technique dans le Parc d’Assistance «Arrivée», il analysera les GRQQpHVHWYpUL¿HUDTXHOHIRQFWLRQQHPHQWGHO¶HPEUD\DJH HVWFRQIRUPH'DQVOHFDVRXQSDWLQDJHGHO¶HPEUD\DJH DXGHOjGXVHXLOPD[LPXPDXWRULVpVHUDLWFRQVWDWpOH &RPPLVVDLUH7HFKQLTXHGUHVVHUDXQUDSSRUWjO¶DWWHQWLRQ du/des Délégué(s) Technique(s) et des Commissaires 6SRUWLIV /HVFRWVGHUpSDUDWLRQFRQVpFXWLIVjWRXWHQGRPPDJHment du système d’acquisition de données embarqué par OHV&RQFXUUHQWVVHURQWHQWLqUHPHQWjODFKDUJHGHFHX[FL All Competitors are responsible for the installation, in the “Start” Servicing Park, of the data logging system distributed by the CIK-FIA and they must make it function correctly. The weight of the system is included in the minimum weight of the kart. It is the Competitors’ responsibility to ensure that the slip of the clutch does not exceed the maximum authorised threshold (direct drive clutch, 100%, at 5,000 rpm maximum, under all circumstances). At the end of each Practice session, Heat and/or Race, the karts must be available for checking by the Scrutineers in the “Finish” Servicing Park so that they can collect and check the data logging systems, and export the data concerned. This data logging system checks as a minimum: - the engine speed; - the speed of the rear wheels. With this data logging system it is possible to analyse as a minimum: - the engine speed; - the speed of the rear wheels; - the ratio between these 2 data. Once a Scrutineer has exported the data in the “Finish” Servicing Park, he will analyse the data and check that the functioning of the clutch complies with the regulations. Should it be ascertained that the clutch spins beyond the maximum authorised threshold, the Scrutineer will draw up a report for the attention of the Technical Delegate(s) and of the Stewards. The costs connected with the repairing of a data logging system damaged by a Competitor shall be completely borne by the latter. *&RQWU{OHGHVGpFLEHOV (QDSSOLFDWLRQFRQMRLQWHDYHFO¶$UWLFOHGX5qJOHPHQW Technique, en cas de dépassement du seuil autorisé de bruit, les pénalités suivantes seront appliquées : /RUVGHV(VVDLV4XDOL¿FDWLIV SpQDOLWpGHSODFHVSRXUWRXWGpSDVVHPHQWMXVTX¶jG% DXGHOjGXVHXLOSUHVFULW - pénalité de 6 places pour tout dépassement compris HQWUHHWG%DXGHOjGXVHXLOSUHVFULW SpQDOLWpGHSODFHVSRXUWRXWGpSDVVHPHQWFRPSULV HQWUHHWG%DXGHOjGXVHXLOSUHVFULW UpWURJUDGDWLRQDXPLQLPXPjODGHUQLqUHSODFHGXFODVsement pour tout dépassement du seuil prescrit de plus GHG% G. Noise Control In joint application with Article 2.19.1 of the Technical Regulations, if a kart exceeds the authorised noise level WKHIROORZLQJSHQDOWLHVZLOOEHLQÀLFWHG 'XULQJ4XDOLI\LQJ3UDFWLFH - penalty of 3 places for up to 1 dB exceeding the prescribed noise limit; - penalty of 6 places for excesses comprised between 1 and 2 dB beyond the prescribed noise limit; - penalty of 9 places for excesses comprised between 2 and 3 dB beyond the prescribed noise limit; - a Driver whose kart’s noise exceeds the prescribed noise OLPLWE\PRUHWKDQG%ZLOOEHFODVVL¿HGODVWDVDPLQLmum. /RUVGHV0DQFKHV4XDOL¿FDWLYHVHWORUVGHODSKDVH¿QDOH 'XULQJWKH4XDOLI\LQJ+HDWVDQGLQWKH¿QDOSKDVH PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS - pénalité en temps de 3 secondes pour tout dépassement MXVTX¶jG%DXGHOjGXVHXLOSUHVFULW - pénalité en temps de 6 secondes pour tout dépassement FRPSULVHQWUHHWG%DXGHOjGXVHXLOSUHVFULW SpQDOLWpHQWHPSVGHVHFRQGHVSRXUWRXWGpSDVVHPHQW FRPSULVHQWUHHWG%DXGHOjGXVHXLOSUHVFULW UpWURJUDGDWLRQDXPLQLPXPjODGHUQLqUHSODFHGXFODVsement pour tout dépassement du seuil prescrit de plus GHG% - time penalty of 3 seconds for up to 1 dB exceeding the prescribed noise limit; - time penalty of 6 seconds for excesses comprised between 1 and 2 dB beyond the prescribed noise limit; - time penalty of 9 seconds for excesses comprised between 2 and 3 dB beyond the prescribed noise limit; - a Driver whose kart’s noise exceeds the prescribed noise OLPLWE\PRUHWKDQG%ZLOOEHFODVVL¿HGODVWDVDPLQLmum. ,OUHVWHGXSRXYRLUGHV&RPPLVVDLUHV6SRUWLIVG¶LQÀLJHUXQH H[FOXVLRQHQFDVG¶LQIUDFWLRQVXSpULHXUHjFHVYDOHXUVHW RXUpSpWLWLYH The Stewards always have the power to exclude a Driver ZKRVHLQIULQJHPHQWLVRYHUWKHVH¿JXUHVDQGRUUHSHWLWLYH Les mesures de bruit seront systématiquement effectuées GqVOHV(VVDLV/LEUHV Noise controls will systematically be carried out from Free Practice onwards. +3URFpGXUHGH3HVDJH D$SUqVOHV(VVDLV4XDOL¿FDWLIVOHV0DQFKHV4XDOL¿FDWLYHV HWOHVFRXUVHVGHODSKDVH¿QDOHFKDTXHNDUWIUDQFKLVVDQWOD/LJQHVHUDSHVp6LOHNDUWQHSHXWDUULYHUMXVTX¶j la Zone du Pesage par ses propres moyens, il sera placé sous le contrôle exclusif des Commissaires de Piste, qui l’y conduiront ou l’y feront conduire, et le Pilote devra se UHQGUHjOD=RQHGH3HVDJHGqVVRQUHWRXUDX[VWDQGVD¿Q TXHVRQSRLGVVRLWpWDEOL H. Weighing Procedure D$IWHU4XDOLI\LQJ3UDFWLFHWKH4XDOLI\LQJ+HDWVDQGWKH UDFHVRIWKH¿QDOSKDVHHDFKNDUWFURVVLQJWKH/LQHZLOO be weighed. If the kart is unable to reach the Weighing Area by its own means it will be placed under the exclusive control of Marshals, who will take it there or have it taken there, and the Driver shall report to the Weighing Area as soon as he returns to the pits so that his weight may be established. E¬O¶LVVXHGHV(VVDLV4XDOL¿FDWLIVOH3LORWHHWVRQNDUW VHURQWSHVpVVLPXOWDQpPHQWSXLVVpSDUpPHQW6LSRXUGHV raisons de force majeure, le Pilote n’était pas en mesure GHVHSUpVHQWHUjODEDODQFHDXWHUPHG¶XQH0DQFKH4XDOL¿FDWLYHRXG¶XQHFRXUVHGHODSKDVH¿QDOHVRQNDUWVHUDLW pesé seul et au poids du kart serait ajouté celui du Pilote HQUHJLVWUpjO¶LVVXHGHV(VVDLV4XDOL¿FDWLIV E$WWKHHQGRI4XDOLI\LQJ3UDFWLFHWKH'ULYHUDQGKLVNDUW will be weighed simultaneously then separately. Should for reasons of force majeure the Driver be unable to go to the VFDOHVDWWKHHQGRID4XDOLI\LQJ+HDWRURIDUDFHRIWKH ¿QDOSKDVHKLVNDUWZRXOGEHZHLJKHGRQLWVRZQDQGWKH 'ULYHU¶VZHLJKWUHJLVWHUHGDIWHU4XDOLI\LQJ3UDFWLFHZRXOG be added to that of the kart. c) Aucune matière ou substance solide, liquide, gazeuse ou de quelque nature que ce soit, ne pourra être ajoutée jXQNDUW\rWUHSRVpHRXHQrWUH{WpHDYDQWOH3HVDJH (sauf par un Commissaire Technique dans le cadre de ses DFWLYLWpVRI¿FLHOOHV c) No solid, liquid or gaseous matter or substance of any nature whatsoever may be added to a kart, placed on it or removed from it before Weighing (except by a Scrutineer ZLWKLQWKHIUDPHZRUNRIKLVRI¿FLDOGXWLHV G6HXOVOHV&RPPLVVDLUHV7HFKQLTXHVHWOHV2I¿FLHOV SHXYHQWSpQpWUHUGDQVOD=RQHGX3HVDJH$XFXQHLQWHUvention, quelle qu’elle soit, n’est autorisée dans cette Zone, jPRLQVTX¶HOOHQ¶DLWpWpSHUPLVHSDUFHV2I¿FLHOV G2QO\6FUXWLQHHUVDQG2I¿FLDOVPD\SHQHWUDWHLQWKH:HLghing Area. No intervention whatsoever is allowed in that $UHDXQOHVVLWKDVEHHQDXWKRULVHGE\WKHVH2I¿FLDOV H8QNDUWRXXQ3LORWHQHSHXYHQWSDVTXLWWHUOD=RQHGX Pesage sans l’autorisation du Délégué Technique de la CIK),$RXGX&RPPLVVDLUH7HFKQLTXH e) A kart or a Driver are not allowed to leave the Weighing Area without the authorisation of the CIK-FIA Technical Delegate (or Scrutineer). f) Toute infraction aux présentes dispositions relatives au 3HVDJHGHVNDUWVSRXUUDHQWUDvQHUO¶DSSOLFDWLRQG¶XQHSpQDOLWpDX3LORWHHWNDUWFRQFHUQpV f) Any infringement to these provisions relating to the Weighing of karts may entail the imposition of a penalty on the Driver and kart concerned. J/¶2UJDQLVDWHXUGLVSRVHUDODEDODQFHVRXVXQDEULj l’entrée du Parc Assistance «Arrivée» et devra prévoir un SHUVRQQHOVXI¿VDQWSRXUDVVXUHUODPLVHHQSODFHGXNDUW VXUODEDODQFH/HV0pFDQLFLHQVVHURQWWHQXVjO¶pFDUWGHV NDUWVMXVTX¶jFHTXHOD3URFpGXUHGH3HVDJHGHOHXUNDUW VRLWWHUPLQpH g) The Organiser shall place the scales under a shelter at the entrance to the «Finish» Servicing Park and must SURYLGHIRUVXI¿FLHQWSHUVRQQHOWRHQVXUHWKHSODFLQJRIWKH kart on the scales. Mechanics will be kept away from the karts until the Weighing Procedure of their karts is over. K6LOHSRLGVG¶XQ3LORWHHWGHVRQNDUWHVWLQIpULHXUjFHOXL h) If the weight of a Driver and of his kart is under that PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS VSpFL¿pGDQVOH5qJOHPHQW7HFKQLTXHOHUpVXOWDWVHUD communiqué par écrit au Concurrent, et le kart et son 3LORWHVHURQWH[FOXVGHODVpDQFHG¶(VVDLV4XDOL¿FDWLIVRX GHOD0DQFKH4XDOL¿FDWLYHFRQFHUQpHVRXV¶DJLVVDQWG¶XQH &RXUVHGHSKDVH¿QDOHDXPLQLPXPFODVVpVGHUQLHUOHFDV pFKpDQWVDQVDWWULEXWLRQGHSRLQWDX&KDPSLRQQDW VSHFL¿HGLQWKH7HFKQLFDO5HJXODWLRQVWKHUHVXOWZLOOEH communicated in writing to the Entrant, and the kart and LWV'ULYHUZLOOEHH[FOXGHGIURPWKH4XDOLI\LQJ3UDFWLFHVHVVLRQRUIURPWKH4XDOLI\LQJ+HDWFRQFHUQHGRULQWKHFDVH RID¿QDOSKDVH5DFHDVDPLQLPXPFODVVL¿HGODVWZLWKRXW allocation of any Championship points, if applicable). L/¶2UJDQLVDWHXUGHYUDSUpYRLUGHVSRLGVFHUWL¿pVSRXUOH FDOLEUDJHGHODEDODQFH L7KH2UJDQLVHUPXVWSURYLGHIRUFHUWL¿HGZHLJKWVIRUWKH calibration of the scales. 12 - Numéros de compétition et nom du Pilote $/HVQXPpURVGHFRPSpWLWLRQVHURQWFRQIRUPHVDX[GLVSRVLWLRQVGHO¶$UWLFOHGX5qJOHPHQW7HFKQLTXH 12 - Racing numbers and name of the Driver A. Racing numbers shall comply with the provisions of Article 24 of the Technical Regulations. %/HQRPGX3LORWHGRLWrWUHLQVFULWVXUFKDTXHFDUURVVHULH ODWpUDOHHWrWUHIDFLOHPHQWOLVLEOHFRQIRUPpPHQWjO¶$UWLFOH GX5qJOHPHQW7HFKQLTXH(Q&KDPSLRQQDWGX0RQGH LOGRLWHQRXWUHDSSDUDvWUHHQJUDQGHVOHWWUHVEURGpHVVXU la combinaison, dans le haut du dos et sur chacune des MDPEHV B. The name of the Driver shall appear on each side of the lateral bodywork and be clearly legible, in accordance with Article 24 of the Technical Regulations. In the World Championship, it must also appear in large letters embroided on his overall, at the top of his back and on each of his legs. &/HGUDSHDXGHODQDWLRQDOLWpGX3LORWHVHUDFHOXLpTXLYDODQWjODQDWLRQDOLWpGHVDOLFHQFHVDXIHQ&KDPSLRQQDWGX 0RQGHRODQDWLRQDOLWpGX3LORWHVHUDFHOOHTXLpTXLYDXWj ODQDWLRQDOLWpGHVRQSDVVHSRUW &7KHÀDJRIWKH'ULYHU¶VQDWLRQDOLW\VKDOOEHWKDWRI the nationality of his licence, except in the World Championship, where the Driver’s nationality will be the one appearing on his passport. 13 - Accès au Paddock Dès leur arrivée, les Concurrents et Concurrents/Pilotes engagés devront se présenter au Secrétariat de l’OrganiVDWHXUSRXUOHXULGHQWL¿FDWLRQVXLYDQWODUpJOHPHQWDWLRQ GHVFKDPSLRQQDWVFRQFHUQpV 13 - Access to the Paddock As soon as they arrive, all Entrants and Entrants/Drivers entered must present themselves to the Organiser’s SeFUHWDULDWIRULGHQWL¿FDWLRQDFFRUGLQJWRWKHUHJXODWLRQVRI the championships concerned). Il leur sera remis : a) 1 laissez-passer Concurrent (si le Concurrent n’est pas le Pilote lui-même), b) 1 laissez-passer Pilote (par Pilote inscrit), c) 2 laissez-passer Mécanicien (par Pilote inscrit), dont un donnant accès aux Parcs d’Assistance, d) 1 laissez-passer Invité (par Pilote inscrit), donnant accès au Paddock, HODLVVH]SDVVHU9pKLFXOH©3DGGRFNªSDU&RQFXUUHQW inscrit), IODLVVH]SDVVHU9pKLFXOH©QRQ3DGGRFNªSDU&RQFXUrent inscrit si le Concurrent n’est pas le Pilote lui-même), JODLVVH]SDVVHU9pKLFXOH©QRQ3DGGRFNªSDU3LORWH LQVFULW Seuls les Concurrents engagés auront un espace attribué dans le Paddock (une surface gratuite par Pilote engagé de [P Les Concurrents ne pourront occuper que les emplacements de Paddock qui leur auront été attribués et qui DXURQWpWpGpVLJQpVSDUOD&,.),$7RXW&RQFXUUHQWQH respectant pas cette réglementation se verra expulsé du 3DGGRFNHWH[FOXGHOD&RPSpWLWLRQ $XFXQHPRGL¿FDWLRQQHSRXUUDrWUHDSSRUWpHDXSODQGX 3DGGRFNpWDEOLSDUOD&,.),$'qVO¶RXYHUWXUHGX3DGGRFN aux Concurrents (conformément aux règlements des FKDPSLRQQDWVFRQFHUQpVGXUDQWODVHPDLQHRVHGpURXOH ODPDQLIHVWDWLRQO¶2UJDQLVDWHXUPHWWUDjGLVSRVLWLRQOH personnel nécessaire pour assurer le respect du plan du 3DGGRFN7RXVOHVDFFqVDX3DGGRFNGRLYHQWrWUHFRQWU{OpV GqVOHGpEXWGHODPDQLIHVWDWLRQ They will be given: a) 1 Entrant’s pass (if the Entrant is not the Driver himself), b) 1 Driver’s pass (per entered Driver), c) 2 Mechanics’ passes (per entered Driver), including one giving access to the Servicing Parks, d) 1 Guest’s pass (per entered Driver), giving access to the Paddock, e) 1 « Paddock» Vehicle pass (per entered Entrant), f) 1 « non-Paddock» Vehicle pass (per entered Entrant if the Entrant is not the Driver himself), g) 1 « non-Paddock» Vehicle pass (per entered Driver). Only entered Entrants will have a space allocated in the Paddock (one free 6 x 9 m surface per entered Driver). Entrants may occupy only those Paddock spaces that have been allocated to them and designated by the CIK-FIA. Any Entrant who does not respect this rule shall be expulsed from the Paddock and excluded from the Competition. 1RPRGL¿FDWLRQPD\EHPDGHWRWKH3DGGRFNSODQ$V soon as the Paddock is open to Entrants (according to the regulations of the championships concerned) in the week in which the meeting is held, the Organiser shall supply the necessary staff in order to ensure the respect of the Paddock plan. All access to the Paddock must be controlled from the very beginning of the meeting. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS /¶2UJDQLVDWHXUSRXUUDGpOLYUHUGHVODLVVH]SDVVHU9LVLWHXUV SD\DQWVVXUEDVHG¶XQWDULIPD[LPXP(XURVGpWHUminé par la CIK-FIA pour l’accès au Paddock, mais sans YpKLFXOH On the basis of a maximum fee (40 Euros) determined by the CIK-FIA, the Organiser may deliver paying Visitors’ passes giving access to the Paddock, but without a vehicle. Toutes les personnes détenant un laissez-passer permanent délivré par la CIK-FIA pour l’année en cours auront OLEUHDFFqVDX3DGGRFNPDLVVDQVYpKLFXOH ,OH[LVWHW\SHVGHODLVVH]SDVVHUSHUPDQHQWV&,.),$ - «Trade» - «Media» - «Guest» ©2I¿FLDOª Anyone holding a permanent pass issued by the CIK-FIA for the current year will have free access to the Paddock, but without a vehicle. There are 4 types of CIK-FIA permanent passes: - «Trade» - «Media» - «Guest» ©2I¿FLDOª 14 - Accès au Parc Assistance «Départ» Seuls le Pilote et son Mécanicien porteur du laissez-passer UHTXLV©0pFDQLFLHQ$ªVRQWDXWRULVpVjSpQpWUHUGDQVOH 3DUF$VVLVWDQFH©'pSDUWªDYHFOHNDUWGX3LORWH 14 - Access to the «Start» Servicing Park Only the Driver and his Mechanic holder of the required pass («Mechanic A») are entitled to penetrate in the «Start» Servicing Park, with the Driver’s kart. 15 - Carburant Dans le cadre de certains Championnats, l’essence pourra rWUHIRXUQLHSDUXQVHXOHWPrPH3pWUROLHUjODVXLWHG¶XQ DSSHOG¶RIIUHVUpDOLVpSDUOD),$ 15 - Fuel Within the framework of certain Championships, petrol may be supplied by one and the same fuel Company following an invitation to tender issued by the FIA. %ULH¿QJ $VVLVWHUDX%ULH¿QJHVWREOLJDWRLUH7RXW&RQFXUUHQWHWWRXW 3LORWHQ¶pWDQWSDVSUpVHQWDX%ULH¿QJVHYHUUDLQÀLJHUXQH amende obligatoire de 125 Euros qui devra être payée aux Commissaires Sportifs de la CIK-FIA avant que le &RQFXUUHQWHWOH3LORWHQHVRLHQWDXWRULVpVjSRXUVXLYUHOD PDQLIHVWDWLRQ %ULH¿QJ $WWHQGLQJWKH%ULH¿QJLVPDQGDWRU\%HIRUHWKH\FDQEH DOORZHGWRFRQWLQXHWKHPHHWLQJDPDQGDWRU\¿QHRI Euros which must be paid to the CIK-FIA Stewards will be LQÀLFWHGRQDQ\(QWUDQWDQG'ULYHUZKRGRQRWDWWHQGWKH %ULH¿QJ 17 - Nombre de karts autorisés en piste Le nombre des karts autorisés en piste (sur circuits courts) HVWOLPLWpjSRXUODSKDVH¿QDOHSRXUOHV(VVDLV 4XDOL¿FDWLIVHWOHV0DQFKHV4XDOL¿FDWLYHVHWSRXUOHV (VVDLV/LEUHV 17 - Number of karts allowed on the track The number of karts allowed on the track (short circuits) is OLPLWHGWRIRU¿QDOSKDVHIRU4XDOLI\LQJ3UDFWLFHDQG WKH4XDOLI\LQJ+HDWVDQGIRU)UHH3UDFWLFH 18 - Déroulement d’une Compétition de Championnat CIK-FIA Toute Compétition de Championnat CIK-FIA se composera G¶(VVDLVOLEUHVG¶(VVDLV4XDOL¿FDWLIVGH0DQFKHV4XDOL¿catives (+ Repêchage éventuel, en fonction du nombre de SDUWLFLSDQWVHWG¶XQHSKDVH¿QDOH 18 - Running of a CIK-FIA Championship Competition Any CIK-FIA Championship Competition shall comprise )UHH3UDFWLFH4XDOLI\LQJ3UDFWLFH4XDOLI\LQJ+HDWVD possible Second Chance Heat, according to the number of SDUWLFLSDQWVDQGD¿QDOSKDVH 18A - Essais Libres Sauf réglementation particulière, l’horaire de la CompétiWLRQGHYUDSUpYRLUGHV(VVDLV/LEUHVSRXUFKDTXHFDWpJRULH Ils seront réservés aux Pilotes engagés dans le ChampionQDWHWDX[3LORWHV:LOG&DUG &HV3LORWHVGRLYHQWDYRLUVDWLVIDLWDX[9pUL¿FDWLRQV6SRUWLYHVHW7HFKQLTXHV6LOHQRPEUHGHV3LORWHVHVWLQIpULHXU jLOVVRQWUpSDUWLVHQGHX[VpULHVSRXUOHVQXPpURV SDLUVHWLPSDLUV6¶LOHVWVXSpULHXUjWURLVVpULHVHQ QRPEUHpJDOVLSRVVLEOHGRLYHQWrWUHSUpYXHV/¶XVDJHGHV WUDQVSRQGHXUVHVWREOLJDWRLUH 18A - Free Practice ([FHSWLQWKHFDVHRIVSHFL¿FUHJXODWLRQVWKHWLPHVFKHdule of the Competition must provide for Free Practice for each category. It will be reserved for Drivers who have entered the Championship and for Wild Card Drivers. Those Drivers must have passed the Sporting Checks and Scrutineering. If the number of Drivers is under 102, they shall be divided into two series for odd and even numbers. If it is more than 102, three series in equal number if possible shall be provided for. The use of transponders is mandatory. %(VVDLV4XDOL¿FDWLIV Les Pilotes ayant satisfait au Contrôle Technique sont répartis en séries égales si possible, par tirage au sort en SUpVHQFHG¶DXPRLQVXQ&RPPLVVDLUH6SRUWLI8QHVpDQFH GHPLQXWHVSDUVpULHHVWSUpYXH&KDTXHVpULHFRPSUHQ- 18B - Qualifying Practice Drivers who have passed Scrutineering are divided into equal series if possible, by drawing lots in the presence of at least one Steward. One 8 minute session per series is provided for. Each series will comprise a maximum PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS GUDXQQRPEUHPD[LPXPGH3LORWHV/RUVGHODVpDQFH OH3LORWHSUHQGUDOHGpSDUWDXPRPHQWGHVRQFKRL[7RXW 3LORWHD\DQWIUDQFKLODOLJQHWUDFpHjODVRUWLHGHO¶DLUHGH départ sera considéré comme ayant pris le départ et son temps sera pris en compte, quelles que soient les circonsWDQFHV7RXVOHVWRXUVFRPSOHWVVRQWSULVHQFRPSWH/H temps retenu est celui du meilleur tour effectué lors de la VpDQFH(QFDVG¶H[ TXROHe meilleur temps accompli sera déterminant, et ainsi de suite en cas de nouvel ex TXR/HFODVVHPHQW¿QDOGHV(VVDLV4XDOL¿FDWLIVVHUD établi comme suit: - S’il y a une seule série : la grille sera déterminée dans l’ordre des temps les plus rapides réalisés par chaque 3LORWH - S’il y a deux séries et si le meilleur temps de la série ODPRLQVUDSLGHQHGpSDVVHSDVGXPHLOOHXUWHPSV réalisé dans la série la plus rapide : le classement sera déterminé par l’ordre des temps les plus rapides réalisés par FKDTXH3LORWH - S’il y a deux séries et si le meilleur temps de la série ODPRLQVUDSLGHGpSDVVHGXPHLOOHXUWHPSVUpDOLVp dans la série la plus rapide : 1ère place au meilleur temps de la 1ère série (meilleur temps absolu), 2e place au meilleur temps de la 2e série, 3e place au 2e meilleur temps de la 1èreVpULHe place au 2e meilleur temps de la 2e série, 5e place au 3e meilleur temps de la 1ère série, et ainsi de VXLWH - S’il y a trois séries et si le meilleur temps de la série la PRLQVUDSLGHQHGpSDVVHSDVGXPHLOOHXUWHPSV réalisé dans la série la plus rapide : le classement sera déterminé par l’ordre des temps les plus rapides réalisés par FKDTXH3LORWH - S’il y trois séries et si le meilleur temps de la série la PRLQVUDSLGHGpSDVVHGXPHLOOHXUWHPSVUpDOLVp dans la série la plus rapide : 1ère place au meilleur temps de la 1ère série (meilleur temps absolu), 2e place au meilleur temps de la 2e série, 3e place au meilleur temps de la 3eVpULHe place au 2e meilleur temps de la 1ère série, 5e place au 2e meilleur temps de la 2eVpULHHWDLQVLGHVXLWH - Et ainsi de suite selon le même principe s’il y a davanWDJHGHVpULHV Si aucun temps n’est pris en compte pour un Pilote, il SUHQGUDOHGpSDUWHQ¿QGHJULOOH6LSOXVLHXUV3LORWHVVRQW dans cette situation, leur position de départ sera tirée au VRUW7RXWDUUrWG¶XQ3LORWHHQ=RQHGH5pSDUDWLRQVRXHQ 3DUFG¶$VVLVWDQFHVHUDGp¿QLWLI(QDXFXQFDVLOQHOXLVHUD SHUPLVGHUHSDUWLU Pour la catégorie Superkart, voir réglementation particuOLqUH number of 36 Drivers. During the session, Drivers will take the start when they choose. Any Driver having crossed the line drawn at the exit of the start area will be considered as having started, and his lap time will be taken into account, whatever the circumstances. Any lap fully covered is counted. The time retained is that of the best lap covered during the session. Any ties will be decided by the 2nd best time set by each Driver, and so on in the case of further ties. 7KH¿QDOFODVVL¿FDWLRQRI4XDOLI\LQJ3UDFWLFHZLOOEHGUDZQ up as follows : - If there is only one series: the grid will be drawn up in the order of the fastest time achieved by each Driver. - If there are two series and if the fastest time achieved in the slower series is not more than 101% of the fastest WLPHDFKLHYHGLQWKHIDVWHUVHULHVWKHFODVVL¿FDWLRQZLOOEH determined by the order of the fastest times achieved by each Driver. - If there are two series and if the fastest time achieved in the slower series is more than 101% of the fastest time achieved in the faster series: 1st place goes to the fastest time of the 1st series (fastest time overall), 2nd place to the fastest time of the 2nd series, 3rd place to the 2nd fastest time of the 1st series, 4th place to the 2nd fastest time of the 2nd series, 5th place to the 3rd fastest time of the 1st series, and so on. - If there are three series and if the fastest time achieved in the slowest series is not more than 101% of the fastest time achieved in the fastest seriesWKHFODVVL¿FDWLRQZLOO be determined by the order of the fastest times achieved by each Driver. - If there are three series and if the fastest time achieved in the slowest series is more than 101% of the fastest time achieved in the fastest series: 1st place to the fastest time of the 1st series (fastest time overall), 2nd place to the fastest time of the 2nd series, 3rd place to the fastest time of the 3rd series, 4th place to the 2nd fastest time of the 1st series, 5th place to the 2nd fastest time of the 2nd series, and so on. - And so on according to the same principle if there are further series. If no time is taken into account for a Driver, he shall take the start at the end of the grid. If several Drivers are in that situation, their starting positions shall be decided by drawing lots. If a Driver stops in the Repairs Area or in the 6HUYLFLQJ3DUNLWZLOOEH¿QDO+HVKHZLOOQRWEHDOORZHG to restart. )RUWKH6XSHUNDUWFDWHJRU\VHHWKHVSHFL¿FUHJXODWLRQV &0DQFKHV4XDOL¿FDWLYHV Cas A : 36 participants ou moins - Deux Manches QuaOL¿FDWLYHVPLQLPXPVHURQWFRXUXHVDYHFWRXVOHV3LORWHV Les grilles de départ de chacune des Manches seront étaEOLHVVXUEDVHGHVUpVXOWDWVGHV(VVDLV4XDOL¿FDWLIV 18C - Qualifying Heats Case A : 36 participants or less $WOHDVWWZR4XDOLI\LQJ Heats will be run with all the Drivers. The starting grids of each of the Heats will be established on the basis of the UHVXOWVRI4XDOLI\LQJ3UDFWLFH Cas B : 37 à 74 participants ¬O¶LVVXHGHV(VVDLV4XDOL¿FDWLIVOHV3LORWHVVHURQWUpSDUWLVGDQVGHVJURXSHV SRXUOHV0DQFKHV4XDOL¿FDWLYHV/HQRPEUHGH3LORWHV SDUJURXSHVHUDGHPD[LPXP&KDTXHJURXSHGHYUD FRQFRXULUFRQWUHWRXVOHVDXWUHVJURXSHV Case B : 37 to 74 participants $WWKHHQGRI4XDOLI\LQJ 3UDFWLFH'ULYHUVZLOOEHVHSDUDWHGLQWRJURXSVIRUWKH4XDlifying Heats. The number of Drivers per group will be 18 maximum. Each group must compete versus all the other groups. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS ¬WLWUHG¶H[HPSOHGDQVOHFDVG¶XQHUpSDUWLWLRQGHV 3LORWHVGDQVJURXSHVOH3LORWHFODVVper aux Essais QuaOL¿FDWLIVSDUWLUDGDQVOHJURXSH$OHe dans le groupe B, le 3eGDQVOHJURXSH&OHe dans le groupe D, le 5e dans le groupe A, le 6e dans le groupe B, le 7e dans le groupe C, le 8eGDQVOHJURXSH'HWDLQVLGHVXLWH - As an example, in the case of a separation of Drivers into JURXSVWKH'ULYHUFODVVL¿HGstLQ4XDOLI\LQJ3UDFWLFHZLOO be in group A, the 2nd in group B, the 3rd in group C, the 4th in group D, the 5th in group A, the 6th in group B, the 7th in group C, the 8th in group D, and so on. - Chacun des quatre groupes mentionnés ci-dessus va FRQFRXULUFRQWUHOHVDXWUHVJURXSHVF¶HVWjGLUH$FRQWUH B, A contre C, A contre D, B contre C, B contre D et C FRQWUH'VRLWXQWRWDOGHVL[0DQFKHV4XDOL¿FDWLYHV &KDTXH0DQFKH4XDOL¿FDWLYHDXUDXQHORQJXHXUG¶HQYLURQ RXNPVHORQODFDWpJRULHG¶kJHGHV3LORWHV-XQLRUV 6HQLRUV - Each of the four above-mentioned groups will compete against the other groups, i.e.: A versus B, A versus C, A versus D, B versus C, B versus D and C versus D, namely DWRWDORIVL[4XDOLI\LQJ+HDWV(DFK4XDOLI\LQJ+HDWZLOO have a distance of approximately 10 or 15 km according to the age bracket of Drivers (Juniors/Seniors). 3RXUOHV0DQFKHV4XDOL¿FDWLYHVOHVSRLQWVVHURQWDWWULEXpVFRPPHVXLWSRLQWDXer, 2 points au 2e, 3 points au 3e et ainsi de suite par progression croissante d’un SRLQWSDUSODFH6LXQ3LORWHQHSUHQGSDVOHGpSDUWG¶XQH des Manches, il lui sera crédité un nombre de points égal DXQRPEUHGHVSDUWLFLSDQWVGHVJURXSHV$HW%SOXV Si un Pilote s’est vu présenter le drapeau noir ou a été exclu, il lui sera crédité un nombre de points égal au nombre GHSDUWLFLSDQWVGHVJURXSHV$HW%SOXV )RUWKH4XDOLI\LQJ+HDWVSRLQWVZLOOEHDZDUGHGDVIROlows: 0 point to the 1st, 2 points to the 2nd, 3 points to the 3rd and so on according to an increasing progression of one point per place. If a Driver does not take the start in D4XDOLI\LQJ+HDWKHZLOOUHFHLYHDQXPEHURISRLQWVHTXDO to the number of participants of groups A and B plus 1. ,ID'ULYHUKDVEHHQEODFNÀDJJHGRUH[FOXGHGKHZLOO receive a number of points equal to the number of participants of groups A and B plus 2. - Tout Pilote qui n’aura pas effectué la totalité des tours SUpYXVPrPHV¶LOQ¶DSDVWHUPLQpOD0DQFKH4XDOL¿FDWLYH sera classé selon le nombre de tours qu’il aura réellement HIIHFWXpV - Any Driver who has not covered all the laps scheduled, HYHQLIKHKDVQRW¿QLVKHGWKH4XDOLI\LQJ+HDWZLOOEH FODVVL¿HGDFFRUGLQJWRWKHQXPEHURIODSVKHKDVDFWXDOO\ completed. $O¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVXQFODVVHPHQWLQWHUPpGLDLUHVHUDpWDEOL(QFDVG¶H[ TXRHQWUHGHX[RX plusieurs Pilotes, ils seront départagés en fonction de leur FODVVHPHQWDX[(VVDLV4XDOL¿FDWLIV /HVSUHPLHUV3LORWHVFODVVpVVHURQWTXDOL¿pVSRXUOD SKDVH¿QDOH/HVSUHPLHUV3LORWHVQRQTXDOL¿pVSRXUURQWSDUWLFLSHUjOD0DQFKHGH5HSrFKDJH $WWKHHQGRIWKH4XDOLI\LQJ+HDWVDQLQWHUPHGLDWHFODVVL¿FDWLRQZLOOEHHVWDEOLVKHG3RVVLEOHWLHVEHWZHHQWZRRU PRUH'ULYHUVZLOOEHVHWWOHGDFFRUGLQJWRWKHLUFODVVL¿FDWLRQ LQWKH4XDOLI\LQJ3UDFWLFH 7KH¿UVWFODVVL¿HG'ULYHUVZLOOEHTXDOL¿HGIRUWKH¿QDO SKDVH7KH¿UVWQRQTXDOL¿HG'ULYHUVPD\SDUWLFLSDWHLQ the Second Chance Heat. Cas C : 75 participants et plus¬O¶LVVXHGHV(VVDLV 4XDOL¿FDWLIVOHV3LORWHVVHURQWUpSDUWLVGDQVGHVJURXSHV SRXUOHV0DQFKHV4XDOL¿FDWLYHV/HQRPEUHGH3LORWHV SDUJURXSHVHUDGHPD[LPXP&KDTXHJURXSHGHYUD FRQFRXULUFRQWUHWRXVOHVDXWUHVJURXSHV Case C : 75 participants and more - At the end of the 4XDOLI\LQJ3UDFWLFH'ULYHUVZLOOEHVHSDUDWHGLQWRJURXSV IRUWKH4XDOLI\LQJ+HDWV7KHQXPEHURI'ULYHUVSHUJURXS will be 18 maximum. Each group must compete versus all the other groups. ¬WLWUHG¶H[HPSOHGDQVOHFDVG¶XQHUpSDUWLWLRQGHV 3LORWHVGDQVJURXSHVOH3LORWHFODVVper aux Essais QuaOL¿FDWLIVSDUWLUDGDQVOHJURXSH$OHe dans le groupe B, le 3eGDQVOHJURXSH&OHe dans le groupe D, le 5e dans le groupe A, le 6e dans le groupe B, le 7e dans le groupe C, le 8eGDQVOHJURXSH'HWDLQVLGHVXLWH - Chacun des quatre groupes mentionnés ci-dessus va FRQFRXULUFRQWUHOHVDXWUHVJURXSHVF¶HVWjGLUH$FRQWUH B, A contre C, A contre D, B contre C, B contre D et C FRQWUH'VRLWXQWRWDOGHVL[0DQFKHV4XDOL¿FDWLYHV &KDTXH0DQFKH4XDOL¿FDWLYHDXUDXQHORQJXHXUG¶HQYLURQ RXNPVHORQODFDWpJRULHG¶kJHGHV3LORWHV-XQLRUV 6HQLRUV - As an example, in the case of a separation of Drivers into JURXSVWKH'ULYHUFODVVL¿HGstLQ4XDOLI\LQJ3UDFWLFHZLOO be in group A, the 2nd in group B, the 3rd in group C, the 4th in group D, the 5th in group A, the 6th in group B, the 7th in group C, the 8th in group D, and so on. 3RXUOHV0DQFKHV4XDOL¿FDWLYHVOHVSRLQWVVHURQWDWWULEXpVFRPPHVXLWSRLQWDXer, 2 points au 2e, 3 points au 3e et ainsi de suite par progression croissante d’un SRLQWSDUSODFH6LXQ3LORWHQHSUHQGSDVOHGpSDUWG¶XQH )RUWKH4XDOLI\LQJ+HDWVSRLQWVZLOOEHDZDUGHGDVIROlows: 0 point to the 1st, 2 points to the 2nd, 3 points to the 3rd and so on according to an increasing progression of one point per place. If a Driver does not take the start in - Each of the four above-mentioned groups will compete against the other groups, i.e.: A versus B, A versus C, A versus D, B versus C, B versus D and C versus D, namely DWRWDORIVL[4XDOLI\LQJ+HDWV(DFK4XDOLI\LQJ+HDWZLOO have a distance of approximately 10 or 15 km according to the age bracket of Drivers (Juniors/Seniors). PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS des Manches, il lui sera crédité un nombre de points égal DXQRPEUHGHVSDUWLFLSDQWVGHVJURXSHV$HW%SOXV Si un Pilote s’est vu présenter le drapeau noir ou a été exclu, il lui sera crédité un nombre de points égal au nombre GHSDUWLFLSDQWVGHVJURXSHV$HW%SOXV D4XDOLI\LQJ+HDWKHZLOOUHFHLYHDQXPEHURISRLQWVHTXDO to the number of participants of groups A and B plus 1. ,ID'ULYHUKDVEHHQEODFNÀDJJHGRUH[FOXGHGKHZLOO receive a number of points equal to the number of participants of groups A and B plus 2. - Tout Pilote qui n’aura pas effectué la totalité des tours SUpYXVPrPHV¶LOQ¶DSDVWHUPLQpOD0DQFKH4XDOL¿FDWLYH sera classé selon le nombre de tours qu’il aura réellement HIIHFWXpV - Any Driver who has not covered all the laps scheduled, HYHQLIKHKDVQRW¿QLVKHGWKH4XDOLI\LQJ+HDWZLOOEH FODVVL¿HGDFFRUGLQJWRWKHQXPEHURIODSVKHKDVDFWXDOO\ completed. ¬O¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVOHVSUHPLHUVGX FODVVHPHQWVHURQWTXDOL¿pVSRXUODSKDVH¿QDOH(QFDV d’ex aequo entre deux ou plusieurs Pilotes, ils seront départagés en fonction de leur classement aux Essais 4XDOL¿FDWLIV $WWKHHQGRIWKH4XDOLI\LQJ+HDWVWKH¿UVWFODVVL¿HG 'ULYHUVZLOOEHTXDOL¿HGIRUWKH¿QDOSKDVH3RVVLEOHWLHV between two or several Drivers will be settled according to WKHLUFODVVL¿FDWLRQLQ4XDOLI\LQJ3UDFWLFH 18D - Manche de Repêchage 8QH0DQFKHGH5HSrFKDJHQ¶DXUDOLHXTXHFRQIRUPpPHQW DX©&DV%ªGHO¶$UWLFOH&0DQFKHV4XDOL¿FDWLYHVj SDUWLFLSDQWV 18D - Second Chance Heat A Second Chance Heat will only take place in accordance ZLWK©&DVH%ªRI$UWLFOH&4XDOLI\LQJ+HDWVWR participants). 6HXOVOHVSUHPLHUV3LORWHVQRQTXDOL¿pVSRXUURQWSDUWLFLSHUjOD0DQFKHGH5HSrFKDJHG¶HQYLURQRXNP VHORQODFDWpJRULHG¶kJHGHV3LORWHV-XQLRUV6HQLRUV 2QO\WKH¿UVWQRQTXDOL¿HG'ULYHUVPD\SDUWLFLSDWHLQ the Second Chance Heat of approximately 10 or 15 km (according to the age bracket of the Drivers - Juniors/ Seniors). La Grille de Départ est déterminée en fonction du classePHQWLQWHUPpGLDLUHpWDEOLjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV Starting positions will be determined according to the ,QWHUPHGLDWH&ODVVL¿FDWLRQHVWDEOLVKHGDIWHUWKH4XDOLI\LQJ Heats. /HVSUHPLHUVVHURQWTXDOL¿pVSRXUODSKDVH¿QDOH 7KH¿UVW¿QLVKHUVZLOOEHTXDOL¿HGIRUWKH¿QDOSKDVH Lors de la Manche de Repêchage, tout Pilote en passe d’être doublé ou qui a été doublé par le Pilote en tête de la course pour quelque raison que ce soit se verra présenter le drapeau bleu et rouge (double diagonale) avec son QXPpUR,OGHYUDREOLJDWRLUHPHQWUHMRLQGUHODEDODQFHGDQV le Parc Fermé et sera classé selon le nombre de tours qu’il DXUDUpHOOHPHQWHIIHFWXpV During the Second Chance Heat, any Driver about to be overtaken or who has been overtaken by the race leader for any reason whatsoever will be shown the blue and red ÀDJGRXEOHGLDJRQDOZLWKKLVQXPEHU+HVKDOOFRPSXOsorily go to the scales in the Parc Fermé and will be clasVL¿HGDFFRUGLQJWRWKHQXPEHURIODSVWKDWKHKDVDFWXDOO\ completed. (3KDVH¿QDOH &DV$VXLYDQWODUpJOHPHQWDWLRQGHVFKDPSLRQQDWV concernés) 6¶LO\DSDUWLFLSDQWVRXPRLQVORUVGHOD&RPSpWLWLRQLO\ DXUDXQH3Up)LQDOHHWXQH)LQDOH 18E - Final phase Case A (according to the regulations of the championships concerned): If there are 74 participants or less at the Competition, there will be one Pre-Final and one Final. 3Up)LQDOHRXNPVHORQOHVFDWpJRULHVG¶kJHV/D Grille de Départ est déterminée en fonction du classement LQWHUPpGLDLUHpWDEOLjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV Les six Pilotes repêchés occuperont les dernières places en UHVSHFWDQWO¶RUGUHG¶DUULYpHGHOD0DQFKHGH5HSrFKDJH )LQDOH3LORWHV\SDUWLFLSHURQWRXNPVHORQOHV FDWpJRULHVG¶kJHV Positions de départ déterminées par le classement de la 3Up)LQDOH/HV3LORWHVQRQSDUWDQWVRXH[FOXVGHOD3Up)LQDOHQHVHURQWSDVDXWRULVpVjSDUWLFLSHUjOD)LQDOH * Pre-Final (15 or 20 km according to age brackets): Starting positions will be determined according to the IntermeGLDWH&ODVVL¿FDWLRQHVWDEOLVKHGDIWHUWKH4XDOLI\LQJ+HDWV 7KHVL['ULYHUVTXDOL¿HGLQWKH6HFRQG&KDQFH+HDWZLOO RFFXS\WKHODVWSODFHVUHVSHFWLQJWKH¿QLVKLQJRUGHURI the Second Chance Heat. * Final, 34 Drivers will compete (25 or 30 km according to age brackets). Starting positions according to the Pre-FiQDOFODVVL¿FDWLRQ'ULYHUVZKRGLGQRWWDNHWKHVWDUWRIWKH Pre-Final or were excluded from it will not be authorised to participate in the Final. Lors de la Pré-Finale et Finale, tout Pilote en passe d’être doublé ou qui a été doublé par le Pilote en tête de la course pour quelque raison que ce soit se verra présen- During the Pre-Final and Final, any Driver about to be overtaken or who has been overtaken by the race leader for any reason whatsoever will be shown the blue and red PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS ter le drapeau bleu et rouge (double diagonale) avec son QXPpUR,OGHYUDREOLJDWRLUHPHQWUHMRLQGUHODEDODQFHGDQV le Parc Fermé et sera classé selon le nombre de tours qu’il DXUDUpHOOHPHQWHIIHFWXpV ÀDJGRXEOHGLDJRQDOZLWKKLVQXPEHU+HVKDOOFRPSXOsorily go to the scales in the Parc Fermé and will be clasVL¿HGDFFRUGLQJWRWKHQXPEHURIODSVWKDWKHKDVDFWXDOO\ completed. &DV%VXLYDQWODUpJOHPHQWDWLRQGHVFKDPSLRQQDWV concernés) : Case B (according to the regulations of the championships concerned): S’il y a 75 participants ou plus lors de la Compétition, il y DXUDGHX[3Up)LQDOHV3Up)LQDOHHWHWXQH)LQDOH If there are 75 participants or more at the Competition, there will be two Pre-Finals (Pre-Final 1 and 2) and one Final. /HVSUHPLHUV3LORWHVTXDOL¿pVDSUqVOHV0DQFKHV4XDOL¿catives peuvent aller en Pré-Finale 1 et 2 RXNPSDU 3Up)LQDOHVHORQOHVFDWpJRULHVG¶kJHVsans courir dans XQHPDQFKHGHUHSrFKDJH 7KH¿UVWTXDOL¿HG'ULYHUVDIWHUWKH4XDOLI\LQJ+HDWVDUH eligible to go to the Pre-Final 1 and 2 (15 or 20 km, per Pre-Final, according to age brackets), without running a Second Chance Heat. /HV3LORWHVTXDOL¿pVVHURQWUpSDUWLVDLQVLOHSUHPLHU3LORWH TXDOL¿pSUHQGUDOHGpSDUWGDQVOD3Up)LQDOHOHGHX[LqPH dans la Pré-Finale 2, le troisième dans la Pré-Finale 1, le quatrième dans la Pré-Finale 2, le cinquième dans la Pré)LQDOHOHVL[LqPHGDQVOD3Up)LQDOHHWDLQVLGHVXLWH 7KHTXDOL¿HG'ULYHUVZLOOEHVRGLVWULEXWHGWKH¿UVWTXDOL¿HG'ULYHUWDNHVWKHVWDUWLQWR3UH)LQDOWKHVHFRQGLQWR Pre-Final 2, the third into Pre-Final 1, the fourth into Pre)LQDOWKH¿IWKLQWR3UH)LQDOWKHVL[WKLQWR3UH)LQDO and so on. 3Up)LQDOHVRXNPVHORQOHVFDWpJRULHVG¶kJHV Positions de départ selon le nombre de points obtenus GDQVOHV0DQFKHV4XDOL¿FDWLYHV * Pre-Finals (15 or 20 km according to age brackets): Starting positions according to the number of points obtaiQHGLQWKH4XDOLI\LQJ+HDWV Après les Pré-Finales, les 17 Pilotes classés de la PréFinale 1 avec les 17 pilotes classés de la Pré-Finale 2 sont TXDOL¿pVSRXUOD)LQDOHRXNPVHORQOHVFDWpJRULHV G¶kJHV $IWHUWKH3UH)LQDOVWKH¿UVWFODVVL¿HG'ULYHUVIURP 3UH)LQDODORQJZLWKWKH¿UVWFODVVL¿HG'ULYHUVIURP 3UH)LQDODUHTXDOL¿HGIRUWKH)LQDO(25 or 30 km according to age brackets). La pole-position pour la Finale reviendra au Pilote vainTXHXUGHOD3Up)LQDOHODSOXVUDSLGH The pole position for the Final will be awarded to the Driver who wins the fastest Pre-Final. )LQDOH3LORWHV\SDUWLFLSHURQWRXNPVHORQOHV FDWpJRULHVG¶kJHV Positions de départ déterminées par le classement de la 3Up)LQDOH/HV3LORWHVQRQSDUWDQWVRXH[FOXVGHOD3Up)LQDOHQHVHURQWSDVDXWRULVpVjSDUWLFLSHUjOD)LQDOH * Final, 34 Drivers will compete (25 or 30 km according to age brackets). Starting positions according to the Pre-FiQDOFODVVL¿FDWLRQ'ULYHUVZKRGLGQRWWDNHWKHVWDUWRIWKH Pre-Final or were excluded from it will not be authorised to participate in the Final. Lors des Pré-Finales et Finale, tout Pilote en passe d’être doublé ou qui a été doublé par le Pilote en tête de la course pour quelque raison que ce soit se verra présenter le drapeau bleu et rouge (double diagonale) avec son QXPpUR,OGHYUDREOLJDWRLUHPHQWUHMRLQGUHODEDODQFHGDQV le Parc Fermé et sera classé selon le nombre de tours qu’il DXUDUpHOOHPHQWHIIHFWXpV During the Pre-Finals and Final, any Driver about to be overtaken or who has been overtaken by the race leader for any reason whatsoever will be shown the blue and red ÀDJGRXEOHGLDJRQDOZLWKKLVQXPEHU+HVKDOOFRPSXOsorily go to the scales in the Parc Fermé and will be clasVL¿HGDFFRUGLQJWRWKHQXPEHURIODSVWKDWKHKDVDFWXDOO\ completed. 19 - Classements Cas A) Le classement d’un Championnat CIK-FIA couru VXUXQHVHXOH&RPSpWLWLRQVHUDFHOXLGHOD)LQDOH Le titre du Championnat CIK-FIA sera attribué au Pilote YDLQTXHXUGHOD)LQDOH 6LOD)LQDOHHVWLQWHUURPSXHHQDSSOLFDWLRQGHO¶$UWLFOH des Prescriptions Générales sans pouvoir repartir et si PRLQVGHGHODGLVWDQFHSUpYXHRQWpWpFRXYHUWVOH WLWUHGX&KDPSLRQQDW&,.),$QHVHUDSDVDWWULEXp &ODVVL¿FDWLRQV Case A)7KHFODVVL¿FDWLRQRID&,.),$&KDPSLRQVKLSKHOG over one single Competition will be that of the Final. The title of the CIK-FIA Championship will be awarded to the Driver who has won the Final. If the Final is stopped under Article 2.21 of the General Prescriptions and cannot be restarted and if less than 75% of the scheduled distance have been covered, the title of the CIK-FIA Championship will not be awarded. Cas B) Le classement d’un Championnat CIK-FIA composé d’une série de Compétitions sera établi comme suit: FKDTXH3LORWHSRXUUDWRWDOLVHUGHVUpVXOWDWVDUURQGLV Case B)7KHFODVVL¿FDWLRQRID&,.),$&KDPSLRQVKLSZLOO be established as follows : 80% of the results rounded up RUGRZQWRWKHQHDUHVW¿JXUHZLOOFRXQWLH PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS au chiffre le plus proche, soit : VLOHQRPEUHGH&RPSpWLWLRQVHVWLQIpULHXUjWRXWHVOHV &RPSpWLWLRQVVHURQWUHWHQXHV - if the number of Competitions is less than 3, all the Competitions will be retained. - si le nombre de Compétitions est compris entre 3 et 7, le plus mauvais résultat obtenu dans les classements interPpGLDLUHVpWDEOLVjO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHV ainsi que le plus mauvais résultat obtenu lors des Finales VHURQWGpFRPSWpV - if the number of Competitions is between 3 and 7, the ZRUVWUHVXOWREWDLQHGLQWKHLQWHUPHGLDWHFODVVL¿FDWLRQV HVWDEOLVKHGDIWHUWKH4XDOLI\LQJ+HDWVDQGWKHZRUVW result obtained in the Finals will be discounted. - si le nombre de Compétitions est compris entre 8 et 12, les deux plus mauvais résultats obtenus dans les FODVVHPHQWVLQWHUPpGLDLUHVpWDEOLVjO¶LVVXHGHV0DQFKHV 4XDOL¿FDWLYHVDLQVLTXHOHVGHX[SOXVPDXYDLVUpVXOWDWV REWHQXVORUVGHV)LQDOHVVHURQWGpFRPSWpV - if the number of Competitions is between 8 and 12, the WZRZRUVWUHVXOWVREWDLQHGLQWKHLQWHUPHGLDWHFODVVL¿FDWLRQVHVWDEOLVKHGDIWHUWKH4XDOLI\LQJ+HDWVDQGWKHWZR worst results obtained in the Finals will be discounted. 8QUpVXOWDWQXOFRQVpFXWLIjXQHH[FOXVLRQQHSRXUUDSDV rWUHGpFRPSWp Le titre du Championnat CIK-FIA sera attribué au Pilote qui DXUDREWHQXOHSOXVJUDQGQRPEUHGHSRLQWV A blank result due to an exclusion may not be discounted. ¬FKDTXH&RPSpWLWLRQOHFODVVHPHQWLQWHUPpGLDLUHpWDEOL jO¶LVVXHGHV0DQFKHV4XDOL¿FDWLYHVGRQQHUDOLHXjXQH DWWULEXWLRQGHSRLQWVDX[SUHPLHUV3LORWHVFODVVpVVHORQ le barème suivant $WHDFK&RPSHWLWLRQIRUWKHLQWHUPHGLDWHFODVVL¿FDWLRQ HVWDEOLVKHGDIWHUWKH4XDOLI\LQJ+HDWVWKHUHZLOOEHDQ DZDUGLQJRISRLQWVWRWKHWRSFODVVL¿HG'ULYHUVDFFRUding to the following scale: 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. ¬FKDTXH&RPSpWLWLRQOD)LQDOHGRQQHUDOLHXjXQHDWWULbution de points aux 15 premiers Pilotes classés, selon le EDUqPHVXLYDQW At each Competition, for the Final, points will be awarded WRWKHWRSFODVVL¿HG'ULYHUVDFFRUGLQJWRWKHIROORZLQJ scale: 25, 20, 16, 13, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1. Si une course est interrompue en application de l’Article GHV3UHVFULSWLRQV*pQpUDOHVVDQVSRXYRLUUHSDUWLUHW si moins de 2 tours ont été couverts, aucun point ne sera DWWULEXp6LSOXVGHWRXUVHWPRLQVGHGHODGLVWDQFH prévue ont été couverts, la moitié des points prévus sera DWWULEXpH/DWRWDOLWpGHVSRLQWVVHUDDWWULEXpHVLRX SOXVGHODGLVWDQFHSUpYXHRQWpWpFRXYHUWV If a race is stopped under Article 2.21 of the General Prescriptions and cannot be restarted and if less than 2 laps have been completed, no points will be awarded. If more than 2 laps but less than 75% of the scheduled distance have been covered, half the scheduled points will be awarded. Full points will be awarded if 75% or more of the scheduled distance have been covered. ([ TXRHQWUH3LORWHV Si deux ou plusieurs Pilotes terminent la saison avec le même nombre de points, la place plus élevée au Championnat CIK-FIA se disputant sur une série de Compétitions sera attribuée (dans l’un ou l’autre cas) : a) au titulaire du plus grand nombre de premières places DX[)LQDOHVRXjOD&RXUVHHWOD&RXUVHVHORQOH format de la Compétition) ; 20 - Dead heats between Drivers ,IWZRRUPRUH'ULYHUV¿QLVKWKHVHDVRQZLWKWKHVDPH number of points, the highest place in the CIK-FIA Championship held over a series of Competitions (in either case) will be awarded to: DWKHKROGHURIWKHJUHDWHVWQXPEHURI¿UVWSODFHVLQWKH Finals or Race 1 and Race 2 (depending on the format of the Competition), b) si le nombre de premières places est le même, au titulaire du plus grand nombre de secondes places aux Finales RXjOD&RXUVHHWOD&RXUVHVHORQOHIRUPDWGHOD Compétition) ; ELIWKHQXPEHURI¿UVWSODFHVLVWKHVDPHWKHKROGHURI the greatest number of second places in the Finals or Race 1 and Race 2 (depending on the format of the Competition), c) si le nombre de secondes places est le même, au titulaire du plus grand nombre de troisièmes places aux )LQDOHVRXjOD&RXUVHHWOD&RXUVHVHORQOHIRUPDWGH OD&RPSpWLWLRQHWDLQVLGHVXLWHMXVTX¶jFHTX¶XQYDLQqueur se dégage ; c) if the number of second places is the same, the holder of the greatest number of third places in the Finals or Race 1 and Race 2 (depending on the format of the Competition), and so on until a winner emerges; d) si l’égalité demeure parfaite, au titulaire du plus grand QRPEUHGHSUHPLqUHVSODFHVDX[3Up¿QDOHV d) if there is still a dead heat, the holder of the greatest QXPEHURI¿UVWSODFHVLQWKH3UH¿QDOV The title of the CIK-FIA Championship will be awarded to the Driver who has scored the greatest number of points. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS HVLOHQRPEUHGHSUHPLqUHVSODFHVDX[3Up¿QDOHVHVW le même, au titulaire du plus grand nombre de secondes SODFHVDX[3Up¿QDOHVHWDLQVLGHVXLWHMXVTX¶jFHTX¶XQ vainqueur se dégage ; HLIWKHQXPEHURI¿UVWSODFHVLQWKH3UH¿QDOVLVWKH same, the holder of the greatest number of second places LQWKH3UH¿QDOVDQGVRRQXQWLODZLQQHUHPHUJHV f) si l’égalité demeure parfaite, la meilleure place lors de la &RXUVH)LQDOHGHODGHUQLqUH&RPSpWLWLRQVHUDGpFLVLYH f) if there is still a dead heat, the better position in the Final Race of the last Competition will be decisive. 21 - Jumelage de deux catégories Dans le cadre des Championnats CIK-FIA, le jumelage de 2 catégories de Groupes différents peut être admis lorsque le nombre minimum de Pilotes (15 par catégorie) n’a pas pWpDWWHLQW/HQRPEUHPLQLPXPGH3LORWHVDXMXPHODJH GHYUDrWUHGH/DFDWpJRULHODSOXVSXLVVDQWHGDQVOH respect des règlements en vigueur, partira en tête sur la JULOOHGHGpSDUWSRXUOHV0DQFKHV4XDOL¿FDWLYHVHW)LQDOHV ¬O¶DUULYpHGHOD)LQDOHLOVHUDSURFpGpjXQFODVVHPHQW VpSDUp(QDXFXQFDVOHVFDWpJRULHV-XQLRUHW6HQLRUQH SRXUURQWrWUHMXPHOpHV 21 - Twinning of two categories Within the framework of the CIK-FIA Championships, the twinning of 2 categories of different Groups may be admitted when the minimum number of Drivers (15 per category) has not been reached. The minimum number of 'ULYHUVIRUWZLQQLQJVKDOOEH)RUWKH4XDOLI\LQJ+HDWV and Finals, the most powerful category, in the respect of the valid regulations, will take the start at the head of WKHVWDUWLQJJULG$WWKH¿QLVKRIWKH)LQDOWKHUHZLOOEHD VHSDUDWHFODVVL¿FDWLRQ7KHUHFDQQHYHUEHDWZLQQLQJRI Junior and Senior categories. 22 - Publicité 8Q2UJDQLVDWHXUQHSHXWLPSRVHUXQHSXEOLFLWpVXUOHV fonds des numéros de compétition qu’avec l’accord exprès GHOD&,.),$ Ces inscriptions publicitaires sur les fonds des numéros de FRPSpWLWLRQQHGHYURQWSDVGpSDVVHUFPGHODUJHXUVXU FPGHKDXWHXUDXGHVVXVRXDXGHVVRXVGXQXPpUR 7RXWOHPDWpULHOGHSXEOLFLWpEDQQLqUHVSDQQHDX[HWF exposé dans le périmètre du circuit devra préalablement avoir été approuvé par la CIK-FIA pour des raisons de VpFXULWp7RXWHSHLQWXUHVXUOHUHYrWHPHQWGXFLUFXLWDXWUH que celle délimitant les bords de la piste et déterminant la JULOOHGHGpSDUWHVWLQWHUGLWHSRXUGHVUDLVRQVGHVpFXULWp 22 - Advertising An Organiser may impose an advertisement to be placed on the competition numbers background only with the express agreement of the CIK-FIA. Such advertising inscriptions on the competition numbers background must not be more than 20 cm in width by 5 cm in height above or below the number. All the advertising material (banners, panels, etc.) exposed in the perimeter of the circuit must have previously been approved by the CIK-FIA for safety reasons. Any paint on the circuit surfacing, other than that which delimits the edges of the track and determines the starting grid, is forbidden for safety reasons. 23 - Application et interprétation des Prescriptions *pQpUDOHVHW6SpFL¿TXHV (QFDVGHGLIIpUHQGUHODWLIjO¶LQWHUSUpWDWLRQGHV3UHVFULSWLRQVVHXOHOD&,.),$HVWTXDOL¿pHSRXUSUHQGUHXQH décision, sans préjudice du droit d’appel, conformément DX&RGH 23 - Application and interpretation of the General DQG6SHFL¿F3UHVFULSWLRQV In the case of a dispute concerning the interpretation of WKH3UHVFULSWLRQVRQO\WKH&,.),$LVTXDOL¿HGWRWDNHD decision, without prejudice of the right to appeal, in accordance with the Code. 24 - Réclamations et Appels Les réclamations ne peuvent être présentées que par le &RQFXUUHQW(OOHVGHYURQWrWUHUHPLVHVVRXVIRUPHpFULWH DX'LUHFWHXUGH&RXUVHRXjVRQDGMRLQWGDQVOHV PLQXWHVTXLVXLYHQWO¶DI¿FKDJHGHVUpVXOWDWVGHV(VVDLV 4XDOL¿FDWLIVHW0DQFKHV4XDOL¿FDWLYHV5HSrFKDJH\FRPSULVHWGDQVOHVPLQXWHVTXLVXLYHQWO¶DI¿FKDJHGX FODVVHPHQWGHV&RXUVHVGHODSKDVH¿QDOH(OOHVVHURQW accompagnées de la caution prévue par la CIK-FIA, s’éleYDQWj(XURVRXpTXLYDODQW/DFDXWLRQSHXWrWUH payée dans la monnaie de l’ASN organisatrice ou une des monnaies suivantes : francs suisses, dollars américains et (XURV ¬GpIDXWGX'LUHFWHXUGH&RXUVHRXGX'LUHFWHXUDGMRLQW HOOHVGRLYHQWrWUHSUpVHQWpHVjXQ&RPPLVVDLUH6SRUWLIGH OD&RPSpWLWLRQ 24 - Protests and Appeals The right to protest lies only with Entrants. They must be presented in writing to the Clerk of the Course or to his deputy within 10 minutes after the posting of the results RIWKH4XDOLI\LQJ3UDFWLFHDQG4XDOLI\LQJ+HDWVLQFOXGLQJ the Second Chance Heat), and within 30 minutes after the SRVWLQJRIWKHFODVVL¿FDWLRQRIWKH5DFHVRIWKH¿QDOSKDVH They shall be accompanied by the fee provided for by the CIK-FIA, amounting to 850 Euros or equivalent. The deposit may be paid in the currency of the organising ASN or in one of the following currencies : Swiss francs, American dollars and Euros. &RQIRUPpPHQWjO¶$UWLFOHGX&RGH6SRUWLI,QWHUQDWLRQDOOHVSpQDOLWpVHQWHPSVLQÀLJpHVSDUOH&ROOqJHGHV Commissaires Sportifs pour des infractions aux Règle- In accordance with Article 12.2 of the International Sporting Code, time penalties imposed by the Panel of Stewards for infringements of the Regulations are not sus- In the absence of the Clerk of the Course or of his deputy, they shall be presented to the Stewards of the Competition or to one of them. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS PHQWVVRQWLQVXVFHSWLEOHVG¶DSSHO ceptible to appeal. La caution sera remboursée si la réclamation est jugée IRQGpH/HMXJHPHQWUHQGXSDUOHV&RPPLVVDLUHV6SRUWLIV FRQIRUPpPHQWjO¶$UWLFOHGX&RGHSRXUUDIDLUHO¶REMHW G¶XQDSSHOHQYHUWXGHVGLVSRVLWLRQVGX&RGH$UWLFOH The deposit will be refunded if the protest is judged founded. It will be possible to appeal against the Stewards’ judgement, pursuant to Article 13 of the Code, in accordance with the provisions laid down in the Code (Article 14). Dans le cadre des Championnats du Monde de Karting de OD&,.),$OHPRQWDQWGHFDXWLRQG¶DSSHOHVWGH¶ (XURV For the CIK-FIA Karting World Championships, the amount of the appeal deposit is 6,000 Euros. 25 - Amendes 8QHDPHQGHSHXWrWUHLQÀLJpHjWRXW&RQFXUUHQW3LORWH assistant ou Organisateur qui ne respectera pas les presFULSWLRQVGHVRI¿FLHOVGHOD&RPSpWLWLRQ8QHDPHQGHSHXW rWUHLQÀLJpHSDUOD&,.),$VXUGpFLVLRQFROOpJLDOHGHV &RPPLVVDLUHV6SRUWLIVGHOD&RPSpWLWLRQ 7RXWHVOHVDPHQGHVGRLYHQWrWUHSD\pHVjOD&,.),$GDQV XQGpODLGHKHXUHVDSUqVDYRLUpWpLQÀLJpHV7RXWHIRLV OHVDPHQGHVMXVTX¶j(XURVGHYURQWrWUHSD\pHVLPPpGLDWHPHQWSDUFDUWHGHFUpGLW 25 - Fines $¿QHPD\EHLQÀLFWHGRQDQ\(QWUDQW'ULYHUDVVLVWDQW or Organiser who does not respect the prescriptions of WKHRI¿FLDOVRIWKH&RPSHWLWLRQ$¿QHPD\EHLQÀLFWHGE\ the CIK-FIA, on decision of the Panel of Stewards of the Competition. 26 - Pénalités Dans les Championnats de la CIK-FIA se déroulant sur plusieurs Compétitions ou sur une Compétition précédée de sélections, les Commissaires Sportifs d’une Compétition DXURQWODSRVVLELOLWpGHWHQLUFRPSWHGHVSpQDOLWpVLQÀLJpHV aux Pilotes lors des Compétitions précédentes du même &KDPSLRQQDW Dès le lendemain de la Compétition, le Président du Collège des Commissaires Sportifs de chaque Compétition communiquera au Secrétariat de la CIK-FIA la liste des SpQDOLWpVLQÀLJpHVSDUOH&ROOqJH/H6HFUpWDULDWGHOD&,. ),$SRUWHUDFHWWHOLVWHjODFRQQDLVVDQFHGX3UpVLGHQWGX &ROOqJHGHOD&RPSpWLWLRQVXLYDQWH 26 - Penalties In the CIK-FIA Championships held over several Competitions or consisting in one Competition preceded by selections, the Stewards of a Competition will have the possibilLW\RIWDNLQJLQWRDFFRXQWDQ\SHQDOWLHVLQÀLFWHGRQ'ULYHUV during previous Competitions of the same Championship. 27 - Dispositions protocolaires - Les pages de couvertures du Règlement Particulier et GXSURJUDPPHGHOD&RPSpWLWLRQOHVIHXLOOHVRI¿FLHOOHVGH FODVVHPHQWDLQVLTXHOHVDI¿FKHVSRUWHURQWHQpYLGHQFH le titre du Championnat CIK-FIA (ou Coupe ou Trophée), avec le logo de la CIK-FIA, le logo de l’ASN et, si l’ASN n’est pas organisatrice elle-même, le logo de l’OrganisaWHXUGpOpJDWDLUH - Le programme et les listes des résultats devront obligatoirement mentionner les nom, prénom et nationalité des Pilotes, le nom et la nationalité des Concurrents, les PDUTXHVGXPDWpULHOXWLOLVpFKkVVLVPRWHXUSQHXVHWOHV QXPpURVGHFRXUVH 27 - Protocol provisions - The cover pages of the Supplementary Regulations and SURJUDPPHRIWKH&RPSHWLWLRQWKHRI¿FLDOFODVVL¿FDWLRQ sheets, as well as the posters, will bear in a prominent position the title of the CIK-FIA Championship (or Cup or Trophy), with the CIK-FIA logo, the logo of the ASN and, if the ASN itself is not the Organiser, the logo of the proxy Organiser. - The programme and lists of results must mention the VXUQDPH¿UVWQDPHDQGQDWLRQDOLW\RIWKH'ULYHUVWKH name and nationality of the Entrants, the makes of the equipment used (chassis-engine-tyres) and the racing numbers. /HVSUpSDUDWLIVSUpFpGDQWOHGpSDUWGHODSKDVH¿QDOH seront, dans la mesure du possible, précédés d’un cérémoQLDOSUpVHQWDWLRQGHV3LORWHVHWF 7KHSUHSDUDWLRQVSULRUWRWKH¿QDOSKDVHZLOOEHDVIDU as possible, preceded by a ceremony (presentation of Drivers, etc.). - La cérémonie de la proclamation du vainqueur sera soigneusement préparée et le matériel suivant doit être prévu de la manière suivante : * un podium de grandes dimensions revêtant les logos de la CIK-FIA, de l’ASN et, si l’ASN n’est pas organisatrice elle-même, de l’Organisateur délégataire (voir Annexe 12 au Règlement des Circuits, Partie 1) ; - The ceremony for the proclamation of the winner shall be carefully prepared and the following equipment must be provided for as follows: * a podium of large dimensions with the logos of the CIKFIA, the ASN and, if the ASN itself is not the Organiser, of the proxy Organiser (see Appendix 12 to the Circuit Regulations, Part 1); $OO¿QHVPXVWEHSDLGWRWKH&,.),$ZLWKLQKRXUVDIWHU WKHLULPSRVLWLRQ+RZHYHU¿QHVRI(XURVRUOHVVPXVW be paid immediately by credit card. On the day after the Competition, the Chairman of the Panel of Stewards of each Competition will forward to the 6HFUHWDULDWRIWKH&,.),$WKHOLVWRISHQDOWLHVLQÀLFWHGE\ the Panel. The Secretariat of the CIK-FIA will bring this list to the attention of the Chairman of the Panel of the following Competition. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS * le 3e, le 2e et le vainqueur de la Compétition monteront successivement sur le podium ; * l’hymne national du Pilote vainqueur sera joué et le drapeau national des trois premiers sera hissé (la nationalité du Pilote étant celle de l’ASN ayant émis sa licence, sauf SRXUOH&KDPSLRQQDWGX0RQGHRODQDWLRQDOLWpFLYLOHGX Pilote prévaudra) ; XQHFRXSHDXPLQLPXPVHUDUHPLVHDX[3LORWHV * the 3rd and 2nd placed Drivers and the winner of the Competition will climb on the podium in that order; * the winner’s national anthem will be played and the QDWLRQDOÀDJVRIWKHWRSFODVVL¿HG'ULYHUVZLOOEHKRLVWHG (the nationality of the Driver being that of the ASN which delivered his licence, except for the World Championship where the civil nationality of the Driver will prevail); * at least a cup will be awarded to the Drivers. 28 - Droits de tournage et d’images animées de la FIA La couverture des Compétitions comptant pour les Championnats de la CIK-FIA doit être équitable et impartiale, FRQIRUPpPHQWjO¶$UWLFOHGHV3UHVFULSWLRQV*pQpUDOHV GHOD),$ ),$¿OPLQJDQGPRYLQJSLFWXUHULJKWV &RQWU{OHGHVFRXUVHVSDUFDPpUDVHPEDUTXpHV (suivant la réglementation des championnats concernés) 29 - Race control system with on-board cameras (according to the regulations of the championships concerned) The CIK-FIA will implement a race control system with on-board cameras on all karts (except in Superkart). Each camera and smart card will be the property of the CIK-FIA, and they will be distributed in the Parc Fermé. The camera attachments (water-proof casing and support) will be the property of the Competitors. It is their responsibility to install the support kit correctly on the kart, but it is strictly forbidden for Drivers and Mechanics to handle the cameras directly, under pain of exclusion. La CIK-FIA mettra en place un système de contrôle des courses par caméras embarquées sur tous les karts (sauf HQ6XSHUNDUW&KDTXHFDPpUDHWFDUWHPpPRLUHVHUDOD SURSULpWpGHOD&,.),$HWGLVWULEXpHHQ3DUF)HUPp/HV ¿[DWLRQVGHODFDPpUDERvWLHUpWDQFKHHWVXSSRUWVHURQW ODSURSULpWpGHV&RQFXUUHQWV,OHVWGHOHXUUHVSRQVDELOLWp d’installer correctement le kit de support sur le kart ; en revanche, il est strictement interdit aux Pilotes et Mécaniciens de manipuler directement les caméras, sous peine G¶H[FOXVLRQ The coverage of Competitions counting towards the CIKFIA Championships must be fair and impartial, in accordance with Article 27 of the FIA General Prescriptions. 30 - Matériels de contrôle Toute perte, détérioration ou tentative de manipulation du système de contrôle du régime du moteur sera sancWLRQQpHDXPLQLPXPG¶XQHDPHQGHGH¼/DSHUWHRX la détérioration involontaire du système de contrôle des embrayages ou de la caméra embarquée sera facturée ¼OHXUPDQLSXODWLRQRXGpWpULRUDWLRQYRORQWDLUHVHUD VDQFWLRQQpHG¶XQHDPHQGHPLQLPXPGH¼ 30 - Control systems Any loss, deterioration or attempt to tamper with the engine speed control system will be punished by a miniPXP¿QHRI¼/RVVRULQYROXQWDU\GHWHULRUDWLRQRIWKH clutch control system or of the on-board camera will be LQYRLFHG¼WDPSHULQJZLWKRUGHOLEHUDWHO\GHWHULRUDWLQJWKHPZLOOEHSXQLVKHGE\DPLQLPXP¿QHRI¼ &DUpQDJHDYDQWHW.LWGHPRQWDJHGHFDUpQDJH DYDQW Dans tous les Championnats, Coupes et Trophées de la CIK-FIA (Superkart excepté), l’utilisation d’un carénage avant homologué et du kit de montage de carénage avant homologué de la période d’homologation de la carrosserie ±HVWREOLJDWRLUH 31 - Front Fairing & Front Fairing Mounting Kit Installation du «Carénage avant» /HFDUpQDJHDYDQWLQVWDOOpjO¶DLGHGXNLWGHPRQWDJH GHFDUpQDJHDYDQWGRLWrWUHHQSRVLWLRQFRUUHFWHjWRXW moment lors d’une compétition (voir Dessin Technique n° G /HGUDSHDXQRLUjGLVTXHRUDQJHQHVHUDSDVSUpVHQWpj un pilote si son carénage avant n’est plus en position corUHFWH Si le juge de fait indique que le carénage avant sur un ou plusieurs karts n’était plus dans la bonne position au PRPHQWROH©GUDSHDXjGDPLHUQRLUHWEODQFªpWDLWDJLWp HWROHVNDUWVFRQFHUQpVIUDQFKLVVDLWDLHQWODOLJQH G¶DUULYpHXQHSpQDOLWpHQWHPSVGHVHFRQGHVVHUDLQÀLJpHDX[SLORWHVFRQFHUQpV&HWWHSpQDOLWpHQWHPSV Q¶HVWSDVVXVFHSWLEOHG¶DSSHO Correct installation of the “Front Fairing” The front fairing (using the front fairing mounting kit) must be in the correct position at all times during a competition (see Technical Drawing No. 2d). In all CIK-FIA Championships, Cups and Trophies (except Superkart), the use of a homologated front fairing and of the homologated front fairing mounting kit of the bodywork homologation period 2015 – 2020 is mandatory. 7KHEODFNÀDJZLWKDQRUDQJHGLVFZLOOQRWEHVKRZQWRD driver if his front fairing is no longer in the correct position. If the judge of fact reports that the front fairing on one or more karts was no longer in the correct position when WKH³EODFNDQGZKLWHFKHTXHUHGÀDJ´ZDVZDYHGDQGWKH NDUWVFRQFHUQHGFURVVHGWKH¿QLVKOLQHDWLPHSHQDOW\ of 30 seconds will be imposed on the driver(s) concerned. This time penalty is not susceptible to appeal. PRESCRIPTIONS SPÉCIFIQUES SPECIFIC PRESCRIPTIONS 32 - Fond de Prix Chaque ASN dont un ou plusieurs Pilotes s’est/se sont HQJDJpVjXQ&KDPSLRQQDW&RXSHRX7URSKpHGHOD&,. ),$GHYUDYHUVHUjOD&,.),$(XURVSRXUDOLPHQWHUOH Fonds de Prix commun récompensant les Championnats de OD&,.),$ 32 - Prize Fund Each ASN of which one or several Drivers has/have entered a CIK-FIA Championship, Cup or Trophy must pay to the CIK-FIA 252 Euros to contribute to the common Prize Fund which rewards the CIK-FIA Championships. 33 - Echappements de KF3 - Appel d’offres Dans le cadre de l’appel d’offres pratiqué par la FIA, le Conseil Mondial du Sport Automobile de la FIA a décidé de désigner ELTO Racing comme fournisseur exclusif au cours GHVVDLVRQVHW 33 - KF3 Exhausts - Invitation to tenders Within the framework of the invitation to tenders issued by the FIA, the World Motor Sport Council of the FIA has decided to designate ELTO Racing as the exclusive supplier during the 2013, 2014 and 2015 seasons: - pour la fourniture des échappements dans le cadre du Championnat du Monde CIK-FIA de KF-Junior, du Championnat d’Europe CIK-FIA de KF-Junior et du Championnat G¶$VLH3DFL¿TXH&,.),$GH.)-XQLRU - for the supply of exhausts in the CIK-FIA World KF-Junior Championship, the CIK-FIA European KF-Junior ChamSLRQVKLSDQGWKH$VLD3DFL¿F.)-XQLRU&KDPSLRQVKLS Pour chaque Pilote et pour tout échappement commandé, OHSUL[SURSRVpSDU(OWR5DFLQJHVWGH¼SLqFH+7 pour les Championnats, Coupes et Trophées mentionnés FLGHVVXV/HVpFKDSSHPHQWVGRLYHQWrWUHFRPPDQGpVj l’avance auprès d’Elto Racing, dans un délai minimum de GHX[VHPDLQHVDYDQWOD&RPSpWLWLRQFRQFHUQpH For each driver and for every exhaust ordered, the price SURSRVHGE\(OWR5DFLQJLV¼SLHFHH[FOXGLQJWD[IRU the Championships, Cups and Trophies mentioned above. The exhaust must be ordered in advance from Elto Racing, a minimum of two weeks before the Competition in question. &RRUGRQQpHVGH(OWR5DFLQJ(OWR5DFLQJ0Eligio TORRE*,$1,9LD0DULR5LFFL3(6$52,7$/,( 7pO )D[ (PDLODPPLQLVWUD]LRQH#HOWRUDFLQJLW Address of Elto Racing : Elto Racing, Mr Eligio TORREGIANI, Via Mario Ricci 10, 61122 PESARO - ITALY 3KRQH )D[ - E mail: [email protected] 7 Commission Internationale de Karting - FIA ANNEXE N°2 : NORMES RECONNUES POUR LES CASQUES EN KARTING APPENDIX No. 2 : RECOGNISED STANDARDS FOR HELMETS IN KARTING Snell-SAH2010 ! (FKpDQFH Not valid after 31/12/2023 Snell-SA2010 ! (FKpDQFH Not valid after 31/12/2023 Snell-K2010 ! (FKpDQFH Not valid after 31/12/2023 Snell-FIA CMS2007 Obligatoire dès 1/1/2010 pour Pilotes de moins de 15 ans Mandatory from 1/1/2010 for Drivers under 15 years old Snell-FIA CMR2007 Obligatoire dès 1/1/2010 pour Pilotes de moins de 15 ans Mandatory from 1/1/2010 for Drivers under 15 years old Snell Memorial Foundation 3628 Madison Avenue, Suite 11 North Hignlands, CA 95660, USA Snell SA2005 ! (FKpDQFH Not valid after 31/12/2018 Snell K2005 (FKpDQFH Not valid after 31/12/2018 Tel. +1 (916) 331-5073 Fax +1 (916) 331-0359 ZZZVPIRUJ ! SFI Foundation Inc 15708 Pomerado Road, Suite N208 Poway, CA 92064, USA SFI 31.1A SFI 31.2A Tel. +1 858-451-8868 Fax +1 858-451-9268 ZZZV¿IRXQGDWLRQFRP Fédération Internationale de l’Automobile 3ODFHGHOD&RQFRUGH 75008 Paris )UDQFH ! (FKpDQFH Not valid after 31/12/2018 FIA 8860-2004 ! (FKpDQFH Not valid after 31/12/2020 ZZZ¿DFRP FIA 8860-2010 Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 23/01/2015 Commission Internationale de Karting - FIA LISTE DES CASQUES CERTIFIÉS SNELL / FIA CMH POUR DISTRIBUTION AU PUBLIC LIST OF CERTIFIED SNELL / FIA CMH HELMETS FOR PUBLIC DISTRIBUTION Liste Snell en cours / Snell active list ( www.smf.org ) - 30/03/2015 SNELL/FIA CMR 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type Arai Helmet CK-6 XXS XS S M L Full Race Full Face Full Face Full Face Full Face B2 Racing RC31-KY 52cm 53cm 54cm 55cm 56cm 57cm 58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face Full Face Full Face RZ31-KY 54cm 55cm 56cm 57cm 58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face XS S M L Full Face Full Face Full Face Full Face 6 1/2 6 3/4 6 5/8 6 7/8 7 7 1/4 7 1/8 7 3/8 Full Face Full Face Full Face Full Face Full Face Full Face Full Face Full Face Beijing Rodia Sports Manufacture Co., Ltd. FF-C2 Bell Racing Copyright © 2015 by CIK-FIA. All rights reserved GP.2-CMR Dernière mise à jour/ Latest update: 02/04/2015 Commission Internationale de Karting - FIA LISTE DES CASQUES CERTIFIÉS SNELL / FIA CMH POUR DISTRIBUTION AU PUBLIC LIST OF CERTIFIED SNELL / FIA CMH HELMETS FOR PUBLIC DISTRIBUTION Liste Snell en cours / Snell active list ( www.smf.org ) - 30/03/2015 SNELL/FIA CMR 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type Bell Racing KC3-CMR 52cm 53cm Full Face Full Face KC7-CMR 52cm 53cm 54cm 55cm 56cm 57cm 58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face Full Face Full Face Bell Racing Europe KC3-CMR 54cm 55cm 56cm 57cm 58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face Duchinni K802 50-51cm 52-53cm 54cm 56cm 58cm Full Face Full Face Full Face Full Face Full Face FR FK-07 50-51cm 52-53cm 54cm 56cm 58cm Full Face Full Face Full Face Full Face Full Face FK-08 S 52-53 M 54-55 L 56-57 Full Face Full Face Full Face Colt XS S M L Full Face Full Face Full Face Full Face Hedtec Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 02/04/2015 Commission Internationale de Karting - FIA LISTE DES CASQUES CERTIFIÉS SNELL / FIA CMH POUR DISTRIBUTION AU PUBLIC LIST OF CERTIFIED SNELL / FIA CMH HELMETS FOR PUBLIC DISTRIBUTION Liste Snell en cours / Snell active list ( www.smf.org ) - 30/03/2015 SNELL/FIA CMR 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type Koden KDC 25 XS S M Full Face Full Face Full Face KDC 25 Carbon XL XXL Full Face Full Face KDF 15 XS S M L XL Full Face Full Face Full Face Full Face Full Face SK005 50-51cm 52-53cm 54cm 56cm 58cm Full Face Full Face Full Face Full Face Full Face MT SP-1 PRO XS S M Full Face Full Face Full Face OMP J-Kart CMR XXXS (50-51) XXS (52-53) XS (54-55) S (56) M (57-58) L (59) Full Face Full Face Full Face Full Face Full Face Full Face KJ-7 XS S M Full Face Full Face Full Face OJK 50-51cm 52-53cm 54-55cm 56cm 57-58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face OSBE s.r.l. Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 02/04/2015 Commission Internationale de Karting - FIA LISTE DES CASQUES CERTIFIÉS SNELL / FIA CMH POUR DISTRIBUTION AU PUBLIC LIST OF CERTIFIED SNELL / FIA CMH HELMETS FOR PUBLIC DISTRIBUTION Liste Snell en cours / Snell active list ( www.smf.org ) - 30/03/2015 SNELL/FIA CMR 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type RXA Track Jr. 50-51cm 52-53cm 54cm 56cm 58cm Full Face Full Face Full Face Full Face Full Face Shiro SH-1102 F-1 Kids XS S M Full Face Full Face Full Face ADV PRIMO 50-51cm 52-53cm 54-55cm 56cm 57-58cm 59cm Full Face Full Face Full Face Full Face Full Face Full Face WTX Primo S XS M L Full Face Full Face Full Face Full Face ST4 CMR XS S M Full Face Full Face Full Face ST5 CMR XS S M Full Face Full Face Full Face Strategic Sports ST-11102C XS S M Full Face Full Face Full Face Uvex FP5-CMR 54cm-56cm 57cm-59cm Full Face Full Face V2 CMR XS S M Full Face Full Face Full Face Sparco Stilo s.r.l. Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 02/04/2015 Commission Internationale de Karting - FIA LISTE DES CASQUES CERTIFIÉS SNELL / FIA CMH POUR DISTRIBUTION AU PUBLIC LIST OF CERTIFIED SNELL / FIA CMH HELMETS FOR PUBLIC DISTRIBUTION Liste Snell en cours / Snell active list ( www.smf.org ) - 30/03/2015 SNELL/FIA CMR 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type Vega HD117 K 50-51cm 52-53cm 54cm 56cm 58cm Full Face Full Face Full Face Full Face Full Face KDC 25 XS S M Full Face Full Face Full Face KDC 25 Carbon XL XXL Full Face Full Face KDF15 XS S M L XL Full Face Full Face Full Face Full Face Full Face SNELL/FIA CMS 2007 HELMETS Company Name Nom de la firme Model Name Nom du modèle Size Taille Type Arai Helmet CK-6S L M S XS XXS Full Face Full Face Full Face Full Face Full Face Copyright © 2015 by CIK-FIA. All rights reserved Dernière mise à jour/ Latest update: 02/04/2015 COMMISSION INTERNATIONALE DE KARTING - FIA COMBINAISONS HOMOLOGUEES - Partie 1 (Norme 2013-1) HOMOLOGATED OVERALLS - Part 1 (Standard 2013-1) Demandeur Pays Type/Modèle Homologation Début Fin Niveau Combinaison valide jusqu'au Applicant Country Type/Model Homologation Beginning End Level Overall valid until Sparco SpA ITA ITA Sparco K31 KS3 Sparco K32 KS5 CIK-FIA 2013/001 07.10.2013 06.10.2018 CIK-FIA 2013/002 07.10.2013 06.10.2018 2 2 06.10.2023 Sparco SpA OMP Racing SpA ITA OMP KS-2 Karting CIK-FIA 2013/003 06.11.2013 05.11.2018 2 05.11.2023 OMP Racing SpA ITA OMP KS-1 Karting CIK-FIA 2013/004 20.11.2013 19.11.2018 2 19.11.2023 Free Minds Srl ITA Freem TK114 CIK-FIA 2013/005 11.12.2013 10.12.2018 2 10.12.2023 Sparco SpA ITA Sparco K33 X-LIGHT CIK-FIA 2013/006 16.01.2014 15.01.2019 2 15.01.2024 OMP Racing SpA ITA OMP KS-3 Karting CIK-FIA 2013/007 04.03.2014 03.03.2019 2 03.03.2024 CONFEZIONE SABINA SNC ITA MIR TAZ1 CIK-FIA 2013/008 06.03.2014 05.03.2019 2 05.03.2024 CONFEZIONE SABINA SNC ITA MIR DIA1 CIK-FIA 2013/009 06.03.2014 05.03.2019 2 05.03.2024 Alpinestars SpA ITA Alpinestars K-MX 9 2014 CIK-FIA 2013/010 18.08.2014 17.08.2019 2 17.08.2024 Racewear p.e. BLR RLG 14 Level 1 CIK-FIA 2013/011 20.02.2015 19.02.2020 1 19.02.2025 Sparco SpA ITA Sparco K34 KS9 CIK-FIA 2013/012 26.08.2014 25.08.2019 2 25.08.2024 Alpinestars SpA ITA Alpinestars K-MX 5 2014 CIK-FIA 2013/013 18.08.2014 17.08.2019 2 17.08.2024 Alpinestars SpA ITA Alpinestars K-MX 1 2014 CIK-FIA 2013/014 26.08.2014 25.08.2019 2 25.08.2024 Sparco SpA ITA Sparco K35 Ergo-7 CIK-FIA 2013/015 16.10.2014 15.10.2019 2 15.10.2024 OMP Racing SpA ITA OMP KS-4 Karting CIK-FIA 2013/016 28.10.2014 27.10.2019 1 27.10.2024 IMPORTANT Rappel du Règlement d'Homologation de la CIK-FIA Art. 8.11, 2ème Partie : Conditions générales 2.1 – Domaine d'application et Niveau d’efficacité a) activité de loisirs : niveau 1 b) activités de compétition nationale et internationale : niveau 2 Reminder of the CIK-FIA Homologation Regulations Art. 8.11, 2 nd Part: General conditions 2.1 – Field of application and levels of efficiency a) leisure activities: level 1 b) national & international competition activities: level 2 06.10.2023 COMMISSION INTERNATIONALE DE KARTING - FIA COMBINAISONS HOMOLOGUEES - Partie 2 (Norme 2001-1) HOMOLOGATED OVERALLS - Part 2 (Standard 2001-1) Demandeur Pays Type/Modèle Homologation Début Fin Niveau Combinaison valide jusqu'au Applicant Country Type/Model Homologation Beginning End Level Overall valid until CIK-FIA 2001/76 09.06.2005 08.06.2010 CIK-FIA 2001/77 21.04.2005 20.04.2010 CIK-FIA 2001/78 04.10.2005 03.10.2010 2 2 2 2 2 2 2 2 1 2 1 1 2 2 2 1 2 2 1 1 2 2 WINTEX INTERNATIONAL A UT WINTEX INTERNATIONAL A UT SABELT S.p.A. ITA Wintex Kart Pro Kartsuit Level 2 Wintex Kart 1 Kartsuit Level 2 Sabelt Future Look SPARCO S.R.L. ITA SPARCO K29 Karting CIK-FIA 2001/79 06.12.2005 05.12.2010 SABELT S.p.A. ITA BRA BRA ITA PAK PAK PAK FRA ITA ITA ITA CAN BRA ITA FRA FRA FRA NLD Sabelt Ecokart liv. 2 Shutt SR K Evolution II Europa OMP 05 Karting Victory Speed Herram-103-CK Avantage Evolution BC6 LICO SPARCO K24 OMP 06 Karting KMX 7 Level 2 Laguna Kart Suit Overall ULV K2007 KRT PRO Livello 2 K015 K021 K221 C. Point Racewear Tech L2 CIK-FIA 2001/80 17.01.2006 16.01.2011 CIK-FIA 2001/81 18.05.2006 17.05.2011 CIK-FIA 2001/82 06.04.2006 05.04.2011 CIK-FIA 2001/83 21.06.2006 19.06.2011 CIK-FIA 2001/84 17.07.2006 16.07.2011 CIK-FIA 2001/85 17.07.2006 16.07.2011 CIK-FIA 2001/86 03.07.2006 02.07.2011 CIK-FIA 2001/87 18.01.2007 17.01.2012 CIK-FIA 2001/88 03.10.2006 02.10.2011 CIK-FIA 2001/90 09.01.2007 08.01.2012 CIK-FIA 2001/91 19.01.2007 18.01.2012 CIK-FIA 2001/92 22.02.2007 21.02.2012 CIK-FIA 2001/93 13.02.2007 12.02.2012 CIK-FIA 2001/94 11.04.2007 10.04.2012 CIK-FIA 2001/95 12.10.2007 11.10.2012 CIK-FIA 2001/96 12.10.2007 11.10.2012 CIK-FIA 2001/97 12.10.2007 11.10.2012 CIK-FIA 2001/98 16.10.2007 15.10.2012 ITA ITA PAK ITA OMP 07 Karting LICO SPARCO K26 Magnum Opus Magnum MIR Global 2 FRA DEU FRA HKG DEU HKg PAK PAK PAK ITA ITA HKG HKG ITA ITA ITA ITA PAK ITA ITA USA ITA UENI INDUSTRIA E COM. CORSA COMERCIA LTDA. OMP RACING LONGTERM RACEWEARS LONGTERM RACEWEARS HERRAM INTERNATIONAL GO KART SPARCO S.R.L. OMP RACING ALPINESTARS SpA FASTLANE ULV-VALDEZ Ind & Com. Ltda MOMO Srl STAND 21 STAND 21 STAND 21 MIRCA VOF OMP RACING SPARCO S.R.L. MAGNUM OPUS SPORTS CONFEZIONI SABINA Snc SODIKART GA SODIKART X'ZUIT PUMA OFF Road Racing Gear Co. Ltd Running Bird Impex PM Sports Wallana Industries ALPINESTARS SPA ALPINESTARS SPA X'ZUIT OFF Road Racing Gear Co. Ltd FREE MINDS S.R.L. ALPINESTARS SPA Kobra di Baronetto Paola CONFEZIONI SABINA My Racing Wears Sparco SpA Sparco SpA OAKLEY, Inc. Sparco SpA 08.06.2015 20.04.2015 03.10.2015 05.12.2015 16.01.2016 17.05.2016 05.04.2016 19.06.2016 17.07.2016 17.07.2016 02.07.2016 31.12.2016 03.10.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 CIK-FIA 2001/99 31.10.2007 30.10.2012 CIK-FIA 2001/100 31.10.2007 30.10.2012 CIK-FIA 2001/101 27.02.2008 26.02.2013 1 2 2 CIK-FIA 2001/102 03.12.2007 02.12.2012 2 31.12.2016 31.12.2016 31.12.2016 31.12.2016 Box's Daytona D1 GA Race Box's Silverstone D2 X'ZUIT FocuZ B Kart Cat Suit ORG Pro-Speedy Suit CIK-FIA 2001/103 06.03.2008 05.03.2013 CIK-FIA 2001/104 30.05.2008 29.05.2013 CIK-FIA 2001/108 15.09.2008 14.09.2013 CIK-FIA 2001/109 22.10.2008 21.10.2013 CIK-FIA 2001/110 19.01.2009 18.01.2014 2 2 2 2 2 2 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 Running Bird Impex Kart Next PM Sports PMS-030-09 Wallana Double Layer Overall K-MX7 2009 Level 2 K-MX1 2009 Level 2 X'ZUIT Ikon XZ ORG Evolution Level 2 FREEM GTK 80 K-MX9 2010 Level 2 KOBRA WINNER MIR GLIRC CIK-FIA 2001/112 04.02.2009 03.02.2014 CIK-FIA 2001/113 13.03.2009 12.03.2014 CIK-FIA 2001/114 23.06.2009 22.06.2014 CIK-FIA 2001/115 25.08.2009 24.08.2014 CIK-FIA 2001/116 25.08.2009 24.08.2014 CIK-FIA 2001/117 30.10.2009 29.10.2014 CIK-FIA 2001/118 19.11.2009 18.11.2014 CIK-FIA 2001/119 17.03.2010 16.03.2015 CIK-FIA 2001/120 30.11.2009 29.11.2014 CIK-FIA 2001/122 08.02.2010 07.02.2015 CIK-FIA 2001/123 22.10.2010 21.10.2015 Racing Suits Akhtar II Depond Cordura CIK-FIA 2001/124 04.05.2010 03.05.2015 Sparco K28 Sparco K30 OAKLEY Kill Switch 2 Sparco Lico K28 CIK-FIA 2001/125 19.05.2010 18.05.2015 CIK-FIA 2001/126 12.07.2010 28.07.2015 CIK-FIA 2001/127 23.09.2010 22.09.2015 CIK-FIA 2001/128 06.09.2010 08.10.2015 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 CIK-FIA 2001/111 06.02..2009 05.02.2014 OMP RACING OMP RACING ALPINESTARS SPA Arroxx BV. AL KHAIR International Leopardo Motorsports LONGTERM RACEWEARS LONGTERM RACEWEARS ALPINESTARS SPA OMP RACING PM Sports MT Sports JAZ INTERNATIONAL ALPINESTARS SPA OMP RACING ITA ITA OMP 14 Karting OMP 15 Karting CIK-FIA 2001/129 05.10.2010 04.10.2015 CIK-FIA 2001/130 15.10.2010 14.10.2015 ITA NLD PAK BRA PAK PAK ITA ITA PAK PAK PAK ITA ITA K-MX3 Light 2010 Level 2 Arroxx Avaron CIK-FIA 2001/131 02.11.2010 01.11.2015 CIK-FIA 2001/132 26.11.2010 25.11.2015 AK First Kart Driving Suit CIK-FIA 2001/133 14.02.2011 13.02.2016 Ciao Ultra-Sky Karting Level 2 CIK-FIA 2001/134 14.02.2011 13.02.2016 Longterm Racewears Victory CIK-FIA 2001/135 22.02.2011 21.02.2016 Longterm Racewears Speed CIK-FIA 2001/136 02.06.2011 01.06.2016 K-MX5 2011 Level 2 OMP 18 Karting PM Sports Speed Racewear Overall MLP Level 2 Kart Suit Top-Speed Level 2 K-MX 1 2012 OMP 19 CIK-FIA 2001/137 13.07.2011 12.07.2016 CIK-FIA 2001/138 26.07.2011 25.07.2016 CIK-FIA 2001/139 21.11.2011 20.11.2016 CIK-FIA 2001/140 13.12.2011 12.12.2016 CIK-FIA 2001/141 15.03.2012 14.03.2017 CIK-FIA 2001/142 04.05.2012 03.05.2017 CIK-FIA 2001/143 06.09.2012 05.09.2017 IMPORTANT Rappel du Règlement d'Homologation de la CIK-FIA Art. 8.11, 2ème Partie : Conditions générales 2.1 – Domaine d'application et Niveau d’efficacité a) activité de loisirs : niveau 1 b) activités de compétition nationale et internationale : niveau 2 Reminder of the CIK-FIA Homologation Regulations Art. 8.11, 2 nd Part: General conditions 2.1 – Field of application and levels of efficiency a) leisure activities: level 1 b) national & international competition activities: level 2 b) national competition activities: level 1 or 2, but level 2 is recommended 2 1 31.12.2016 31.12.2016 2 2 2 2 1 2 2 2 2 2 2 2 2 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 31.12.2016 KZ / KZ2 / ACADEMY CHAMPIONNAT D’EUROPE CIK-FIA DE KZ CIK-FIA EUROPEAN KZ CHAMPIONSHIP CHAMPIONNAT D’EUROPE CIK-FIA DE KZ2 CIK-FIA EUROPEAN KZ2 CHAMPIONSHIP TROPHÉE ACADÉMIE DE KARTING CIK-FIA CIK-FIA KARTING ACADEMY TROPHY (2) (2) (2) (2) (1) (1) 21-24 .05. 2015 SITUATION GEOGRAPHIQUE/LOCATION 29km N. de/N. of Zaragoza GPS 41°49’57’’ N, 0°48’26’’ W ASN/ASN CIRCUIT/CIRCUIT HÔTELS/HOTELS Circuito Internacional Zuera, Carratera Nacional 330 km 521.5, 50800 ZUERA, Spain +34 976 697 125 Web : www.circuitointernacionaldezuera.es E-mail : [email protected] ORGANISATEUR/ORGANISER CDE Zuera Racing, Carratera Nacional 330 km 521.5, 50800 ZUERA, Spain +34 976 553 973 Web : www.circuitointernacionaldezuera.es E-mail : [email protected] DONNEES DU CIRCUIT/CIRCUIT DATA Longueur/Length : Largeur/Width : 1’700 m 10m AEROPORT/AIRPORT Zaragoza (30km) Barcelona / Madrid (330km) ZUERA (ESP) RFEDA, c/o Escultor Peresejo 68bis, 28023 ARAVACA, Spain +34 91 729 94 30 Fax : +34 91 357 02 03 Web : www.rfeda.es E-mail : [email protected] - Hotel&Spa Real Ciudad de Zaragoza (12km) +34 976 459 295 - E-mail [email protected] - Arco Hotel, San Mateo de Gállego (4km) +34 976 683 275 - E-mail [email protected] - Hostal del Sol-sunlight, Zuera (6km) +34 976 69 02 98 - Hotel Las Galias, Zuera (6km) +34 976 680 224 - E-mail [email protected] - Hotel Palafox, Zaragoza (30km) +34 976 237 700 - E-mail: [email protected] - Hotel Césaraugusta, Zaragoza (30km) +34 976 282 727 - E-mail: [email protected] - Catalonia Zaragoza Plaza, Zaragoza (30km) +34 976 205 858 E-mail : [email protected] - Silken Reino de Aragón, Zaragoza (30km) GARE FERROVIAIRE/RAILWAY STATION +34 976 468 200 - E-mail: [email protected] Zaragoza (29km) - Hotel NH Ciudad de Zaragoza (30km) +34 976 442 100 - Fax: +34 976 443 361 E-mail : [email protected] OFFICE DU TOURISME/TOURIST OFFICE Zaragoza Turismo, Plaza de Ntra. Señora del Pilar s/n +34 902 14 2008 Fax : +34 976 72 12 81 Web : www.zaragoza.es/ciudad/turismo/ E-mail : [email protected] CAMPING/CAMPING SITE Camping Municipal Ciudad de Zaragoza (35km) +34 876 241 495 - 680 523 154 E-mail : [email protected] 451