apple computer mission statement
Transcription
apple computer mission statement
Fall/Automne 2015 PM #40065075 New CAUBO CAUBO President President Ne New Gitta Kulczycki La nouvelle présidente de l’ACPAU La nouvelle présidente de l’ACPAU Review of university endowment and pension funds Analyse des fonds de dotation et des caisses de retraite des universités Tablet application: MORE SIMPLE MORE EFFICIENT Download it now! Thanks to its intuitive navigation, it’s now easier than ever to conduct your transactions. Apple and the Apple logo are trademarks of Apple Inc., registered in the U.S. and other countries. App Store is a service mark of Apple Inc. Android and Google Play are trademarks of Google Inc. Romspen Mortgage Investment Fund YEAR 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 NET RETURN 9.9% 10.3% 10.5% 9.9% 8.7% 8.7% 8.2% 7.7% 7.4% 7.8% With a 49-year history of capital preservation and consistent returns, our commercial mortgage fund is ideal for pension funds, foundations and endowments seeking to improve fixed income returns without significantly increasing risk. Dianna Price [email protected] 416 928 5105 WHERE NOW? ALTERNATIVE FIXED INCOME? ABSOLUTE RETURN? I CAN HAVE BOTH. Results from January 1, 1995, to January 16, 2006, are those of a pool of individually-syndicated mortgages managed by the manager of Romspen Mortgage Investment Fund (the “Fund”). The indicated rates of return are historical returns calculated on a cash-on-cash basis, after fees, and the annual compounded net returns assume a monthly reinvestment of distributions. Returns do not take into account income taxes, changes in unit values, third-party expenses or redemption charges that would have reduced returns. This is not an offer to sell or a solicitation of an offer to buy units of the Fund, which are offered to investors who meet eligibility requirements under applicable securities laws. Fund units are offered only by offering memorandum, which contains important information about the Fund’s fees, objectives, and risk factors, and which should be read before investing. Consult your financial advisor. The Fund’s returns are not guaranteed, unit values may change, and past performance may not be repeated. N I A T S U E L AB S INNO N O I VAT ACHIEVING OUR SHARED VISION THROUGH SUSTAINABLE INNOVATION Chartwells unique partnerships extend beyond providing innovative solutions which engage students, faculty and staff. They include comprehensive student-focused initiatives such as local-based food sourcing, customized menus and brands and expert-led bundling of services and programs. Consistently putting students first allows Chartwells to enjoy long and successful partnerships with leading universities and colleges across Canada. Contact us to find out how together we will make your campus the first choice for today’s prospective students. Western Canada Terri Phipps (403) 613-0853 [email protected] Quebec Nathalie Picard (514) 574-5985 [email protected] Member of Compass Group Canada compass-canada.com t dineoncampus.ca Ontario and Atlantic Canada Morag McKenzie (647) 328-0709 [email protected] Canadian Association of University Business Officers Association canadienne du personnel administratif universitaire 315 – 350 rue Albert Street Ottawa, Ontario K1R 1B1 Tel./Tél.: (613) 230-6760 Fax/Téléc.: (613) 563-7739 [email protected]/[email protected] Executive Director/Directrice générale Nathalie Laporte Managing Editor/Rédactrice en chef Christine Hanlon Graphic Designer/Graphiste Daniel Goulet Marketing Manager/ Directeur du marketing Al Whalen Advertising Coordinator/ Coordonnatrice de la publicité Stefanie Hagidiakow Publications Mail Agreement #/Numéro de convention du service Poste-publications : #40065075 Return undeliverable Canadian addresses to/ Retourner toute correspondance ne pouvant être livrée au Canada à : [email protected] Third Floor/Troisième étage – 2020 avenue Portage Avenue, Winnipeg, Manitoba R3J 0K4 FALL/AUTOMNE 2015 Features VOLUME 23 • NUMBER 4 | VOLUME 23 • NUMÉRO 4 Articles A chat with incoming president Gitta Kulczycki ...................................................................... 9 Entretien avec la nouvelle présidente de l’ACPAU Gitta Kulczycki .........................................12 CAUBO’s new Strategic Plan 2015-2020 .....................................................................................14 Le plan stratégique 2015 - 2020 de l'ACPAU ..................................................................................14 CAUBO 2015 Conference review ..................................................................................................17 Retour sur le Congrès ACPAU 2015 ..................................................................................................17 2015 Recognition Award winners ................................................................................................22 Prix de reconnaissance 2015 .............................................................................................................24 Why does IT cost so much?.............................................................................................................27 Integrated leadership development: Working better, together ......................................32 Le développement du leadership intégré : travailler mieux, ensemble ................................38 Review of university endowment and pension funds .........................................................43 Analyse des fonds de dotation et des caisses de retraite des universities ............................62 Published four times a year on behalf of the Canadian Association of University Business Officers (CAUBO) by Publié quatre fois par année pour l’Association canadienne du personnel administratif universitaire (ACPAU) par 17 Third Floor - 2020 Portage Avenue Winnipeg, Manitoba R3J 0K4 Tel: 866-985-9780 Fax: 866-985-9799 www.kelman.ca [email protected] The views expressed in this publication are the responsibility of the publisher and do not necessarily reflect the views of the officers or members of the Canadian Association of University Business Officers. Les opinions exprimées dans cette publication sont la responsabilité de l’éditeur et ne reflètent pas nécessairement celles des dirigeants ou des membres de l’Association canadienne du personnel administratif universitaire. © 2015 Craig Kelman & Associates Ltd. All rights reserved. The contents of this publication may not be reproduced by any means, in whole or in part, without the prior written consent of the publisher. © Craig Kelman & Associates Ltd., 2015. Tous droits réservés. Cette publication ne peut être reproduite, en tout ou en partie, par quelque moyen que ce soit, sans autorisation écrite préalable de l’éditeur. Departments Chroniques People Moves ........................................................................................................................................ 6 Professional Development/Perfectionnement professionnel ..............................................69 People Moves Appointments Board of Directors ~ 2015-2016 Conseil d’administration Gitta Kulczycki President/Présidente Vice-President (Resources and Operations) Western University Canada (519) 661-3114 x83114 Fax/Téléc. : (519) 661-3139 [email protected] Gayle Gorrill Vice-President/ Vice-présidente Vice-President Finance and Operations University of Victoria (250) 721-7018 Fax/Téléc. : (250) 721-6677 [email protected] Eric Tufts Secretary-Treasurer/Secrétaire-trésorièr Vice-recteur à l’administration Université Sainte-Anne (902) 769-2114 x7309 Fax/Téléc. : (902) 769-3120 [email protected] Dave Button Past President/Président sortant Vice-President (Administration) University of Regina (306) 585-4386 Fax/Téléc. : (306) 585-5255 [email protected] Karen Cunningham has been appointed Vice-President, Administration and Finance at the University of New Brunswick. She has served as Acting Vice-President at the university since September 2014. Robert Einarson has been appointed Associate Vice-President Finance and Operations at UBC’s Okanagan campus, effective September 7, 2015. Einarson most recently served as Executive Director of Planning and Process Improvement at the University of Winnipeg. Michel Nadeau has been appointed Associate Vice-President of Facilities Directors / Administrateurs Isabelle Boucher Vice-présidente à l’administration Université du Québec (418) 657-4316 Fax/Téléc. : (418) 657-2132 [email protected] James Butler Vice-President, Finance & Administration Wilfrid Laurier University (519) 884-0710 x2248 / Fax/Téléc. : (519) 886-8645 [email protected] Michael Di Grappa Vice-Principal (Finance and Administration) McGill University (514) 398-2883 Fax/Téléc. : (514) 398-5902 [email protected] Michael Emslie Associate Vice-President (Financial Services and Operations) The University of Winnipeg (204) 258-2943 Fax/Téléc. : (204) 783-4996 [email protected] Donna Janiec Associate Vice-Principal (Finance) Queen’s University (613) 533-6000 x33048 Fax/Télec. : (613) 533-2011 [email protected] Sharon Johnson-Legere Vice President, Finance and Administration NSCAD University (902) 494 8112 Fax/Télec. : (902) 429 4925 [email protected] Matthew Nowakowski 'LUHFWHXUJpQpUDO6HUYLFHGHVÀQDQFHV Université de Montréal (514) 343-7153 Fax/Téléc. : (514) 343-6608 [email protected] Ad r i a n Te e s has been appointed Associate VP Human Resources at Emily Carr University of Art + Design. Son i a Tr udel has been appointed Concordia University’s Chief Financial 2IÀFHUDVRI$XJXVW7UXGHOKDV previously served as General Manager for CBC/Radio Canada’s Real Estate Division and as Vice-President of Finance, Administration and Asset Management for the Old Port of Montreal. Remembering Pat Hibbitts Nathalie Laporte Executive Director/Directrice générale (613) 230-6760, x268 Fax/Téléc. : (613) 563-7739 [email protected] Christopher Callbeck Assistant Vice-President (Financial & Administrative Services) University of New Brunswick (506) 648 5580 Fax/Téléc. : (506) 648-5714 [email protected] Management at Concordia University effective June 1, 2015. Nadeau’s most recent role was Director of Real Estate Transactions and Strategies for the City of Montreal. He replaces Peter Bolla, who is retiring from the university after 15 years. Sadly and unexpectedly, in June 2015 the CAUBO Community lost one of its most active and distinguished members: Patricia Hibbitts, known to most as Pat. Pat was one of a kind. Her level of contribution and list of accomplishments is unparalleled. A huge supporter and believer in life-long learning and in the education sector as a whole, she was a passionate and captivating person and communicator. Whether taking part in a casual conversation with colleagues or participating in a formal presentation in front of hundreds, her delivery was always informative, engaging and humorous. She was a ‘tell it like it is’ person, delivering her opinion with the sharpest wit and intelligence. The commitment that Pat demonstrated towards her career did QRWVHHPWRFRPHDWWKHVDFULÀFHRIKHU role as a wife, mother and grandmother; she was always proud to talk about her family and her personal pursuits. She was admired, highly respected and a mentor to many. Her passing will leave DVLJQLÀFDQWYRLGLQRXUFRPPXQLW\DQG in the voice for higher education in the years to come. As a tribute to such an active member of our community and a devout supporter of continuing education and professional development, CAUBO will be establishing a PD bursary in Pat’s name. The application and selection details will be available in early 2016. CAUBO Ken Clements Award recipient 2013 CAUBO Outstanding Contribution Award recipient 2012 CAUBO Board of Directors 2002-2011 CAUBO President 2009-2010 Quality and Productivity Award Selection Committee member 2006-2012 (Chair 2007-2010) Nominating Committee member 2009-2012 Editorial Board member 2002-2012 (Chair 2010-2012) Eight-time CAUBO conference presenter Click HERE to return to TABLE OF CONTENTS A chat with incoming CAUBO President fter a dozen years each in the private sector and as an administrator in health care, Gitta Kulczycki is entering her 12th year in university administration at Western University, as Vice-President of Resources and Operations. A mentor once told her “don’t let moss grow under your feet” and Kulczycki has certainly followed that advice. 7KHÀUVWRIKHU*HUPDQLPPLJUDQWIDPLO\WRDWWHQGXQLYHUVLW\VKHHDUQHGDQ+%&RPPHUFH degree Cum Laude in Accounting, Finance and Mathematics from Laurentian University – marrying her high school sweetheart in third year – followed by an MBA Magna Cum Laude from the University of Ottawa. She has lived and worked all across the country: as a Manager of Financial Services and Taxation for Bell-Northern Research in Ottawa; Corporate Controller for LSI Logic of Canada in Calgary; and Vice-President and Chief )LQDQFLDO2IÀFHUZLWKWKH*UDQG5LYHU+RVSLWDOLQ.LWFKHQHUWRQDPHDIHZ Her responsibilities at Western include everything from Finance and Human Resources to Facilities Management and Capital Planning Services, with plenty in between. After working with residences, research parks and an abundance of interesting and unique projects, .XOF]\FNLZLOOEHWKHÀUVWWRVD\WKDWDWDXQLYHUVLW\LWLVLPSRVVLEOHWREHFRPHERUHG Click HERE to return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 9 A chat with incoming CAUBO President Gitta Kulczycki Having worked in both areas, what differences do you see in the challenges affecting the health care sector and those facing higher education? Both clearly play a vital role for our society, future health, and success. Both compete for shares of the public purse. While we receive funds in different proportions – health care being fairly close to 100% governmentfunded, and higher education less so – there is a common duty to be accountable to our many stakeholders. In our sector, students and their families make a significant investment to attend university. So we have an important duty to them. The demographics of each sector are very different. The vast proportion of health care is consumed in the very last decade of life, whereas we at university are serving a young population. The focus is on making an investment: we’re helping young people become the leaders of tomorrow. Choosing higher education is a conscious choice while healthcare is a basic need. Health care is much more tightly controlled by government. However, government is becoming more involved in the operations of universities. To retain our autonomy in HE, it’s essential that we demonstrate accountability and transparency in how we manage our funds and discharge our mandate. When I was in health care, there was never enough money. Every year the budget was a challenge of making do with less while facing higher demands due to an DJLQJSRSXODWLRQ,QFRQWUDVWP\ÀUVW\HDUV in HE were marked by growing enrollments and related government investment. But these times have come to an end, so we need to learn to cope with lean times. What role do you see CAUBO playing in assisting universities to meet these challenges? I think there is a very important role for CAUBO to play in supporting the business side of higher education: promoting collaborative efforts; facilitating relationships with peers across Canada; sharing best practices and innovations; providing professional development; and being a national voice for members’ concerns on important business issues. A critical and unique area where CAUBO contributes is data. This is highly valued by not only member institutions but also a number of stakeholders interested in that data. 10 UNIVERSITY MANAGER • Fall 2015 As president, how do you foresee your role in the next two years? I see my role as facilitating and supporting the work of others. There are many excellent people involved in this organization, including the CAUBO staff and the many volunteers who give of their time and expertise. But I’m also not reluctant to roll up my sleeves and contribute effort and expertise where I can be helpful too. CAUBO is set to launch its new strategic SODQRQHWKDWQDPHGDVLJQLÀFDQWQXPEHU of changes that occurred over the past GHFDGHDQGLGHQWLÀHGWKHQH[WÀYH\HDUV as a critical transition period for the organization. I want to help, in year one of that new strategic plan, in the effort to determine and implement the changes we must make as an organization to respond to these important developments. I also see my role as an advocate for CAUBO. While higher education operates and is essentially funded under provincial oversight, there are many important issues, trends, topics and opportunities that transcend provincial boundaries. You have had quite a varied career. What is your approach when starting a new position? I start with a mindset of curiosity and an eagerness to learn, prepared to take as many hours as it takes. I ask many questions, meet as many people as possible, as quickly as possible, and engage with WKHPWRÀQGRXWZKDWWKHLUSULRULWLHVDUH and how I can help. The early days, when people are most understanding of your many questions and lack of knowledge, constitute the best time to absorb and learn. As you do all of that, no doubt you identify two or three areas where you can have some early positive impact. Then it’s critical that you deliver. I try never to take my prior organization with me. Every organization has a distinct culture and is its own place. I believe you need to come to understand and respect the culture, ÀJXULQJRXWKRZ\RXFDQFRQWULEXWHDQG work within it in order to be successful and helpful to the team that surrounds you. What insights from your experience in the private sector have you used in your work in higher education? Those were my early career years when I learned about leadership, resourcefulness DQGÁH[LELOLW\KDUGZRUNWKHLPSRUWDQFH of open communication and the team, and about the need to have alignment of personal and organizational values in order to be successful. All those things are still important in higher education. In addition, working in different sectors and positions KDVWDXJKWPHWKHLPSRUWDQFHRIÁH[LELOLW\ and the ability to embrace change. How has your volunteer work with CAUBO informed your work in higher education? I’ve learned a lot from colleagues across the country. I see how they have approached similar challenges and bring that back to my own organization. One gets exposure to other provincial regimes for higher education and that’s very enlightening. We are very fortunate in our sector to have colleagues who are so open to sharing information, ideas and experiences. It is quite unique and certainly a strength. What words of advice would you have for someone starting in higher education who had not previously been exposed to the sector and its particularities? Of all the experiences I’ve had, the university environment has been the most challenging to learn but also the most interesting and rewarding. Be prepared for a bit of culture shock. Universities operate in such a decentralized environment – to be successful they have to be that way. Do your homework. You’ll work with brilliant people who expect you to be prepared. Be open to input and different approaches as people will challenge you to look at matters in different ways. Find ways to engage with students. Their energy, enthusiasm and eagerness is invigorating – and contagious. They always remind me of why I’m here. Know that the work you do is ultimately helping these young people to be our leaders of tomorrow. In how many places can you work and make that statement? What would you say to people who are considering becoming involved with CAUBO? Do it! You won’t regret it. You’ll meet people from across the country. You’ll have a chance to contribute to your profession and to higher education in a variety of ways. You ZLOOOHDUQQHZWKLQJV,WZLOOEHQHÀWQRWRQO\ you and your institutions, but all of us. Click HERE to return to TABLE OF CONTENTS Entretien avec la nouvelle présidente de l’ACPAU, près une douzaine d’années dans le secteur privé et douze autres dans l’administration de la santé, Gitta Kulczycki en est à sa douzième année dans l’administration universitaire à la Western University, où elle est vice-rectrice aux ressources et aux opérations. Un mentor lui a conseillé un jour de « ne pas laisser la mousse lui pousser sous les pieds », conseil qu’elle a assurément suivi. Première de sa famille d’immigrants allemands à fréquenter l’université, elle a obtenu son EDFFDODXUpDWVSpFLDOLVpHQFRPPHUFHDYHFPHQWLRQFXPODXGHHQFRPSWDELOLWpÀQDQFHVHW mathématiques de l’Université Laurentienne – où elle a épousé son petit ami du secondaire en troisième année – puis elle a poursuivi avec un MBA avec mention magna cum laude de l’Université d’Ottawa. Elle a habité et travaillé partout au pays, notamment comme JHVWLRQQDLUHGHVVHUYLFHVÀQDQFLHUVHWGHODWD[DWLRQFKH]%HOO1RUWKHUQ5HVHDUFKj2WWDZD FRQWU{OHXVHFKH],16/RJLFRI&DQDGDj&DOJDU\HWYLFHSUpVLGHQWHHWGLUHFWULFHGHVÀQDQFHV du Grand River Hospital à Kitchener. :HVWHUQ HOOH V·RFFXSH j OD IRLV GH ÀQDQFHV GH UHVVRXUFHV KXPDLQHV GH JHVWLRQ GHV LQVWDOODWLRQVGHSODQLÀFDWLRQGHVLPPRELOLVDWLRQVHWGHELHQG·DXWUHVFKRVHVHQFRUH$SUqV avoir travaillé dans des projets impliquant des résidences, des centres de recherche et à une pléiade d’autres projets tout aussi uniques qu’intéressants, Gitta Kulczycki sera la première à dire qu’il est impossible de s’ennuyer dans une université. Comme vous avez travaillé dans les deux secteurs, quelles différences voyezYRXVHQWUHOHVGLIÀFXOWpVTXHFRQQDvWOH milieu de la santé et celles qui touchent l’enseignement supérieur? Les deux secteurs jouent de toute évidence un rôle crucial pour notre société, notre 12 UNIVERSITY MANAGER • Fall 2015 bien collectif et notre prospérité. Les deux se disputent leur part des deniers publics. Bien que notre financement ne soit pas dans les mêmes proportions – les soins de VDQWp pWDQW ÀQDQFpV SUHVTXH j SDU les fonds publics, ce qui n’est pas le cas de l’enseignement supérieur – les deux secteurs ont la même préoccupation de reddition de compte par rapport aux nombreux acteurs de ces milieux. En éducation postsecondaire, les étudiants et leurs familles réalisent un investissement considérable pour fréquenter l’université. Nous avons donc une grande responsabilité envers eux. La clientèle desservie par ces deux secteurs est aussi très différente. Une Click HERE to return to TABLE OF CONTENTS grande proportion des soins de santé est « consommée » dans la dernière décennie de vie, tandis que la population universitaire est jeune. Notre préoccupation, c’est d’investir : nous aidons les jeunes à devenir les dirigeants de demain. Le choix des études postsecondaires est une décision consciente, tandis que le recours aux services de santé est un besoin essentiel. Le gouvernement exerce un contrôle beaucoup plus serré dans le milieu de la santé, même s’il s’immisce de plus en plus dans les activités des universités. Pour conserver notre autonomie, en éducation postsecondaire, il est essentiel de prouver notre responsabilité et notre transparence dans notre façon de gérer nos fonds et de nous acquitter de notre mandat. Quand j’étais dans le domaine de la santé, il n’y avait jamais assez d’argent. Chaque année, il fallait adapter le budget pour faire notre travail avec moins d’argent, malgré une hausse de la demande en raison de la population vieillissante. À l’opposé, mes premières années en éducation postsecondaire ont été marquées par une hausse des inscriptions et des investissements gouvernementaux. Cette époque étant révolue, nous devons apprendre à vivre plus modestement. savoir-faire. Mais je n’hésiterai pas du tout à retrousser mes manches et à mettre les efforts et l’expertise là où il le faudra. L’ACPAU s’apprête à lancer son nouveau plan stratégique, qui tient compte d’un nombre considérable de changements survenus dans les dix dernières années et qui établit les cinq prochaines années comme période de transition cruciale pour l’organisme. À l’an un de ce nouveau plan stratégique, je veux SDUWLFLSHU j OD GpÀQLWLRQ HW j O·DGRSWLRQ des changements que nous devons apporter, en tant qu’association, pour réagir à ces importants développements. Je pense avoir un rôle de promotion des intérêts à jouer envers l’ACPAU. Bien que l’éducation postsecondaire relève essentiellement des provinces, bon nombre d’enjeux, de tendances, de possibilités et de sujets importants transcendent les frontières provinciales. 9RXVDYH]XQHFDUULqUHSOXW{WGLYHUVLÀpH Que faites-vous quand vous commencez un nouvel emploi? Je pense que l’ACPAU a un rôle très important à jouer en offrant du soutien au volet administratif de l’éducation postsecondaire : promouvoir les efforts concertés; favoriser les rapports avec des homologues de partout au Canada; diffuser des pratiques exemplaires et des innovations; offrir du perfectionnement professionnel; servir de porte-parole national pour faire entendre les préoccupations des membres sur d’importants enjeux de gestion. L’ACPAU est aussi une source importante et unique de données, ce qui est très intéressant non seulement pour les établissements membres, mais aussi pour de nombreux acteurs du milieu. Je me mets d’abord en mode apprentissage et je me prépare à y mettre autant d’heures qu’il le faudra. Je pose beaucoup de questions, je rencontre le plus de gens possible, le plus rapidement possible, je discute avec eux pour savoir quelles sont leurs priorités et ce que je peux faire pour eux. C’est aux premiers jours en poste, alors que les gens vous pardonnent très volontiers vos nombreuses questions et votre méconnaissance de certains dossiers, que l’apprentissage et l’absorption sont à leur FRPEOH$XÀOGHFHVGpPDUFKHVMHGLVWLQJXH évidemment deux ou trois domaines où je pourrai faire rapidement une contribution positive. Il est alors essentiel de produire des résultats. J’essaie aussi de ne pas apporter le bagage provenant de mon employeur précédent. Chaque entreprise ou association a sa propre culture et sa propre place. Il faut arriver à comprendre et à respecter cette culture, et à trouver une façon de contribuer et de travailler en fonction de cette culture si l’on veut réussir et aider son équipe. Comment entrevoyez-vous votre rôle de présidente dans les deux prochaines années? Quels aspects de votre expérience dans le secteur privé vous servent-ils en éducation postsecondaire? Mon rôle est d’organiser et de soutenir le travail des autres. L’ACPAU a la chance de compter sur un grand nombre d’excellentes personnes, notamment son personnel et les nombreux bénévoles qui lui donnent de leur temps et de leur J’étais dans le secteur privé au début de ma carrière. C’est là que j’ai tout appris sur le leadership, la débrouillardise, la souplesse, l’ardeur au travail, l’importance de la communication ouverte et de l’équipe, et l’importance d’une concordance entre À votre avis, comment l’ACPAU peutelle aider les universités à traverser ces PRPHQWVGLIÀFLOHV" Click HERE to return to TABLE OF CONTENTS les valeurs personnelles et les valeurs de l’entreprise pour réussir. Tout cela est encore important en éducation supérieure. De plus, le fait de travailler dans différents secteurs et à différents postes m’a appris l’importance de la polyvalence et de la capacité de s’adapter au changement. Comment votre bénévolat auprès de l’ACPAU influence-t-il votre travail en éducation postsecondaire? J’ai beaucoup appris de mes collègues de partout au Canada. Je vois de quelle façon ils règlent des problèmes semblables aux miens et je les transpose dans mon contexte. L’ACPAU m’a fait connaître d’autres régimes provinciaux d’enseignement supérieur, ce qui est très enrichissant. Notre secteur est très choyé de pouvoir compter sur des collègues si disposés à partager de l’information, des idées et des expériences. C’est quelque chose d’unique et c’est certainement une de nos forces. Quels conseils donneriez-vous à quelqu’un qui commence en éducation postsecondaire VDQVFRQQDvWUHOHVHFWHXUQLVHVSDUWLFXODULWpV" De tous les endroits où j’ai travaillé, c’est le PLOLHXXQLYHUVLWDLUHTXLDpWpOHSOXVGLIÀFLOH à apprivoiser, mais aussi le plus intéressant HW OH SOXV JUDWLÀDQW $WWHQGH]YRXV j XQ petit choc culturel. Les universités sont des milieux très décentralisés, et il faut qu’elles le soient pour se démarquer. Faites vos devoirs. Vous travaillerez avec des gens brillants qui s’attendent à ce que vous soyez prêt. Soyez ouverts aux commentaires et aux nouvelles approches, car les gens vous amèneront à voir les choses autrement. Trouvez des façons d’établir des contacts avec les étudiants. Leur énergie, leur enthousiasme et leur volonté sont stimulants – et contagieux! Ils me rappellent toujours pour quelle raison je suis là. N’oubliez pas que votre travail consiste en fait à aider ces jeunes à devenir les dirigeants de demain. Dans combien de milieux de travail peut-on faire ce JHQUHG·DIÀUPDWLRQ" Que dites-vous aux gens qui songent à participer aux activités de l’ACPAU? Je leur dis : n’hésitez pas, vous ne le regretterez pas. Vous y rencontrerez des gens de partout au pays. Vous aurez la possibilité de contribuer à votre profession et à l’éducation supérieure de plusieurs façons. Vous apprendrez EHDXFRXSHWFHVHUDSURÀWDEOHSRXUYRXVHW votre établissement, mais aussi pour chacun de nous. UNIVERSITY MANAGER • Fall 2015 13 CAUBO’s new Strategic Plan 2015-2020 Le plan stratégique 2015-2020 de l’ACPAU F À Overarching strategy: 1. Adopt an issue-based, member-guided prioritization and planning culture. This strategy is key to orient CAUBO’s activities and structure LQWHUPVRILVVXHVIDFHGE\²DQGLGHQWLÀHGE\²PHPEHUV driven by the priorities of the VP members. Stratégie globale : $GRSWHUXQHFXOWXUHGHSODQLÀFDWLRQUHSRVDQWVXUOHVSULRULWpVGLFWpHVSDU OHVPHPEUHVHWOHXUVHQMHX[FOpV Cette stratégie est essentielle puisqu’elle oriente les activités et la structure de l’ACPAU vers les enjeux auxquels les membres sont confrontés — et qu’ils ont eux-mêmes relevés — et tient compte des priorités des vice-recteurs membres. ollowing an extensive member engaged planning SURFHVV &$8%2 ODXQFKHG D ÀYH\HDU VWUDWHJLF SODQ which was presented at the Annual General Meeting held in Saint John, NB in June. A detailed copy of the 20152020 is now available for all members to read on our website, www.caubo.ca. In the plan, CAUBO adopted a new Vision and Mission VWDWHPHQWDVZHOODVÀYHVWUDWHJLHV Vision: CAUBO is a key enabler of excellence in Canadian higher education administration. Mission: CAUBO provides a national perspective on matters related to higher education administration. It strengthens the capacity of leaders in the sector by connecting them with peers and information, enabling them to pursue opportunities and create solutions for shared issues. Operational strategies: 2. Proactively articulate, capture and disseminate a national perspective on key issues. This strategy asserts CAUBO’s role at the national level on issues where influence, information, or advocacy are important ways to deliver value to members and to the sector. 3. Connect members to resources that inform decision-making and SUREOHPVROYLQJUHODWHGWRWKHLUPRVWVLJQLÀFDQWDGPLQLVWUDWLYH or operational needs. This strategy focuses on CAUBO’s effectiveness as an information clearinghouse and provider to the sector, and as a catalyst for members to connect with each other, ultimately as a means to support them in their work. This strategy was informed by the results of the member needs survey, which ODVXLWHG·XQYDVWHH[HUFLFHGHSODQLÀFDWLRQHWGHFRQVXOWDWLRQGHV membres, l’ACPAU a lancé son plan stratégique quinquennal et l’a présenté à l’assemblée générale annuelle tenue à Saint John en juin. Les membres peuvent consulter la version détaillée du plan 20152020 sur notre site web au www.caubo.ca. Dans ce plan, l’ACPAU a adopté un nouvel énoncé de vision et de mission ainsi que cinq stratégies : Vision : L’ACPAU joue un rôle essentiel dans l’atteinte de l’excellence dans l’administration de l’enseignement supérieur au Canada. Mission : L’ACPAU fournit un point de vue national sur des enjeux liés à l’administration de l’enseignement supérieur. Elle renforce les capacités des leaders du secteur en les mettant en contact avec leurs pairs et en leur donnant de l’information, leur permettant ainsi de tirer parti des occasions qui se présentent et de créer des solutions à des problèmes communs. Stratégies opérationnelles : 2. Concevoir, exprimer et diffuser de façon proactive un point de vue national VXUGHVHQMHX[FOpV Cette stratégie fait valoir le rôle de l’ACPAU sur la scène nationale en FHTXLFRQFHUQHOHVHQMHX[RO·LQÁXHQFHO·LQIRUPDWLRQRXODGpIHQVH des intérêts peuvent créer de la valeur pour les membres et le secteur. 3UpVHQWHU DX[ PHPEUHV GHV UHVVRXUFHV TXL OHV DLGHURQW j SUHQGUH GHV GpFLVLRQV HW j UpVRXGUH GHV SUREOqPHV HQ OLHQ DYHF OHXUV EHVRLQV DGPLQLVWUDWLIVRXRSpUDWLRQQHOVOHVSOXVLPSRUWDQWV &HWWHVWUDWpJLHPHWO·DFFHQWVXUO·HIÀFDFLWpGHO·$&3$8HQWDQWTXHIRXUQLVVHXU et centre de diffusion de l’information à l’échelle du secteur, et en tant que catalyseur d’interactions entre les membres, comme forme de soutien dans le cadre de leur travail. Elle se fonde sur les résultats tirés du sondage sur les besoins des membres, lesquels démontrent l’importance des données de référence, des pratiques exemplaires et des conseils de pairs. Hospitality... Like Never Before! Hospitality. Dalvay Sydney Fredericton M nctoon Mo Moncton n HOTELS AND RESORTS dpmurphyhotelsandresorts.com Saint John Halifax ax 14 Charlottetown UNIVERSITY MANAGER • Fall 2015 6DL 6DLQW-RKQ)UHGHULFWRQ0RQFWRQ &KDUORWWH &KDUORWWHWRZQ'DOYD\+DOLID[6\GQH\ Click HERE to return to TABLE OF CONTENTS indicate the importance of benchmark data, best practices and peer advice. 4. Foster a strong community of university administrators within CAUBO. For members, connecting with each other is a key element of the value they derive from CAUBO. This strategy seeks to enable these connections, and to capture and leverage the outputs in ZD\VWKDWEHQHÀWDOO Enabling strategy: 5. Align CAUBO’s structure to support strategies and enable success. The strategies require CAUBO to reinvent and redesign its existing structure and operating model in order to remain relevant and VXVWDLQDEOH7KLVVWUDWHJ\UHFRJQL]HVWKHVLJQLÀFDQFHWKHFKDOOHQJHV and opportunities of this transformation. )DYRULVHUOHGpYHORSSHPHQWG·XQHIRUWHFRPPXQDXWpG·DGPLQLVWUDWHXUV universitaires au sein de l’ACPAU Pour les membres, la valeur de l’ACPAU repose en grande partie sur le fait qu’elle leur permet d’interagir avec d’autres membres. Cette stratégie vise à favoriser les interactions, mais également la VDLVLHHWODPLVHjSURÀWGHVH[WUDQWVSRXUOHELHQFRPPXQ Stratégie structurante : $GDSWHU OD VWUXFWXUH GH O·$&3$8 GH PDQLqUH j FH TX·HOOH SXLVVH DWWHLQGUHVHVREMHFWLIVHWFRQQDvWUHOHVXFFqV Les méthodes qui régissent actuellement la prestation des services ne sont pas viables. Par ailleurs, les stratégies exigent la réinvention et le remaniement de la structure et du modèle d’exploitation de l’ACPAU. Cette stratégie reconnaît donc la SRUWpHGHFHWWHWUDQVIRUPDWLRQHWOHVGLIÀFXOWpVTX·HOOHVRXOqYH Moving forward The plan sets CAUBO on a course to making a significant shift and difference, positioning itself in the national higher education landscape and significantly enhancing value to members. CAUBO staff and leadership are now undertaking the process of putting the plan into action. We will continue to engage members in the operationalization of the plan. We look forward to your contributions and support as we work collectively towards accomplishing our strategic goals. Prochaines étapes Le plan met donc l’ACPAU sur la voie d’une profonde transformation et d’un renforcement de sa portée concrète, en permettant à celle-ci de se tailler une place dans le paysage national de l’enseignement supérieur et de créer une plus grande valeur pour les membres. Le personnel et la direction de l’ACPAU en sont maintenant à l’étape de la mise en œuvre et continueront de consulter les membres pour l’opérationnalisation du plan d’action. Nous vous remercions à l’avance de votre contribution et de votre appui dans cet effort collectif qui nous permettra d’atteindre nos objectifs stratégiques. We extend our sincere appreciation to the hundreds of members who contributed to the development of the plan through interviews, focus groups, surveys and other consultations. 1RVVLQFqUHVUHPHUFLHPHQWVDX[FHQWDLQHVGHPHPEUHVTXLRQWFRQWULEXp j O·pODERUDWLRQ GH FH SODQ HQ SDUWLFLSDQW j GHV HQWUHYXHV JURXSHV GH discussion, sondages et autres consultations. Click HERE to return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 15 Don’t put your DC plan members in danger. Your plan members work hard to help students shape their future. They deserve a plan that can help them fund a comfortable retirement. Find out if yours makes the grade. Guided Outcomes: Powerful insights to improve retirement outcomes Retirement income adequacy is a burning issue for politicians and pension regulators – and with good reason. With ongoing improvements in life expectancy and longer retirements, it’s more important than ever for you to understand what your plan delivers. Guided Outcomes (GO) – exclusively from Eckler Ltd. – can help you. GO offers DC plan sponsors real-time analysis showing how contribution levels and plan design changes can affect member outcomes. It’s driven by Eckler’s Living Standard Replacement RatioTM model, which measures your members’ ability to maintain their lifestyle in retirement. Find out how GO can help ensure your DC plan members achieve their retirement income needs. Call Cam MacNeish at 416-696-4068 or email [email protected]. guidedoutcomes.ca CAUBBO 20115 Confferenncee Revvieew Survvoll duu conngrrèss 2015 he tides of change swept through Saint John, New Brunswick from June 14-16, 2015 as close to 550 delegates rolled into WRZQIRU&$8%2$FWLRQSDFNHGIURPWKHÀUVWPRPHQWV the conference opened with eye-opening statistics and thoughtprovoking commentary on current and upcoming trends in &DQDGLDQ KLJKHU HGXFDWLRQ ÀQDQFH IURP NH\QRWH VSHDNHU$OH[ Usher. The following morning, panelists Norman Betts and Tom Traves, along with moderator Ron Bond, built on Alex’s presentation by delving into some tough questions about who should be leading change at Canadian universities and how to accomplish it. As always, concurrent sessions covered a variety of issues, WUHQGVDQGWRSLFVRYHUERWKGD\VLQFOXGLQJÀQDQFLDOVXVWDLQDELOLW\ IT costs and service delivery trends, space planning and facilities usage, budget models and program prioritization. University Manager readers will see more in-depth coverage of several of these topics in upcoming issues, beginning with the feature article ‘Why Does IT Cost So Much?’ on page 27 of this issue. u 14 au 16 juin 2015, des vagues de changement ont déferlé sur Saint John, au Nouveau-Brunswick, où près de 550 participants sont débarqués en ville pour le congrès de l’ACPAU. Sous le signe de l’action dès les premiers instants, le congrès s’est ouvert sur des statistiques révélatrices et des commentaires portant à UpÁH[LRQVXUOHVWHQGDQFHVDFWXHOOHVHWIXWXUHVGDQVOHGRPDLQH GHV ÀQDQFHV HQ HQVHLJQHPHQW SRVWVHFRQGDLUH DX &DQDGD GH OD part du conférencier principal, Alex Usher. Le lendemain matin, les panellistes Norman Betts et Tom Traves et l’animateur Ron Bond ont renchéri sur la présentation de M. Usher en posant des TXHVWLRQV GLIÀFLOHV QRWDPPHQW TXL GHYUDLHQW rWUH OHV FKHIV GH ÀOHGXFKDQJHPHQWGDQVOHVXQLYHUVLWpVFDQDGLHQQHVHWFRPPHQW réaliser ces changements. Comme toujours, des séances concomitantes ont touché divers enjeux, thèmes et tendances pendant les deux jours du FRQJUqVSDUH[HPSOHODYLDELOLWpÀQDQFLqUHOHFRWGHV7,HWOHV WHQGDQFHV GDQV O·RIIUH GH VHUYLFH OD SODQLÀFDWLRQ GH O·HVSDFH et l’utilisation des installations, les modèles budgétaires et la priorisation des programmes. Les lecteurs de Gestion universitaire verront des articles plus étoffés sur plusieurs de ces sujets dans les prochains numéros du magazine, à commencer par l’article GHIRQG©3RXUTXRLOHV7,FRWHQWHOOHVVLFKHU"ªjODSDJH de ce numéro-ci. Misseed a sessiion – or thhe conferencce? Visit the Liive Leearninng Ceentre and viiew recordeed conttent noow! CAUBO’s Live Learning Centre has been updated to include captured content from the CAUBO 2015 conference as well as the pre-conference seminars. Attendees receive access to this content free of charge, while members who did not attend the conference or pre-conferences may purchase individual sessions or packages at member prices. You can review sessions you attended at the conference, and experience sessions you missed, in the form of screen captures of the sessions including all audio, video and slides used in the presentations. Stream conference content on your computer or mobile device anytime, anywhere. Click HERE to return to TABLE OF CONTENTS Vouus avvez ratté une des séances ou le conngrèss commee tel? Allez au Livve L earninng Centtre poour vissionnerr les exposés qui vous inntéressennt! Le Live Learning Centre de l’ACPAU propose maintenant des séances du congrès 2015 ainsi que des séminaires précongrès. UNIVERSITY MANAGER • Fall 2015 17 CAUBBO 20115 Confferenncee Revvieew Here are just a few of the sessions that are available on the Live Learning Centre from CAUBO 2015: • Canada’s Universities: Cost Pressures, Business Models and Financial Sustainability • Fostering a Culture of Service Excellence • The Role of Ancillary Services – Best Practices in Relevance • Using a P3 Model to Develop New Residences • Business Process Re-engineering: Hype or Reality? Vous y avez accès gratuitement si vous avez assisté au congrès; sinon, vous pouvez acheter l’une ou l’autre des séances aux prix pour membres. Qu’il s’agisse d’exposés que vous voulez revoir ou que vous avez manqués, vous pouvez y accéder sous forme de captures d’écran avec audio, vidéo et diapos. Vous pourrez aussi les lire en continu sur votre ordinateur ou votre appareil mobile au moment et à l’endroit de votre choix. Voici quelques-unes des séances du congrès 2015 offertes par le Live Learning Centre (en anglais) : • Canada’s Universities: Cost Pressures, Business Models and Financial Sustainability • Fostering a Culture of Service Excellence • The Role of Ancillary Services – Best Practices in Relevance • Using a P3 Model to Develop New Residences • Business Process Re-engineering: Hype or Reality? Thaank yoou to thhe Locall Organiizing Commmittee annd the volunnteers in red t-shirts! The members of the CAUBO 2015 Local Organizing Committee from the University of New Brunswick helped to plan and deliver a well-run, engaging and memorable conference. We are so grateful for the time, expertise and enthusiasm that each and every one of them generously offered in support of CAUBO 2015: • • • • • • • • • Chris Callbeck, Conference Chair Sue Allen and Cathy Mahboob, Co-Liaisons • Janice Hicks Erin Caines • Natalie Kallar Nicola Cassidy • Carla Lavigne Karen Cunningham • Peter McDougall Heather Finkle • Keri Regier Cindy Flann • Katie Stevens David Gillespie Larry Guitard In addition, more than 20 volunteers from the University of New Brunswick supported every aspect of the conference. From registration and assistance at networking events and sessions to KHOSZLWKWUDQVSRUWDWLRQDQGZD\ÀQGLQJWKHVHDZHVRPHPHQ and women helped ensure a great experience for delegates. Our heartfelt thanks to each and every one of the volunteers in red t-shirts for their hard work, smiling faces, and positive attitude! Unn mercii sincèrre au Coomité organnisateurr local et à l’ééquipe de bénnévoless aux t-shirts rougess! Les membres du Comité organisateur local du congrès 2015 de la University of New Brunswick nous ont aidés à organiser et à vous offrir un congrès bien rodé, stimulant et mémorable. Nous leur sommes très reconnaissants du temps, du savoir-faire et de l’enthousiasme qu’ils ont si généreusement consacrés à l’organisation du congrès 2015 : • • • • • • • • • Chris Callbeck, président du congrès Sue Allen et Cathy Mahboob, agentes de liaison • Janice Hicks Erin Caines • Natalie Kallar Nicola Cassidy • Carla Lavigne Karen Cunningham • Peter McDougall Heather Finkle • Keri Regier Cindy Flann • Katie Stevens David Gillespie Larry Guitard En outre, plus de 20 bénévoles de la University of New Brunswick ont contribué à tous les volets du congrès. Des inscriptions, séances et activités de réseautage au transport et à l’orientation, ces hommes et ces femmes extraordinaires vous ont assuré une expérience exceptionnelle. Nos sincères remerciements à chacun des porteurs de t-shirts rouges pour leur excellent travail, leurs beaux sourires et leur attitude positive! 18 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE OF CONTENTS Our Sponsorss Nos commmandditaiiress CAUBO is grateful for the outstanding support of our sponsors, without whom events such as the Annual Conference would not be possible. Their valued contributions of time, money, products and services helped take CAUBO 2015 from ordinary to extraordinary! L’ACPAU sait fort bien que le congrès annuel ne pourrait se tenir sans le soutien exceptionnel de ses commanditaires, d’où notre profonde reconnaissance à leur égard. Leurs contributions – temps, produits, services – nous ont permis de vivre encore une fois une expérience extraordinaire! Princippal Partners/Par artten tenaires principaux Exxhibitors/Expos osaants Prestige Paartner/Partenaairire de prestige artenaires maj ajeeurs Major Partners/Par • MNP LLP • Grand & Toy Ltd. Delegaate Bag Spponsor/ Commmanditaire des sacs écologiques remis aux congressisstes • PeopleAdmin, Inc. Officiaal Sustainaability Spoonsor/ Commmanditaire officiel - viiab a ilité du développemment durablle • ARAMARK Higher Education Associat a e Partnerrs/Partenairres associés at • • • • • • • • • • • • • • • • • • • • Adaptive Insights Arizona State University Budget Car Rental Centurion Asset Management Inc. Commissionaires Concur Technologies Inc. FairTax Johnson Controls Knightsbridge Robinson Surrette (KBRS) Academic Search Mercer RBC Royal Bank Ricoh Canada Scotiabank Sightlines Sodexo Canada, Ltd. The Scion Group Tribal Visa Canada Western Union Business Solutions Click HERE to return to TABLE OF CONTENTS • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • Air Canada Akran Marketing AMJ Campbell Inc. ARAMARK Higher Education Armstrong Moving Best Doctors BMO Financial Group Campus Living Centres Canadian Campus Communities Cash Management Group at Raymond James Ltd. Chartered Professional Accountants of Canada CURIE Dana Hospitality LP Ellucian Enterprise Rent-A-Car and National Car Rental Follett of Canada, Inc. GovDeals, Inc. Honeywell IBM Canada Ltd. International SOS ITC Systems KYOCERA Document Solutions Macquarie Equipment Finance (MEF) Marsh Canada Limited MCW Custom Energy Solutions Ltd. MERX Networks Inc. MHPM Project Leaders Millennium Computer Systems Ltd. Moneris peerTransfer PeopleAdmin, Inc. Perceptive Software from Lexmark Precise ParkLink Inc. Projector Lamp Source RPR Environmental Salto Systems SciQuest Staples Advantage UNIGLOBE Travel UNB College of Extended Learning University of Guelph’s College of Business and Economics Executive Programs UNIVERSITY MANAGER • Fall 2015 19 CAUBBO 20115 Confferenncee Revvieew Optional Event: CAAUB UBOO Un Unco cork rked ed// Activité faccul ulta tatiive : L'ACCPA ta PAUU déb ébouché hée • Greystone Managed Investments Inc. • KPMG LLP Pree-co e- onferen encee Semmin inar Spo ponsor ors/ or s/ Coommmandiditairres des sém éminnai aires pr préc écon ongr grès ès • • • • • • • • • • • Aberdeen Asset Management CIBC Mellon Concur Technologies Inc. Ernst & Young LLP Fiera Capital Corporation Greystone Managed Investments Inc. Hicks Morley HigherEdPoints KPMG LLP MHPM Project Leaders RPR Environmental To view more photos from the conference, visit www.caubo.ca and click on the link under Latest News. SPECIALIZED INSURANCE AND RISK MANAGEMENT SERVICES × VQNQYGTRTGOKWO rates and comprehensive coverage × TQDWUVTKUMOCPCIGOGPV programs and services × GUUGPVKCNMPQYNGFIG sharing among the CURIE community Pour voir d’autres photos du congrès, visitez le www.caubo.ca et cliquez sur le lien sous Dernières nouvelles. Protecting universities. Sharing knowledge. CURIE was founded in 1988, at the peak of the liability insurance crisis with the mandate to stabilize premium costs and offer custom coverage for Canadian universities. Today, CURIE, Canada’s only non-profit reciprocal specializing in universities, represents large and small institutions. With a strong membership, CURIE is prepared for today and looking ahead to tomorrow. www.curie.org Canadian Universities Reciprocal Insurance Exchange 20 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE OF CONTENTS SHURE LITHIUM-ION RECHARGEABLE BATTERIES* THE POWER TO ENGAGE MINDS. Crystal clear audio plays an essential role in teaching and learning. Today's educational facilities require microphones that not only deliver audio clarity to the audience, but also operational efficiency to the technician. Shure lithium-ion rechargeable batteries for select Shure wireless systems contain a built-in smart chip that monitors battery health and transmits information on remaining runtime in hours and minutes. They also last longer than disposable alkaline batteries. Integrating rechargeable technology into educational installations not only results in top notch reliability for critical presentations, it’s also suitable for institutions who are looking for ways to increase cost-savings without sacrificing quality. For more information, download our Products for Installed Applications brochure at www.shurecanada.com/audiosolutions.pdf *Compatible with Shure QLX-D® and ULX-D® Digital Wireless Systems. www.shurecanada.com © 2015 Shure Incorporated Distributed in Canada by SFM | [email protected] | www.sfm.ca SB900 SBC200 Connect up to four SBC200. Charge mics and bodypacks.(Sold Separately) Remaining runtime displayed in hours and minutes accurate to within 15 minutes on wireless systems Generates significant cost savings over the use of alkaline batteries Reduces the amount of toxic materials sent to landfills T he CAUBO Recognition Awards celebrate and honour member volunteers who promote excellence, collaboration, leadership and LQIRUPDWLRQVKDULQJLQWKHÀHOGRIKLJKHU education administration in Canada. CAUBO is pleased to present the 2015 Recognition Award winners: KEN CLEMENTS DISTINGUISHED ADMINISTRATOR AWARD and mitigate risks of the Human Pathogens and Toxins Act and Regulations. Under Michael’s leadership, the University of Ottawa embarked on a project focused on developing a hazardous materials and equipment inventory system – HECHMET (Higher Education Consortium for Hazardous Materials and Equipment Tracking). This successful partnership between the University of Ottawa, Queen’s, Concordia and the Royal 0LOLWDU\&ROOHJHZRQÀUVWSUL]HDWWKH CAUBO Quality and Productivity Awards. created a Centre of Knowledge for the Best Value Business Model in Ontario, and then took the initiative to expand it to include all universities in Canada using the model. This project won second prize in the Themed Category of the 2015 CAUBO Quality and Productivity Awards. As a leader, Elizabeth understands the importance of focusing not only on business processes and systems, but also on the people side of managing change. She is a mentor to many, sharing her knowledge and encouraging others to develop personally and professionally. EMERGING LEADER AWARD LEADERSHIP IN LEARNING AWARD Michael J. Histed'LUHFWRU2IÀFHRI Risk Management, University of Ottawa 0LFKDHOH[HPSOLÀHVOHDGHUVKLSERWKLQKLV work at the University of Ottawa and in the provincial, national and international risk management arenas. He ensures that the work accomplished by his team is shared throughout the risk management and health and safety communities, and frequently spearheads high-impact initiatives in order to establish precedent and/or common ground with inter-university organizations and regulators. As co-founder and past Chair of the CAUBO Environmental Health and Safety Committee (now the Risk Management Committee) Michael helped broker a deal with the Canadian Nuclear Safety Commission to provide financial guarantees instead of cash payments for radioactive decommissioning projects on Canadian campuses, and worked with the Canadian Association of Research Administrators (CARA) to interpret impacts 22 UNIVERSITY MANAGER • Fall 2015 Elizabeth Krische, Director of Procurement Services, Western University Elizabeth’s extraordinary vision and passion have been instrumental in helping Western far surpass the targets for collaborative procurement spending set by the Ontario government. She also developed a viable business case to implement a user-friendly, cloud-based eProcurement solution at Western that launched on time and on budget and whose savings targets are on track. While Elizabeth’s commitment to Western University and exemplary procurement processes is unwavering, she is also mindful of the larger University community, seeking to collaborate and improve process provincially and nationally. Elizabeth built a proposal that Deborah Collis, Director, Financial and Administrative Services, Memorial University of Newfoundland Roxanne Millan, Director, Academic Support Services, Memorial University of Newfoundland Both Deborah and Roxanne are longterm CAUBO volunteers, well known for their support of continuing education for members. Deborah is a past member and Click HERE to return to TABLE OF CONTENTS Chair of the CAUBO Finance Committee while Roxanne currently Chairs the Academic Managers Committee. This dynamic duo was a significant contributor to making CAUBO’s Fall 2014 Higher Education Budgeting Basics workshop the great success it was. They played a key role in content customization and delivery, adding real value to the workshop by integrating the Canadian context, sharing their own experiences, and bringing a national awareness of the topic to the discussion. Their warm personalities made them easy to listen to and very accessible to workshop participants. Centre for Higher Education Research and Development (CHERD). Honorary membership is bestowed sparingly and only to those individuals who are deemed to have made an extraordinary contribution to CAUBO and the management of higher education. Honorary Members receive free lifetime registration at CAUBO annual conferences, so although Lucie will retire in 2015, we hope to see her there in the future. THANK YOU! CAUBO would like to thank all of our dedicated volunteers, whose support, dedication and expertise allow us to deliver timely, useful and relevant resources and information to members that facilitate and support their work. We are truly fortunate to have you on our team! For more information about the CAUBO Recognition Awards program, including past winners and criteria, please visit www.caubo.ca. HONORARY MEMBERSHIP Lucie Mercier-Gauthier, Associate Vice-President, Student Services, University of Ottawa Lucie has been a generous and consistent contributor to the University sector at both the regional and national level, serving as a member or Chair of many CAUBO Committees including Treasury, Financial Reporting, Administrative and Support Services, the Editorial Board, and the Q&P Awards Selection Committee, as well as on the Board of Directors. As Chair of the Treasury Committee, she was instrumental in heightening the professional level of expertise across the country in investment management and supervised the creation of the Debt Management Guide. In 2005 Lucie was honored with CAUBO’s Ken Clements Distinguished Administrator Award, re c o g n i z i n g h e r e x t r a o rd i n a r y leadership and contributions to CAUBO. She is also a past recipient of the Ontario Finance Group’s Distinguished Leadership Award. Lucie has presented at many CAUBO annual conferences and has been an instructor for a number of years for the University Management Course in budget management offered by the Click HERE to return to TABLE OF CONTENTS S T N E D U T S LET HEIR WAY. PAY T Your students don’t want excuses – they want payment options. And as technology changes, Moneris® will be there, offering advanced payment solutions for today and tomorrow. Seize every sale with Moneris and set your business up for success. moneris.com | 1-866-319-7450 [email protected] ® MONERIS, and MONERIS & Design, are registered trade-marks of Moneris Solutions Corporation. TM MONERIS BE PAYMENT READY & Design is a trade-marks of Moneris Solutions Corporation. All other marks and registered trade-marks are the property of their respective owners. UNIVERSITY MANAGER • Fall 2015 23 es p r i x d e r e c o n n a i s s a n c e d e l ’ A C PA U r é c o m p e n s e n t l ’ e n g a g e m e n t d e s m e m b re s bénévoles en ce qui a trait à l’excellence, à la collaboration, au leadership et au partage de l’information dans le secteur de l’administration de l’enseignement supérieur au Canada. L’ACPAU est fière de présenter les lauréats des prix de reconnaissance 2015. L PRIX KEN CLEMENTS POUR ADMINISTRATEUR EXCEPTIONNEL Michael J. Histed, directeur, Bureau de la gestion du risque, Université d’Ottawa Michael est un exemple de leadership tant dans le travail qu’il mène à l’Université d’Ottawa que dans les réseaux provinciaux, nationaux et internationaux de la gestion du risque. Non seulement s’assure-t-il que le travail accompli par son équipe est partagé dans tous les milieux de la gestion du risque et de la santé et sécurité, mais il prend aussi fréquemment des initiatives particulièrement efficaces pour établir des précédents ou des terrains d’entente auprès d’organisations interuniversitaires et d’organismes de réglementation. À titre de cofondateur et d’ancien président du Comité de l’environnement et de la santé-sécurité au travail de 24 UNIVERSITY MANAGER • Fall 2015 l’ACPAU (devenu le Comité de la gestion des risques), Michael a contribué à élaborer un accord avec la Commission canadienne GH VUHWp QXFOpDLUH DÀQ TXH O·RQ SXLVVH IRXUQLU GHV JDUDQWLHV ÀQDQFLqUHV SOXW{W que des paiements comptants dans le cadre de projets de déclassement d’installations radioactives sur les campus canadiens, et il a travaillé avec l’Association canadienne des administratrices et des administrateurs de recherche (ACAAR) pour interpréter les effets et atténuer les risques afférents à la Loi sur les agents pathogènes humains et les toxines ainsi qu’aux règlements qui s’y rapportent. Sous la direction de Michael, l’Université d’Ottawa a entrepris un projet visant à élaborer un système d’inventaire des équipements et produits dangereux – le système HECHMET (Higher Education Consortium for Hazardous Materials and Equipment Tracking). Ce partenariat fructueux entre l’Université d’Ottawa, la Queen’s University, l’Université Concordia et le Collège militaire royal du Canada a remporté le premier prix du Programme des prix de la qualité et de la productivité de l’ACPAU en 2013. Félicitations! PRIX DE LEADER ÉMERGENT Elizabeth Krische, directrice, Services d’approvisionnement, Western University Animée par une vision et une passion hors du commun, Elizabeth a aidé la Western University à largement surpasser les cibles de dépenses en approvisionnement FROODERUDWLIÀ[pHVSDUOHJRXYHUQHPHQWGH l’Ontario. Elle a aussi monté un dossier de justification viable pour mettre en oeuvre une solution d’approvisionnement infonuagique et conviviale à la Western University, solution qui a été lancée au moment et avec le budget prévus, et qui est en bonne voie d’atteindre les objectifs G·pFRQRPLHÀ[pV Bien que son engagement envers la Western University et les processus d’approvisionnement exemplaires soit indéfectible, Elizabeth est attentive à la grande communauté universitaire; elle cherche à collaborer avec ses collègues et à améliorer les processus à l’échelle provinciale et nationale. Elizabeth a soumis une proposition qui a mené à la création du Centre of Knowledge for the Best Value Business Model en Ontario, puis elle a pris l’initiative d’étendre cette idée à toutes les universités du Canada utilisant le modèle d’affaires « Best Value ». Ce projet a remporté le deuxième prix de la qualité Click HERE to return to TABLE OF CONTENTS et de la productivité de l’ACPAU dans la catégorie thématique en 2015. En qualité de leader, Elizabeth comprend l’importance de se concentrer non seulement sur les processus et les systèmes administratifs, mais aussi sur les gens qui gèrent le changement. Elle est un mentor pour plusieurs, n’hésitant pas à partager ses connaissances et à encourager les autres à s’épanouir personnellement et professionnellement. PRIX DE LEADERSHIP EN APPRENTISSAGE Roxanne préside actuellement le Comité des gestionnaires académiques. Ce duo dynamique a contribué de près au succès retentissant de l’atelier « L’ABC de la budgétisation en enseignement supérieur : concepts, création et connexions » donné à l’automne 2014 par l’ACPAU. Deborah et Roxanne ont joué un rôle clé dans l’adaptation et la présentation du contenu de l’atelier, et elles y ont ajouté une valeur réelle avec l’intégration du contexte canadien, le partage de leurs expériences propres et la dimension nationale donnée au sujet de discussion. Leurs personnalités chaleureuses les ont rendues faciles à écouter et très accessibles aux participants. MEMBRE HONORAIRE Deborah Collis, directrice, 6HUYLFHVÀQDQFLHUVHWDGPLQLVWUDWLIV Memorial University of Newfoundland Lucie Mercier-Gauthier, vice-rectrice associée, Services aux étudiants, Université d’Ottawa Roxanne Millan, directrice, Services de soutien académique, Memorial University of Newfoundland Deborah et Roxanne sont toutes deux des bénévoles de longue date de l’ACPAU, bien connues pour leur soutien à la formation continue des membres. Deborah a été membre et présidente du Comité des finances de l’ACPAU, tandis que Lucie a contribué avec générosité et constance au secteur universitaire, tant à l’échelle régionale que nationale, en s’engageant comme membre ou présidente dans de nombreux comités de l’ACPAU, dont le Comité de trésorerie, le Comité VXUOHVUDSSRUWVÀQDQFLHUVOH&RPLWpGHV services administratifs et de soutien, le Comité de rédaction, le Comité de sélection des prix de la qualité et de la productivité, ainsi que le conseil d’administration. À titre de présidente du Comité de trésorerie, elle a grandement contribué à rehausser le niveau d’expertise professionnelle en gestion de placements dans tout le pays, et elle a supervisé la création d’un guide sur la gestion de la dette. En 2005, Lucie a reçu le prix Ken Clements pour administrateur exceptionnel en raison de son leadership extraordinaire et de sa formidable contribution à l’ACPAU. Elle a aussi reçu dans le passé le prix pour leadership exceptionnel de l’Ontario Finance Group. Lucie a prononcé des conférences à nombre de congrès annuels de l’ACPAU et a été chargée de cours pendant plusieurs années au Centre for Higher Education Research and Development (CHERD) pour le cours de gestion universitaire (volet de la gestion budgétaire). Le titre de membre honoraire est prestigieux; il n’est conféré que rarement et seulement aux personnes qui ont apporté une contribution extraordinaire à l’ACPAU ainsi qu’à la gestion de l’enseignement supérieur. Les membres honoraires reçoivent une inscription gratuite à vie aux congrès annuels de l’ACPAU. Bien que Lucie prenne sa retraite en 2015, nous espérons la voir à nos prochains congrès. MERCI! L’ACPAU tient à remercier tous ses bénévoles, car sans leur appui, leur dévouement et leur expertise, il ne nous serait pas possible d’offrir diligemment à nos membres les ressources et renseignements utiles qui viennent faciliter et soutenir leur travail. Nous sommes choyés de pouvoir compter sur vous tous! Pour en savoir plus sur le programme des prix de reconnaissance de l’ACPAU, les lauréats et les critères d’admissibilité, veuillez visiter le www.acpau.ca. Visit the CAUBO website www.caubo.ca Visitez le site Web de l’ACPAU Visi www.acpau.ca Click HERE to return to TABLE OF CONTENTS CON NT TENT TEN TE EN ENT E NT S UNIVERSITY MANAGER • Fall 2015 25 Unleashing the power of your data In our recent edition of Education matters we explore how data and analytics technologies (DAT) are assisting post-secondary schools to bring not simply the brightest talent through their doors, but the right talent, and in a cost-effective manner. We specialize in helping higher education institutions transform data into insight and action. Our dedicated group of experts blend deep industry experience with the right skillset to deliver a customized solution that helps you harness the power of your data. Read the latest Education matters edition today: www.pwc.com/ca/educationmatters © 2015 PricewaterhouseCoopers LLP, an Ontario limited liability partnership. All rights reserved. 4845-03 0915 PROTECT YOUR CAMPUS Keep your campus, staff, students and faculty safe with the Commissionaires team of dedicated professionals. We’re the choice of more than 60 campuses across Canada for crime prevention, access control, intrusion detection, video surveillance and more. You can count on Commissionaires. Many are former military and RCMP, superbly trained and experienced to respond to your security needs. www.commissionaires.ca/campus 1 888 688 0715 26 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE OF CONTENTS %\0DUN5RPDQ&KLHI,QIRUPDWLRQ2IÀFHU6LPRQ)UDVHU8QLYHUVLW\ %\ \ 0DUN 0DU DUN5 5RPD 5RPDQ 5R PDQ Q & &KL KLHI KL K HII ,QIRU ,QIRU QIRU QI RUPD UPD PDWL PDWL WLLRQ WLRQ Q 2IÀ 2IÀFHU IÀ ÀFH FHU HU 6LPRQ LPRQ ) )UDVHU UDVH UD VHUU 8Q 8QLY 8 LYHU LYHUVLW\ HUVL VLW\ W\ \ Introduction Across Canada and around the world, senior university leaders are watching their IT budgets continue to grow. In an era of greater cost scrutiny, this expanding demand from IT seems counterintuitive and senior university leaders are increasingly questioning why. The simple answer is that IT costs are growing because universities are using IT more broadly and more systemically in everything they do. Yet that answer does not fully capture the big picture. There are many forces driving up costs and we need to understand what we can control and what we cannot. A brief history of IT cost, complexity, and importance The diagram below outlines the changing role and characteristics of IT university organizations as they have evolved over the past few decades. Every year we discover new and useful applications of information technology in the university, and we add new technologies to the portfolio of systems we are required to support. Constant technological innovation means constant increases in technology utilization, penetration, and dependency in all aspects of university research, administration, teaching, and learning. As the importance of IT grows on our campuses, so does its complexity and cost. Today we have a reached a point where IT is ubiquitous. Every participant in the university experience uses information technology. From board members accessing key documents on iPads to researchers collecting data from underwater observatories or students rating their professors online, we all use some aspect of IT every day. In this environment, many of the cost drivers are no longer within our control. With internal and external forces driving change, we face a vast array of controllable and uncontrollable cost drivers. Uncontrollable drivers of cost growth The uncontrollable drivers of IT cost growth are all around us. We live in an environment of constant technological innovation, and a university is not an island of splendid isolation. Key areas of uncontrolled drivers of growth in IT expenses are: • Breadth of demand Information systems are used by everyone on campus. Everything we do is impacted by IT. Every process RQFDPSXV²IURPWUDGLWLRQDOÀQDQFLDO transaction processing to more modern applications such as plagiarism detection – has an inherent IT component. In everything we do, we demand more and more information technology to get things done at the university. • Depth of demand The average person brings 1½ IT devices on campus with them every day; often a laptop, an iPad, and a smartphone. Not only are we using more systems, but we are using more devices to access those systems. IT must keep the response time fast while seamlessly supporting all points of access. • Increasing compliance demands We are experiencing increased demand for information systems to support legislative compliance in areas such as privacy, copyright protection, and freedom of information. Today, a lawyer is often consulted before a new system is even considered. The legal and compliance implications of any system are adding a new layer of cost and complexity to everything we do in IT. • Increasing security demands The IT world has become an increasingly dangerous place. Hacking has transcended simple acts of theft into high-stakes criminal cyber-attacks. We used to build firewalls, then we reinforced the firewalls, but that’s not enough anymore. The attacks are coming from inside and outside our boundaries. New security protection UHTXLUHV DUWLÀFLDO LQWHOOLJHQFH WRROV WR detect attacks inside the perimeter. These new layers of security are vastly more complex and expensive. • Any device Increasing demand to support whatever technology the client desires is expensive. We used to set some base standards for personal computer access to our network. Our clients no longer tolerate that approach. Now we have to install infrastructure and software to support every device imaginable: Apple PCs, Windows PCs, Linux PCs, Apple tablets, Android tablets, Windows tablets, Blackberries, and more. Time Characterization Description Today IT is ubiquitous Everyone and everything depends on IT 5 years ago IT became mission critical Universities could not run without it 10 years ago IT became a growth enabler Only IT could support growing demands on campus 15 years ago IT became a competitive advantage Research universities discovered IT was a competitive driver 20 years ago IT became an innovation driver IT solutions were driving innovative solutions 25 years ago IT became an operational necessity 6SHFLÀFFDPSXVIXQFWLRQVUHTXLUHG,7WRRSHUDWH 30 years ago IT became useful IT was recognized as necessary for transaction processing 35 years ago IT became interesting IT was still new in many areas on campus and it was exciting Click HERE to return to TABLE OF CONTENTS IT Cost IT Complexity & Importance Dependency Timeline UNIVERSITY MANAGER • Fall 2015 27 Investment servicing solutions for Canadian universities and colleges CIBC Mellon offers much more than core custody services. As a leading Canadian provider of asset servicing, we recognize that our clients’ needs go well beyond safekeeping and settlement. Our integrated offering combines proven custody solutions with advanced administration, information delivery and operational solutions to help institutional investors face today’s challenging market and regulatory environment. We work in close collaboration with BNY Mellon, the investments company for the world, to help you achieve your goals. For more information, contact: Shane Kuros at 416 643 6365 Tim Rourke at 416 643 5373 www.cibcmellon.com ©2015. A BNY Mellon and CIBC Joint Venture Company. CIBC Mellon is a licensed user of the CIBC trade-mark and certain BNY Mellon trade-marks, is the corporate brand of CIBC Mellon Trust Company and CIBC Mellon Global Securities Services Company and may be used as a generic term to reference either or both companies. We are here for you University and college administrators and officers... Sign up for a Retirement Planning Workshop near you: www.rto-ero.org/rpw-schedule-list Depuis 1968 Since 1968 À votre service...pour le soin de votre avenir. Here for you now ... Here for your future. www.rto-ero.org/join-us 1-800-361-9888 416-962-9463 Join RTO/ERO and access Canada’s largest voluntary group insurance plan for retired educators and educational support staff with over 89,000 participants! Attend a Retirement Planning Workshop for your chance to win a FREE iPad Mini! * *We value your privacy. Your information will remain within RTO/ERO and will never be sold. iPad Mini courtesy of RTO/ERO. At each of the workshops, one attendee will be selected by random draw to win one (1) Apple iPad Mini DSSUR[YDOXH&RUUHFWDQVZHUWRVNLOOWHVWLQJTXHVWLRQUHTXLUHG1RSXUFKDVHQHFHVVDU\&KDQFHVRIZLQQLQJL3DG0LQLZLOOGHSHQGRQWKHQXPEHURIDWWHQGHHVDWWKHVSHFLÀFZRUNVKRSL3DG0LQLLVDUHJLVWHUHGWUDGHPDUNRI$SSOH Inc. Apple is not a sponsor of, nor a participant in this promotion. 28 UNIVERSITY MANAGER • Fall 2015 Click HERE to return turn to TABLE TABL ABL BLE OF BLE O CONTENTS CONTENTS CO • Any time IT department budgets were established at a time when information systems were accessed during regular business hours. Today, accessibility to systems is expected 24/7. Not only is availability demanded, but round-the-clock staff support is also required. This broadening of system and support availability requires more money to implement and sustain. • Any place Similar to the any time cost driver, IT departmental budgets were established to support systems within the physical boundaries of campus. Those days are gone. Distributed learning, distance education, and multiple campuses across the globe now require access to all of our systems from anywhere. Building technical infrastructure to support the networking demand of this new world increases IT capital and operating costs. • Quality of software I taught a first-year undergraduate business course recently. When the students discovered I was the CIO they told me, “Your systems suck.” They were right. Compared to the cool apps they commonly use (Facebook, LinkedIn, Twitter, Instagram, etc.) our systems fail. Satisfying these growing quality expectations is expensive. • New teaching and learning technology New innovations in teaching and learning technology generate increasingly large video and image databases. For example, flipped classrooms require new technology to record and store vast volumes of video data. In-class student response systems demand instantaneous responses, requiring greater wireless capacity. Students come to our universities expecting the best classroom experience possible. The cost to renovate and upgrade our classrooms to new and rapidly changing technology accelerates the growth of IT and its commensurate expenses. • Exponential research data volume growth Research data demands are driven by several changes in the nature of research computing. For example, research using vast arrays of sensor networks leads to huge growth in pure data volume. Not only do we have to store the data, but we also have to transmit it over our networks and back it up in our archive systems. This massive growth in data demand is outpacing Moore’s Law and driving up costs. Click HERE RE E to to return re retu turn to TABLE TAB OF OF CONTENTS The full force of these drivers is affected by factors outside the university. The best we can do in these areas is to strive to manage their impact on our bottom line and on our clients’ expectations. Controllable Drivers of Cost Growth There are several cost drivers that are within our control. The way universities manage IT is the real culprit. The controllable drivers of IT cost growth are insidiously hidden behind seemingly unassailable campus myths. Some key areas of cost drivers that we can control include: • Distributed IT The growth of independent, isolated, and silo IT departments that are separate from central IT leads to duplication of HIIRUWVLQHIIHFWLYHVWDQGDUGVFRQÁLFWLQJ technologies, and highly risky security incidents. At many universities, IT expenditures for non-central IT are often higher than those for central IT. These non-central IT expenditures have none of the rigour and controls typically applied to central IT funding. • Redundant systems Distributed IT responsibilities lead to the implementation of independent IT systems without a coordinated plan, creating overlapping and redundant systems. Disproportionate cost increases DUHQHHGHGWRIXQGWKHVHLQHIÀFLHQFLHV • Data integration Data created by distributed IT departments and disparate systems cannot be integrated effectively. Multiple sources of data create duplication and redundancy in each of these systems. Resolution of data conflicts among multiple systems or multiple IT departments is expensive. Independent IT support, overlapping systems, and duplicated data issues arise from a genuine need to be responsive to unique and highly specialized local needs, but without disciplined management, the costs and risks are excessive. Controlling these cost drivers is a non-trivial management responsibility that lies within the control of IT, academic, and administrative leaders. Lack of control is acceptable only if the associated risks and costs are formally understood and accepted. IT Is an Investment Traditional IT departments spend almost 75% of their budgets on operational support work such as help desk, data centre management, and maintaining applications software. Only 25% of the budget is left for system enhancements and new projects, which leaves little room for innovation and creativity in the application of IT and projects a grim future for IT at our universities. As a result of budget challenges, universities need to shift their perspective on IT funding. Instead of viewing it as a necessary evil to keep everything up and running, expectations of IT need to change. We need to view IT as an investment in the future. IT is an institutional investment opportunity to improve productivity, capacity, quality, and performance of all aspects of academia. Chief Information 2IÀFHUV &,2V PXVW EH FKDOOHQJHG WR PRYH from the traditional 75% maintenance and 25% projects model to a new order. Universities need to invest in growth by setting an expectation that their IT budgets will allocate 25% to maintenance and 75% to investments. An investment focus requires the university to create prioritization criteria for IT investments and then ensure all institutional IT spending is assessed against these criteria. The IT organization becomes a creative partner with every university department in applying the prioritization mechanism to identify and implement revenue opportunities, quality improvements, cost HIÀFLHQFLHVDQGULVNPLWLJDWLRQV The diagram below illustrates the shifting emphasis. IT is an Investment Traditional IT Resource Allocation 25% Projects Ideal IT Resource Allocation 25% Operations 75% Operations 75% Projects “Keep the lights on” “Invest in the future” UNIVERSITY MANAGER • Fall 2015 29 Finding the real costs A thorough approach to sustainable investing + ESG Integration + Stewardship + Promoting Sustainable Financial Markets Measuring the real and full IT cost in a higher education environment is complex because IT funding comes from a variety of sources. This multiplicity of sources brings challenges in measuring the real spend. Where do all the hidden costs lie? Challenge the budget status quo: if all IT funds are not managed by the central IT department, understand why. Getting an accurate picture of who does IT work can be hidden behind the heroic generalist. With distributed IT staff, we see generalists who do everything IURP+5ZRUNDQGÀQDQFLDOWUDQVDFWLRQV to IT support. Counting those resource costs as part of the overall IT spend is GLIÀFXOW SDUWLFXODUO\ ZKHQ FHQWUDOL]LQJ management of work. Other costs are masked by unnecessary duplication. Many technologies are actively converging and some university organizations have not adapted. For example, audio-visual technology and IT DUHFRQYHUJLQJLQWRDXQLÀHGWHFKQRORJLFDO ecosystem, yet in many institutions they remain managed by distinct and disparate departments. Shifting to investments addenda-capital.com 30 UNIVERSITY MANAGER • Fall 2015 Moving to an investment model means changing the university’s IT portfolio. What do we stop doing? Consider spending less time doing IT commodity work like administering email systems and moving those resources up the food chain. Can we centralize all email on campus to a single email system with one set of administrators? Can we outsource this work to a provincial shared service provider or outsource it to the cloud? After all, teaching, learning, and research are not dependent on our email administrative skills. Those administrative resources are best re-purposed to leverage technology in areas such as pedagogy or highperformance research computing. Examine every commodity IT activity as an opportunity to move to a new service provision model – but they must be products and services we understand well. Never outsource something you cannot manage. When IT is no longer viewed as a cost, but as an investment, each project is an individual value proposition with a positive return on investment (ROI). IT projects are no longer bottom line expenses – they are opportunities to create products or services where the EHQHÀWVH[FHHGWKHULVNVDQGH[SHQVHV Click HERE to return turn to TABLE TABL ABL BLE OF BLE O CONTENTS CONTENTS CO Top 5 Best Practices Shift to a Common Infrastructure Move to a single, common infrastructure for all information systems at the institution. Leverage Shared Services Work with existing provincial and national higher education service providers. Support and encourage development of these services. Outsource to the Cloud Shift commodity services to the cloud when the IXOOEXVLQHVVFDVHLVEHQHÀFLDODQGWKHVHUYLFHLV trustworthy. Review for Currency Review all information systems contracts as if they were being signed today. What should be changed? Measure and Rationalize Measure the performance and utilization of the university’s information systems. Stop investing in low-value products and services. Maximizing the value of your IT spending Moving to an investment-driven IT organization means thinking differently about the complete cost structure. There are several emerging best practices in managing IT expenses. The most effective best practice in IT cost containment is moving to a common infrastructure. A common information systems platform for the entire institution PHDQVPDNLQJWKHGLSORPDWLFDOO\GLIÀFXOW decision to centralize the management and control of all information systems. One IT department equals one procurement process for all of IT and a single source of the truth for all data. Another best practice is developing shared provincial services for higher education IT. Much like provincial regional networking organizations like ORION or Cybera provide low cost shared bandwidth across the province, shared services in areas such as Disaster Recovery Planning (DRP), data centre management, and IT procurement can lower costs for all higher education institutions. BCNET is the Canadian leader in this approach. CANARIE is also pioneering services above the network that can be shared nationally. The cost-saving best practice receiving the most attention in the press is cloud computing. Essentially an outsourcing economic model, cloud computing delivers significant costs savings in some commodity IT services. Any cloud decision requires a careful business case that assesses the quantitative and TXDOLWDWLYHEHQHÀWVDJDLQVWWKHORQJWHUP risks and hidden costs. When properly assessed and closely managed, cloud computing lowers IT operating costs. Click HERE RE E to to return re retu turn to TABLE TAB OF OF CONTENTS IT contracts tend to be written once and then ignored, but there can be gold lurking in the contract details. What software was purchased years ago in a bundle that is no longer being used? ERP contracts are rife with these gems. Has staff, student, or faculty headcount declined? Many licensing contract fees vary by the number of enterprise users, and vendors do not always feel obliged to notify customers when billing could decrease. What can the university stop doing? Develop metrics such as tracking usage rates of technology over time. Then calculate the ratio of the number of users of each technology to the operating cost of that technology. Use these numbers to justify shutting down or outsourcing technologies that are not providing an appropriate ROI. Apply these best practices across the full portfolio of IT products and services and use the savings to re-invest in the projects the institution needs to move its strategic vision forward. The table below highlights WKHVHWRSÀYHEHVWSUDFWLFHV Summary Why does IT cost so much? First, the outside world continues to demand more IT services from universities. Second, universities are diplomatically delicate in their treatment of controllable IT costs. What we do about these cost drivers depends on how we manage expectations from the outside and how we apply leadership, strategy, and discipline to information systems management within the institution. The new world of IT is inexorably growing in depth and breadth across all campuses. Our dependency on IT grows more every day, leading to an inevitable growth in cost. The role of IT has increased over the years, leading to a commensurate increase in expense. Managing costs in an environment where external drivers dominate the ODQGVFDSH LV GLIÀFXOW 7KHUH DUH LQWHUQDO factors the university can control, but the most effective strategy is to set new expectations. The CIO must focus on a vision for the future and shift the budget model to support the new world of ubiquitous IT. Funding Your Future BNY Mellon Asset Management helps Canada’s colleges and universities plan for the future. See how innovative we can be, contact: Michael Parsons 416 775 5876 [email protected] ©2014 The Bank of New York Mellon Corporation. All rights reserved. UNIVERSITY MANAGER • Fall 2015 31 I n an op-ed piece for the Ottawa Citizen, Carleton Professor Emerita Katherine Graham points out that the word university is derived from the Latin word universitas, meaning ‘the whole.’ Yet institutions often experience a divide between those working in professional services, student services, and academia. These silos extend to leadership development, with this piecemeal approach only reinforcing boundaries and the limitations they impose. As universities face increasingly difficult challenges, these complex institutions need to draw on leadership from across the institution, working together toward the best possible solutions. Accordingly, under the leadership of President Roseann O’Reilly Runte, Carleton developed an integrated leadership development initiative alongside its 2013-2018 Strategic Integrated Plan (SIP). “A colleague from professional services and I moved the idea from something we would like to do to something we are doing,” says Graham, the initial academic lead for Carleton Leader, the university’s leadership development initiative. Climbing the Andes Climbing the Andes, the train zigzags upward pushed alternately by one of the two engines located at either end of the carriage. Aboard, medical personnel distribute oxygen masks to passengers as the air thins and lungs gasp for breath. But when you get to what feels like the top of the world, the sunrise is simply exquisite. There are goals which are well worth the effort. At Carleton University adopting a strategic integrated plan was the logical, if somewhat quixotic, next step for a progressive community with burgeoning academic and research portfolios. Successful enterprises regularly bring into 32 UNIVERSITY MANAGER • Fall 2015 DOLJQPHQW WKHLU GHYHORSPHQW ÀQDQFLDO and cultural strategies. Universities are GLIIHUHQWSDUWRIWKHQRWIRUSURÀWZRUOG WKH\PD\ZHOOKDYHSURÀWFHQWUHV:KLOH faculty are experts at interdisciplinary work, departments often exist as silos in ÀHOGVRIGUHDPVZKLFKDUHUHPRWHIURPWKH central budgetary function. Areas such as VWXGHQWVHUYLFHVDQGVWDIIEHQHÀWVPD\EH worlds unto themselves. Faculty and staff work together but may well see themselves in a hierarchical fashion. Students are partners in learning but may make demands resembling those of customers or, in some cases, as members of a union. Few universities have even attempted to create a truly integrated strategic plan. It was not without trepidation that we embarked on this project at Carleton University. Parts of the plan were easily envisaged and readily adopted by the entire academic community. Bringing together physical plant, ÀQDQFLDO UHVRXUFHV UHVHDUFK DQG WHDFKLQJ in areas such as the environment, disability services, health, including mental health, security, and digital communications and technology presented a natural continuation for work already well-established in each of these areas. The most difficult goal was to make leadership in all aspects of the University’s operations and in every sector of the campus Click HERE to return to TABLE OF CONTENTS The SIP process started with an examination of the core academic plan, and then brought in professional services and student services as well. “All plans should be integrated,” says Graham, noting WKDW 5XQWH KDG LGHQWLÀHG LQWHJUDWLRQ DV a priority, “but for Carleton, given our history, the academic plan, professional services plan, and student services plan had developed at different points. This was an opportunity, with a bit of time, to draw all three plans together.” At the same time, the university recognized that integrated leadership development was integral to moving the plan forward and pursuing its mission of collaboration, leadership and resilience, with impacts that would continue far beyond the lifespan of the SIP. The ultimate goal was to develop a community of leaders ZKR ZRXOG PDNH D VLJQLÀFDQW RQJRLQJ contribution to Carleton’s success. Like many universities, Carleton has a history of holding short leadership courses – one could say that they were management courses – for people working on campus, mostly in professional services areas such as financial services. The institution recognized that furthering its goals would require moving from this type of limited leadership training to more global leadership development, in a uniquely Carleton context. Accordingly, Graham’s counterpart, Cindy Taylor, Director at the Office of Quality Initiatives, launched a working group that looked at various models of professional development for professional services. At the same time, as Senior Advisor to the President and Provost, come together. While the strategic plan spoke of leadership and excellence in teaching and research as well as in governance and management, there was no obvious formula for bringing all talents together. A team including faculty, academic and non-academic administrators visited Sheffield, U.K. and, inspired by this experience, proposed a version of the program that institution had adopted. The goals were to contribute to the leadership capacity of faculty and staff from every sector of the campus, to build a community of engaged peers who are prepared to work together as cross-sectorial teams, to share understanding of major issues facing the institution and society and to promote the creation of positive and practical solutions IRUWKHWUXO\GLIÀFXOWFKDOOHQJHVIDFHGE\ higher education in general and Carleton 8QLYHUVLW\LQVSHFLÀF%\LQYHVWLQJLQRXU current faculty and staff, it was felt that they might be empowered to contribute actively to the achievement of the goals in each sector, to remain at the University and to understand not only the challenges we face but to have the ability to work as teams. These goals are the same as those of every other sector as all governments, companies and institutions look to creating a climate of co-operation and a positive working environment which fosters innovation. The Carleton program involved leadership and communications training in small teams of 20 faculty and staff from across the campus. Each team was challenged to identify a problem they believed to be of significance, to develop recommended solutions, understanding that the only funds available for their work were those they found themselves. The teams had total freedom to identify topics and to perform their work. Administrators gave participants total trust and respect asking only that they would apply their efforts for the good of the institution. Offered an array of excellent solutions to difficult problems, the administration would then have the problem of having more solutions than capacity to implement them. This meant that, in turn, the teams had to have respect and trust in the administration, an atmosphere which could only be developed with excellent, open communication and understanding. The teams selected meaningful topics including institutional competitiveness, the reputation of the University, i n t e rd e p a r t m e n t a l c o l l a b o r a t i o n , internationalization and globalization vs regional and local outreach, and faculty/ staff relations. Everyone gained a deeper appreciation for the issues selected. Some very specific recommendations were made and adopted (including some Web design and updated data and access to information facilitating collaborative work). Teams continue to work and to profit by knowing people Click HERE to return to TABLE OF CONTENTS Graham was given a mandate to look at what was being done in terms of academic leadership development, including the kinds of tools needed by the chairs and directors of academic departments. The two agreed to coordinate their efforts and explore different models. “That is how we came upon this initiative at Sheffield University that consciously brought together academic leaders – and up-and-coming leaders in the broader context – with professional services leaders,” explains Graham. She adds that a small group of administrators from Carleton traveled to the UK in November 2012 and spoke WR SHRSOH ZKR ZHUH LQYROYHG LQ 6KHIÀHOG Leader. “We decided that something akin to that was the approach we would take.” Unlike traditional leadership GHYHORSPHQW LQLWLDWLYHV 6KHIÀHOG /HDGHU who are located in different buildings and departments. Good, professional relationships have been developed across sectors and individuals have honed talents and skills and are bringing them to excellent use in their daily work and by taking advantage of opportunities to join committees across sectors that are designed to move forward the integrated plan. We are in the early light of dawn these days. We see, however, the sun rising over the campus and can see the warmth that will be spread as a growing number of staff and faculty have the opportunity to participate in this program. Integrating leadership is both a theme and a requirement in this time of economic stress when every agency, every institution needs every member of the team to understand the issues, to work HIIHFWLYHO\DQGHIÀFLHQWO\DVDWHDPDQGWR share their creative brilliance. Together, we shall make the sun, not only rise but shine its full promise. I salute my colleagues who have worked so carefully and diligently in designing this program. I am proud that Carleton can be considered a leader in creative leadership and I signal this program as an example of exceptionally good governance. Roseann O’Reilly Runte President, Carleton University UNIVERSITY MANAGER • Fall 2015 33 Collaboration gets you from here to there. As an institutional investor, you’re working to reach specific investment goals. And, through careful listening and close collaboration, we’re working to help you get there. Our broad suite of investment strategies has evolved in step with the changing needs of our investors. Together, we continue to build strategies that are inspired by innovation, strengthened by expertise, and validated by results. Let’s work together. Call 1-888-834-6339 or visit tdaminstitutional.com TD Asset Management Inc. is a wholly-owned subsidiary of The Toronto-Dominion Bank. ® The TD logo and other trade-marks are the property of The Toronto-Dominion Bank. Integrated leadership development focuses on the concept of a ‘leaderful’ university. “We want to encourage all our staff and faculty to be leaders, and not to be restricted by hierarchy or position of DXWKRULW\µH[SODLQV-DQH*LQQLYHU6KHIÀHOG·V Director, Leadership & Management 'HYHORSPHQW´6KHIÀHOG/HDGHULVLQFOXVLYH of all those employed by the University and QRWUHVWULFWHGWRFHUWDLQVWDIÀQJJURXSVRUE\ VHQLRULW\µ 6KH DGGV WKDW 6KHIÀHOG /HDGHU is not a ‘program,’ as there is no end point. The focus is on continuously developing a community and harnessing its potential to EHQHÀWWKHLQVWLWXWLRQ Although the Carleton initiative is not identical to Sheffield Leader, it is founded on the same precepts, including the idea that “we work best when we work together.” That leadership is spread throughout the institution and not tied to holding formal office. “In this way everyone has the potential to play a leadership role within the institution,” says Graham. The idea is to invest in those who have the greatest potential and interest in leadership, regardless of what role they currently play in the organization or how far along they are in their career. While adopting the basic principles RI 6KHIÀHOG /HDGHU &DUOHWRQ UHGXFHG WKH number of streams (or levels as they are GHVLJQDWHG DW 6KHIÀHOG IURP WR 7KH stand-alone streams are not intended to be sequential or hierarchical. “We’ve had assistant professors and junior associate professors participate in Carleton Leader Three, which is the broader of the three streams,” explains Graham. “Each stream is independent. It is not a progression. It is not necessary to complete 1 and 2 to be in 3” Carleton Leader 1 is for people who are interested in learning and exploring the notion of leadership. “There is a lot of emphasis on sharing,” notes Graham. Exercises include job shadowing and journaling about leadership experiences. Carleton Leader 2 is for people who have or are looking to have institutional LQÁXHQFH ZLWKLQ WKHLU RZQ XQLW EH LW DQ academic unit or work unit in professional services, and have already begun to work outside their particular domain within the university. Finally, Carleton Leader Three is for those who have a broad reach of HQJDJHPHQWDQGLQÁXHQFH /LNH6KHIÀHOG&DUOHWRQDGRSWHGDSURFHVV of nominating individuals to join the Leader community, but with some adaptations. To participate in Carleton Leader 1 or 2, individuals can self-nominate or be nominated by their manager/supervisor (directors, deans, vice-presidents). Click HERE to return to TABLE OF CONTENTS However, participation in Carleton 3 is only via nomination by a senior leader. For every round of Carleton Leader, the university strives for balanced participation in terms of gender, area of the university, and representation from professional services, student services, and academia. Carleton Leader 1 involves a launch followed by three-and-a-half days of activities, all held on campus. Carleton Leader 2 and 3 are held off-site. Each involves three modules of two to three days each. The modules encompass an examination of leadership in general as well as in a post-secondary context, with participants ZRUNLQJ WRJHWKHU WR UHÁHFW RQ OHDGHUVKLS within a paradigm that focuses on ‘me,’ ¶ZH·DQG¶XV·¶7KH¶PH·LQYROYHVUHÁHFWLQJ on personal leadership traits, while the ‘we’ involves working on a department team or group level. The ‘us’ involves how we work together for the betterment of the institution and beyond,” explains Graham. Carleton Leader 1 through 3 involves DQLQWHUDFWLYHDQGUHÁHFWLYHSURFHVVDLPHG at developing a shared sense of leadership through a community of collaborative leaders from all parts of the institution. Participants in Carleton Leader 2 and 3 are formed into Strategic Impact Groups. CANADIAN FIRM They are given the opportunity to choose topics of institutional interest on which they work as a group and then present to the broader community when they have completed their work. Graham describes this as the grand conclusion of the formal part of Carleton Leader, the focus being not on the outcome but on the experience. “There is no expectation that the outcomes will be automatically useful for the university,” she notes, “But in fact, a number of them have been.” However, the ultimate goal of Carleton Leader is more about building capacity than generating immediately-applicable outcomes. Carleton Leader develops the abilities of those recognized as being leaders, broadening and better equipping the pool for future leadership roles. :KHQ LW ZDV ÀUVW ODXQFKHG &DUOHWRQ Leader was met with an element of surprise from the campus community, particularly because it would be open to everyone and participation was not tied to one’s formal position at the university. “We made it very explicit from the beginning that participating in Carleton Leader was not meant to guarantee or imply a gateway to promotion,” notes Graham. GLOBAL REACH Expert investors: Here and around the world * $"(!!(%& !&#$"%%%%"! #$"#$&$)$%$ * $% ! !&%#! * &%$("$"'$!&%%! Contact James Porter or Jamie Brubacher "$ toron-ami.com © Copyright 2015 Toron AMI UNIVERSITY MANAGER • Fall 2015 35 Over 50 years of investing with PASSION, PERSPECTIVE & PURPOSE for Canadian universities, pension plans and endowments Nous investissons depuis plus de 50 ans avec PASSION, VISION ET DÉTERMINATION pour les universités, les caisses de retraite et les fonds de dotation canadiens. VANCOUVER • CALGARY • TORONTO • MONTRÉAL 1-855-408-6111 • [email protected] Phillips, Hager & North Investment Management is a division of RBC Global Asset Management Inc. ® Trademark of Royal Bank of Canada. Used under licence. © RBC Global Asset Management Inc. 2015. Phillips Hager & North gestion de placements est une division de RBC Gestion mondiale d’actifs Inc. ® Marque de commerce de la Banque Royale du Canada. Utilisée(s) sous licence. © RBC Gestion mondiale d’actifs Inc. 2015. #IC1508477 “It’s about collaborating with others in the institution, making the best contribution as a leader that you can.” “The fundamental premise of Carleton Leader,” she continues, “is that we work better together and that we will work together better if we understand each other. It’s intended to give people within Carleton a better understanding of leadership and an institutional awareness across the institution.” Overall, Carleton Leader has been positively received, with members of the university seeing the initiative as an expression of the university’s interest in faculty, professional services and student services staff development. Of course, there were lessons learned during the implementation period and, thanks to feedback, certain changes were made. For instance, at first there was a certain lack of understanding around the selection process, which has since been clarified. The university strives for a 50/50 balance of faculty and professional/student services staff. “Sometimes it can be challenging to convince faculty that Carleton Leader will be beneficial to them and to get them to commit,” adds Graham. “Our best ambassadors are those who have completed the program.” At the same time, the significant engagement of the senior institutional leaders with participants of Carleton Leader has helped its promotion, while playing an important role in sustaining the Leader community. Participants of Carleton Leader are increasingly engaged in the lead-up to the university’s next strategic plan and have stepped forward to lead initiatives such as a review of the university’s BA offerings and the launch of an internal fundraising campaign. These are only two small examples of a larger transformational change of increased collaboration and initiative among the faculty, professional services, and student services communities. Sustaining this leadership or ‘leaderful’ capacity is an ongoing process. To expand the many connections, relationships, and networks formed throughout all streams of Carleton Leader, the university has created the Carleton Leader Community. The university provides the opportunity for members of the community to get together to discuss and deliberate the current and future challenges of the institution. Events such as a speaker’s series, a town hall, and social get-togethers have been scheduled throughout the Click HERE to return to TABLE OF CONTENTS FRPLQJ \HDU ´6KHIÀHOG LV D OLWWOH IDUWKHU ahead in that regard,” notes Graham, “because they have been at it longer.” Meanwhile, the two universities are actively engaged in ongoing collaboration. 7KHLQLWLDOYLVLWWR6KHIÀHOGZDVIROORZHG by a visit to Carleton in 2013 by a team from the British university. “We also regularly Skype both individually and with our respective teams, to ensure we continue to learn from each other and strengthen our relationship,” says Ginniver. In July 2015, representatives from both universities delivered a presentation on 6KHIÀHOG&DUOHWRQ/HDGHUDWWKH1HWZRUN for Change and Continuous Innovation conference in Nashville. In fact, by taking the lead on this project and working together, the two institutions are practicing the philosophy at the core of their respective initiatives, collaborating to take the lead in this exciting new approach to leadership development. Or, as they pointed out in their presentation at the Nashville conference: “Alone we can do so little; together we can do so much.” For more information, please contact Cindy Taylor at [email protected]. UNIVERSITY MANAGER • Fall 2015 37 D ans une lettre ouverte au Ottawa Citizen, Katherine Graham, professeure émérite de la Carleton University, souligne que le mot « université » vient du latin universitas, TXLVLJQLÀH©FRPPXQDXWpª3RXUWDQWRQ constate souvent dans ces établissements une division entre les personnes qui travaillent aux services professionnels ou aux services aux étudiants ou qui enseignent et font de la recherche. Ces silos se retrouvent aussi dans le développement du leadership, où cette approche décousue ne fait que consolider les barrières et les limites qu’elles imposent. Comme ces établissements complexes ont des difficultés toujours plus grandes à surmonter, les universités doivent s’appuyer sur les forces en leadership de tous leurs secteurs, et sur des gens qui travailleront ensemble à trouver les meilleures solutions possibles. Ainsi, sous la direction de la rectrice Roseann O’Reilly Runte, Carleton a élaboré une initiative de développement du leadership intégré en parallèle à son plan stratégique intégré (PSI) 2013-2018. « Une collègue des services professionnels et moi avons proposé de travailler à partir de ce que nous faisions déjà », explique Katherine Graham, première leader du secteur de l’enseignement de Carleton Leader, l’initiative de développement du leadership de l’université. Le processus d’élaboration du PSI a commencé par l’examen du plan académique, puis de celui des services professionnels et des services aux étudiants. « Tous les plans devraient être intégrés », DIÀUPH 0me Graham, en soulignant que Mme Runte avait fait de l’intégration une priorité, « mais à Carleton, compte tenu de notre histoire, le plan académique, le plan des services professionnels et le plan des services aux étudiants ont tous évolué différemment. L’occasion était bonne, en prenant le temps, pour amalgamer ces trois plans. » L’université a aussi reconnu que le 38 UNIVERSITY MANAGER • Fall 2015 développement du leadership intégré était essentiel à la mise en place de son plan stratégique et à la poursuite de sa mission de collaboration, de leadership et de résilience, et qu’il aurait des répercussions qui iraient bien au-delà du PSI. Le but ultime : créer une communauté de leaders qui contribueraient de façon soutenue et continue au succès de l’établissement. À l’image de bien d’autres universités, Carleton a déjà offert à ses employés de brefs cours de leadership – certains diront qu’il s’agissait de cours de gestion –, surtout à ceux des services professionnels (p. ex. OHVVHUYLFHVÀQDQFLHUV/·pWDEOLVVHPHQWD reconnu que pour atteindre ses objectifs, il devait abandonner ce type de formation limitée et opter pour une formule plus globale de développement du leadership, dans un contexte propre à Carleton. C’est dans cette optique que la collègue de Mme Graham, Cindy Taylor (directrice, 2IÀFH RI 4XDOLW\ ,QLWLDWLYHV D IRUPp XQ groupe de travail chargé d’étudier divers modèles de perfectionnement pour les services professionnels. En parallèle, à titre de conseillère principale de la rectrice et vice-rectrice aux études, Katherine Graham a reçu le mandat d’examiner ce qui se faisait en matière de développement du leadership académique, y compris le type d’outils dont les titulaires de chaires et directeurs de départements ont besoin. Les deux femmes ont accepté de coordonner leurs travaux et d’étudier divers modèles ensemble. « C’est ainsi que nous sommes arrivées jFHWWHLQLWLDWLYHGHOD6KHIÀHOG8QLYHUVLW\ qui réunissait consciemment les leaders académiques – et les leaders émergents dans un contexte élargi – ainsi que les leaders des services professionnels », explique M me Graham, en ajoutant qu’un petit groupe d’administrateurs de Carleton s’est rendu au Royaume-Uni en novembre 2012 pour discuter avec des gens de là-bas du SURJUDPPH6KHIÀHOG/HDGHU©1RXVDYRQV alors décidé que c’était le genre d’initiative que nous voulions adopter. » C o n t r a i re m e n t a u x i n i t i a t i v e s conventionnelles de développement du OHDGHUVKLSOHSURJUDPPH6KHIÀHOG/HDGHU repose sur le concept de leaderful university (université axée sur le leadership). « Nous voulons encourager tous les membres de Click HERE to return to TABLE OF CONTENTS notre personnel et du corps professoral à jouer un rôle d’influence, sans égard à la hiérarchie ou aux postes d’autorité, explique Jane Ginniver, directrice du OHDGHUVKLS HW GH OD JHVWLRQ j OD 6KHIÀHOG University. Le programme Sheffield Leader est offert à toute personne employée par l’université; il n’est pas réservé à certains groupes d’employés ni aux hauts dirigeants. » Elle précise que 6KHIÀHOG /HDGHU Q·HVW SDV YpULWDEOHPHQW un « programme » puisqu’il n’a pas de ÀQFRPPHWHOOH,OYLVHOHGpYHORSSHPHQW continu d’une communauté et la valorisation de son potentiel pour le mieux-être de l’établissement. Même si elle n’est pas identique au SURJUDPPH6KHIÀHOG/HDGHUO·LQLWLDWLYHGH Carleton repose sur les mêmes préceptes, notamment l’idée selon laquelle « les gens travaillent mieux quand ils travaillent ensemble ». Ce leadership se répand alors dans tout l’établissement et ne sera pas UDWWDFKpjXQHIRQFWLRQRIÀFLHOOH©'HFHWWH façon, tout le monde peut jouer un rôle de meneur dans l’établissement », commente Mme Graham. Le but de cette façon de faire est d’investir dans les individus qui ont le plus de potentiel et qui s’intéressent le plus au leadership, quel que soit leur rôle dans l’organisation où le point où ils en sont dans leur carrière. Bien qu’elle ait adopté les principes de EDVHGH6KHIÀHOG/HDGHU&DUOHWRQDUpGXLW de quatre à trois le nombre de volets du programme (ou de niveaux, comme on les nomme dans le programme original). Ces volets ne sont ni séquentiels ni hiérarchiques. « Nous avons des professeurs adjoints et de jeunes professeurs agrégés qui ont participé au volet 3 de notre programme, qui est le plus général des trois, explique Mme Graham. Chaque volet est indépendant. Ce n’est pas une progression : il n’est pas nécessaire d’avoir suivi les volets 1 et 2 pour suivre le 3. » Carleton Leader 1 est destiné aux gens qui s’intéressent à la notion de leadership et souhaitent l’approfondir. « Il y a beaucoup d’échanges dans ce volet », souligne Mme Graham. Entre autres exercices, mentionnons l’observation au poste de travail et la consignation des expériences de leadership. Carleton Leader 2 intéressera les gens qui ont ou qui aimeraient avoir une certaine LQÁXHQFHSURIHVVLRQQHOOHGDQVOHXUXQLWp qu’il s’agisse d’une unité académique ou d’une unité de services professionnels, et qui ont déjà commencé à travailler à l’extérieur de leur propre domaine au sein GH O·XQLYHUVLWp (QÀQ &DUOHWRQ /HDGHU Click HERE to return to TABLE OF CONTENTS est conçu pour les personnes déjà très HQJDJpHVHWTXLRQWXQHYDVWHLQÁXHQFH O·LQVWDUGH6KHIÀHOG&DUOHWRQDDGRSWp un processus de sélection des participants au programme, qu’elle a toutefois adapté à ses besoins. Pour participer au volet 1 ou au volet 2, toute personne peut se porter candidate ou faire proposer sa candidature par son supérieur (directeurs, doyens, vice-recteurs). Par contre, la participation au volet 3 est réservée aux personnes nommées par un haut dirigeant. Chaque fois qu’un volet est offert, l’université veille à assurer une participation équilibrée en ce qui concerne le sexe des participants, les secteurs de l’université et la représentation des services professionnels, des services aux étudiants et du secteur académique. un sujet d’importance pour l’établissement sur lequel ils vont travailler en groupe et qu’ils vont présenter à la communauté élargie une fois leur travail terminé. Pour Mme Graham, cette dernière étape est la « grande conclusion » de la partie formelle de Carleton Leader, l’accent étant mis non pas sur les résultats, mais sur l’expérience. « On ne s’attend pas à ce que les résultats soient nécessairement utiles pour l’université, souligne-t-elle, mais plusieurs d’entre eux l’ont effectivement été. » Le but ultime de Carleton Leader est toutefois beaucoup plus orienté vers le renforcement des capacités que la production de solutions applicables sur-le-champ. Le programme stimule le développement des compétences des « Nous souhaitons stimuler la collaboration entre les gens de divers secteurs de l’établissement et que chacun fasse la meilleure contribution possible en tant que leader. » Carleton Leader 1 commence par une introduction suivie de trois jours et demi d’activités tenues à l’université. Les volets 2 et 3, donnés à l’extérieur, comportent trois modules de deux ou trois jours chacun. Dans ces modules, les participants s’attardent à la notion de leadership en général et dans le contexte de l’éducation SRVWVHFRQGDLUHFHTXLOHVDPqQHjUpÁpFKLU ensemble au leadership dans le cadre d’un paradigme axé sur le « moi » et le « nous » (à la fois we et us). « Le «moi» amène OHV SDUWLFLSDQWV j UpÁpFKLU DX[ TXDOLWpV personnelles de leadership, tandis que le «nous/we» les fait travailler au sein d’une équipe départementale ou d’un groupe. Et le «nous/us» touche à notre façon de travailler ensemble à l’amélioration de notre établissement et plus encore », explique Mme Graham. $[pV VXU O·LQWHUDFWLRQ HW OD UpÁH[LRQ les volets 1, 2 et 3 de Carleton Leader visent à développer une compréhension commune du leadership par un groupe de leaders collaboratifs de tous les secteurs de l’établissement. Les participants aux volets 2 et 3 sont divisés en « groupes d’impact stratégique ». On leur demande de choisir personnes ayant des qualités reconnues de leader, il enrichit le bassin d’individus appelés à jouer ultérieurement un rôle de tête et leur fournit les outils dont ils pourraient avoir besoin. Au début, Carleton Leader a été accueilli avec surprise par la communauté universitaire, surtout parce qu’il était ouvert à tous et qu’il n’était pas réservé aux titulaires de certains postes à l’université. « Nous avons établi clairement dès le départ que la participation au programme n’était aucunement associée à une garantie ni même à une possibilité de promotion, souligne Mme Graham. Nous souhaitons stimuler la collaboration entre les gens de divers secteurs de l’établissement et que chacun fasse la meilleure contribution possible en tant que leader. » « La prémisse de base de Carleton Leader, poursuit-elle, c’est que nous travaillons mieux ensemble et que nous travaillerons encore mieux ensemble si nous nous comprenons. Le programme a pour but d’approfondir la compréhension du leadership et de renforcer la sensibilisation institutionnelle de toute la communauté universitaire. » UNIVERSITY MANAGER • Fall 2015 39 Le développement du leadership intégré : Dans l’ensemble, Carleton Leader a été bien accueilli, les membres de la communauté universitaire y voyant une manifestation de l’intérêt de l’université envers le perfectionnement du corps professoral et du personnel des services professionnels et des services aux étudiants. On a tout de même tiré certaines leçons pendant la mise en place du programme et apporté quelques changements à la suite des commentaires reçus. Au début, par exemple, on ne comprenait pas très bien le processus de sélection, qui a depuis été clarifié. L’université vise la parité entre les membres du corps professoral et le personnel des services professionnels ou aux étudiants. « Il n’est pas toujours facile de convaincre les professeurs que Carleton /HDGHUVHUDEpQpÀTXHSRXUHX[HWGHOHV amener à participer, ajoute Mme Graham. Nos meilleurs ambassadeurs sont les gens qui ont suivi le programme. » De plus, l’engagement remarquable de la haute direction auprès des participants de Carleton Leader a contribué à la promotion du programme, tout en jouant un rôle important dans la stimulation de la « communauté des Leaders ». Les participants sont en effet de plus en plus engagés dans les étapes menant à l’application du prochain plan stratégique de l’université et se sont portés volontaires pour mener des initiatives comme un examen des programmes de premier cycle en arts ou le lancement de la campagne GHÀQDQFHPHQWLQWHUQH&HQHVRQWOjTXH deux petits exemples d’une transformation beaucoup plus large qui prend la forme d’une collaboration accrue et d’initiatives plus nombreuses de la part des employés du corps professoral, des services professionnels et des services aux étudiants. Le maintien ou la stimulation de ces capacités de leader est d’ailleurs un La route des Andes Le train qui grimpe la route des Andes zigzague vers le sommet propulsé par l’un des deux moteurs logés aux deux extrémités du convoi. À bord, le personnel médical distribue des masques à oxygène aux passagers, car l’air se UDUpÀH HW OHV SRXPRQV FKHUFKHQW OHXU VRXIÁH0DLVXQHIRLVUHQGXVOjRO·RQ se sent au sommet du monde, le lever de soleil est extraordinaire. Certains objectifs valent bien tous les efforts déployés pour les atteindre. À la Carleton University, l’adoption d’un plan stratégique LQWpJUp était la prochaine étape logique, bien que quelque peu chimérique, pour une communauté universitaire progressiste grouillant d’activités de recherche et d’enseignement. Les entreprises prospères font régulièrement l’exercice d’aligner leurs stratégies de développement, financières et culturelles. Les universités fonctionnent 40 UNIVERSITY MANAGER • Fall 2015 différemment toutefois : elles sont sans but lucratif, mais il est possible qu’elles génèrent des profits dans certains secteurs. Bien que le corps professoral soit spécialiste du travail interdisciplinaire, les départements fonctionnent souvent en silo dans des domaines exotiques qui sont parfois bien loin des activités budgétaires centrales. Des secteurs comme les services aux étudiants et les services de gestion des avantages sociaux du personnel sont parfois deux mondes tout à fait différents. Le corps professoral et le personnel travaillent ensemble, mais un sentiment de hiérarchie s’installe parfois entre les deux. Les étudiants sont partie prenante de leur apprentissage, mais ils font parfois des demandes qui ressemblent à celles de clients ou, dans certains cas, à celles de syndiqués. Peu d’universités ont tenté de se doter d’un plan stratégique véritablement intégré. Ce ne fut donc pas sans inquiétude que nous nous sommes lancés dans cette aventure à Carleton. Certaines parties du plan étaient faciles à élaborer et ont vite été adoptées par l’ensemble de la communauté universitaire. L’harmonisation des LQVWDOODWLRQVGHVUHVVRXUFHVÀQDQFLqUHV de la recherche et de l’enseignement dans des secteurs comme l’environnement, des services aux personnes handicapées, des services de santé, incluant la santé mentale, de la sécurité, des communications électroniques et des technologies était une suite naturelle aux travaux déjà bien amorcés dans chacun de ces secteurs. /·REMHFWLIOHSOXVGLIÀFLOHjDWWHLQGUH DpWpFHOXLG·XQLÀHUODGLUHFWLRQGHWRXV les aspects des activités de l’université et de tous les secteurs de l’établissement. Bien que le plan stratégique énonce des principes de leadership et d’excellence en enseignement et en recherche, tout Click HERE to return to TABLE OF CONTENTS processus continu. Pour renforcer les nombreux liens et réseaux formés dans les divers volets du programme, l’université a formé la Carleton Leader Community. L’université crée des occasions où les membres de cette communauté se rassemblent pour discuter et débattre des problèmes actuels et futurs de l’établissement. Des activités comme une série de conférences, une discussion ouverte et des rencontres sociales sont d’ailleurs au calendrier de la prochaine DQQpH©6KHIÀHOGDXQSHXG·DYDQFHVXU nous à cet égard, constate Mme Graham, parce qu’elle a commencé avant nous. » comme en gouvernance et en gestion, il n’y avait pas de formule magique pour réunir tous ces savoir-faire. Une équipe composée de professeurs et d’administrateurs membres et non membres du corps professoral se sont rendus à Sheffield, au Royaume-Uni, d’où ils sont revenus inspirés et prêts à proposer une version du programme adopté par cet établissement. Les objectifs : développer la capacité de leadership du corps professoral et du personnel de tous les secteurs de l’université; créer une communauté de pairs engagés disposés à travailler ensemble au sein d’équipes intersectorielles; se donner une compréhension commune des grands enjeux de l’université et de la société; et promouvoir la recherche de solutions positives et pratiques aux grands problèmes de l’éducation supérieure en général, et de Carleton en particulier. Nous avons voulu investir dans les membres actuels de notre corps professoral et de notre personnel pour les amener à contribuer activement à l’atteinte des objectifs de chaque secteur, à demeurer à O·XQLYHUVLWpHWjFRPSUHQGUHQRVGLIÀFXOWpV tout en ayant la capacité de travailler en équipe. Ces objectifs sont les mêmes que ceux de bien d’autres secteurs puisque tous les gouvernements, entreprises et organismes cherchent à créer un climat de collaboration et un milieu de travail positif propice à l’innovation. L e p ro g r a m m e d e C a r l e t o n comportait des séances de formation au leadership et en communications en petites équipes de 20 membres provenant du corps professoral et du Click HERE to return to TABLE OF CONTENTS Entre-temps, les deux universités poursuivent activement leur étroite FROODERUDWLRQ/DSUHPLqUHYLVLWHj6KHIÀHOG a été suivie de la visite à Carleton en 2013 d’une équipe de l’université britannique. « Nous communiquons aussi souvent par Skype soit individuellement, soit avec nos équipes respectives, de manière à apprendre constamment les uns des autres et à UHQIRUFHUQRVOLHQVªDIÀUPH-DQH*LQQLYHU En juillet 2015, des représentants des deux universités ont livré une présentation SRUWDQWVXUOHSURJUDPPH6KHIÀHOG&DUOHWRQ Leader au congrès Network for Change and Continuous Innovation tenu à Nashville. personnel de l’université. Chaque équipe devait trouver un problème qu’elle jugeait préoccupant et recommander des solutions en supposant que les seuls fonds disponibles pour faire leur travail étaient les fonds qu’ils trouvaient eux-mêmes. Les équipes avaient tout le loisir de choisir les sujets de leur choix et de faire leur travail à leur façon. Les administrateurs ont accordé aux participants toute leur confiance et leur respect en leur demandant seulement de consacrer leurs travaux au bien de l’établissement. Devant une palette d’excellentes solutions à des SUREOqPHV GLIÀFLOHV O·DGPLQLVWUDWLRQ D alors eu le problème inverse, soit avoir plus de solutions qu’elle est en mesure d’en adopter. À leur tour, les équipes RQW G DFFRUGHU OHXU FRQÀDQFH HW OHXU respect à l’administration, dans un climat que seules une communication et une compréhension exceptionnelles et basées sur l’ouverture pouvaient permettre. Les équipes ont choisi des sujets de grand intérêt, par exemple la compétitivité de l’université, la réputation de l’université, la collaboration interdépartementale, l’internationalisation et la mondialisation par rapport à l’action régionale et locale, et les relations entre le corps professoral et le personnel. Chacun y a approfondi sa compréhension du sujet choisi. Quelques recommandations très précises ont été adoptées (notamment par rapport à des travaux de conception web, de mise à jour de données et d’accès à l’information facilitant la collaboration). Les équipes poursuivent leur travail et continuent à s’enrichir en connaissant des gens En fait, en prenant les devants dans ce projet et en travaillant ensemble, les deux établissements mettent en pratique le principe fondamental de leurs initiatives respectives, soit collaborer pour mener ensemble cette nouvelle approche captivante de développement du leadership. Autrement dit, comme l’ont souligné les représentants dans leur présentation à Nashville : « Seul, on peut faire si peu; ensemble, on peut tant faire. » Pour de plus amples renseignements, écrire à Cindy Taylor, [email protected]. qui travaillent dans d’autres pavillons et départements. Des relations saines et professionnelles se sont établies entre les secteurs, et les individus ont développé leurs talents et leurs compétences, qu’ils PHWWHQWjSURÀWGHIDoRQH[FHSWLRQQHOOH dans leur travail quotidien et en participant à des comités intersectoriels ayant pour mandat de mettre en place le plan intégré. Nous en sommes encore aux toutes premières lueurs de l’aube. Nous voyons cependant le soleil se lever sur le campus et nous sentons déjà la chaleur qu’il répandra sur un nombre toujours croissant de professeurs et de membres du personnel qui prennent part à ce processus. L’intégration du leadership est à la fois un thème et une exigence en cette ère de tension économique où chaque organisme et chaque établissement doit veiller à ce que tous les membres de son équipe comprennent bien les enjeux pour collaborer avec efficacité et efficience et partager leur intelligence créative. Ensemble, nous veillerons à ce que le soleil se lève, mais aussi qu’il brille de tous ses feux. Je remercie mes collègues qui ont travaillé avec autant de soin et de diligence à la conception de ce SURJUDPPH -H VXLV ÀqUH TXH &DUOHWRQ soit considérée comme une chef de file du leadership créatif et je cite ce programme comme exemple à suivre de gouvernance exceptionnelle. Roseann O’Reilly Runte Rectrice, Carleton University UNIVERSITY MANAGER • Fall 2015 41 Understand the spectrum of investment opportunities and how to combine them. Through investment selection, asset allocation, implementation, and monitoring, we optimize your returns and risk. We develop and implement customized investment strategies for pension funds, high-net-worth individuals, endowments, and more. Asset and Risk Management Ltd. means investment objectives and outcomes align. To learn more, call Robert Boston at 416.380.2765 or email [email protected]. of univerrsity endowment and pensio on funds des fonds de dotation et des caisse es de re etraite des universités Click HERE to return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 43 Use Paper Responsibly Today’s forest industry is working hard to become one of the greenest industries on earth. No industry is perfect. But the paper industry has made, and continues to make, huge investments in environmental responsibility. Specifying and buying paper from certified sources ensures the continuation and growth of carbonabsorbing forests. Using paper with appropriate amounts of recycled fibre helps preserve forests, conserve energy, and maximize fibre usage through paper lifecycles. Brought to you by Craig Kelman & Associates Ltd. – publisher of this magazine and a proud supporter of the printing and paper industries. bfinance is helping Canadian plan sponsors and institutional investors to make the right investment choices bfinance is an international investment consulting firm. bfinance has managed over $100 billion in over 500 searches for Canadian, European and Middle Eastern institutional sponsor clients London – Paris – Amsterdam – Dubai – Montréal – Munich – New York www.bfinance.ca Brian Cyr, CFA – Managing Director at 514-393-4899 or [email protected] Marco Larocque – Director at 514-393-4899 or [email protected] 44 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE OF CONTENTS INVESTING ISN’T EASY. When it comes to investment outsourcing, Russell understands what’s at stake. Your organization and hundreds—if not thousands— of people are counting on the success of your investment program. It’s your responsibility to manage that program to produce the best possible results. This is as tough as it gets. We’re here to help. | TALK TO US: 866-737-2228 VISIT US: www.russell.com/ca/institutional INVESTED. TOGETHER.™ Russell Investments is a trade name and registered trademark of Frank Russell Company, a Washington USA corporation, which operates through subsidiaries worldwide and is part of the London Stock Exchange Group. It is used under a license by Russell Investments Canada Limited. Russell Investments Canada Limited is a wholly owned subsidiary of Frank Russell Company and was established in 1985. Russell Investments Canada Limited and its affiliates, including Frank Russell Company, are collectively known as “Russell Investments”. Copyright © 2015 Russell Investments. All rights reserved. Tides of change in the financial sector By Serge Germain, General Manager, Pension Plan, Université de Sherbrooke 2014 2013 2012 2011 14.0 15.3 2014 10.9 2011 12.1 11.0 2010 2013 10.8 2009 2012 10.9 8.7 2008 10.4 2007 9.0 2006 Figure 1. Survey statistics - endowments Endowment 11.5% 10.2% 9.7% >$100 M 8.1% > $30 M to $100 M Change in Assets and Investment Returns Overall, 68 universities participated in the survey with total endowment DVVHWV ZRUWK ELOOLRQ 7KH UHSRUWHG HQGRZPHQWYDOXHLVXSIURPELOOLRQ LQDQGELOOLRQLQFigure 1). It is interesting to note that four universities have endowments greater than one billion GROODUV7KHVHHQGRZPHQWVUHSUHVHQW billion, or 38% of the total reported in the survey. As Figure 2 illustrates, the Larger (QGRZPHQW )XQGV JURXS ! million) had the highest one-year median return (11.5%), while the Smaller group 68 68 66 64 66 2010 2009 2008 2007 2006 2005 2004 61 67 67 69 67 72 2005 On behalf of the Treasury and Investment Committee, I would like to thank everyone who contributed to the survey. The list of participating institutions appears in Appendices I and II at the end of the article. Total Endowment Assets ($billions) 7.9 Pension • PLOOLRQLQWRWDODVVHWV‘Smaller Pension Funds’ – 6 funds • !PLOOLRQWRPLOOLRQ² 10 funds • !PLOOLRQWRPLOOLRQ² 16 funds • !PLOOLRQ‘Larger Pension Funds’ – 24 funds Participants (Endowments) > $10 M to $30 M Endowment • PLOOLRQLQWRWDODVVHWV‘Smaller Endowment Funds’ – 10 funds • !PLOOLRQWRPLOOLRQ²IXQGV • !PLOOLRQWRPLOOLRQ² 25 funds • !PLOOLRQ‘Larger Endowment Funds’ – 24 funds 2004 The 2015 CAUBO conference theme ‘Tides of Change’ describes how universities have VHHQ VLJQLÀFDQW IXQGDPHQWDO FKDQJHV RI late, at times in tumultuous environments, and must embrace change and harness its energy to compete and excel in the future. University treasurers, financial professionals and Board committees must constantly manage this change and adapt in order to secure adequately-funded pension plans and endowment funds that provide intergenerational equity. The information in this article is the culmination of a process that starts in February when member institutions are invited to participate in Canada’s most comprehensive survey of investments held by post-secondary institutions’ endowment and pension funds. In April and May, the CAUBO National Office transforms the extensive data into the results referenced below. A stable participation base is central for comparability of results from year to year and among institutions. This year there was a slight increase in the number of institutions that participated in both the endowment and pension survey, as compared the previous year. The following break points are included in the survey to facilitate inter-university comparison. to $10 M Introduction 18% 16% 14% 12% 10% 8% 6% 4% 2% 0% High Median Low Figure 2. One-year returns (by endowment size) 2014 "The information in this article is the culmination of a process that starts in February when member institutions are invited to participate in Canada’s most comprehensive survey of investments held by post-secondary institutions’ endowment and pension funds." 46 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NTE TENT TEN T ENT EN E NT N TS Aon Hewitt Expect our to keep you AHEAD of the Planning for success means being two steps ahead, not running to catch up. At Aon Hewitt, we embrace a culture of progress. Our solutions are proactive, practical, and bold and our focus is on the success of your people and your organization. For more information about our talent, retirement and health solutions, visit aonhewitt.com/canada. Risk. Reinsurance. Human Resources. RESEARCH OPENS THE DOOR TO OPPORTUNITY PROGRESS INNOVATION You know this and we do too. That’s why research is the foundation of all our investment consulting services. For over 25 years, Pavilion Advisory Group® has assisted colleges and universities with key aspects of their investment programs. We conduct research on investment managers, the macro economy and specialty topics. With a 360-degree perspective of the marketplace, we share our investment intelligence with clients to advance their financial outcomes. MONTREAL | WINNIPEG | CHICAGO | INDIANAPOLIS | TORONTO | EDMONTON Visit us at www.pavilioncorp.com/advisory-services Pavilion Advisory Group® is a registered trademark of Pavilion Financial Corporation used under license by Pavilion Advisory Group Ltd. in Canada and by Pavilion Advisory Group Inc. in the United States. © 2015 Pavilion Advisory Group Ltd. All rights reserved. Tides Tid des o off c change hange iin n tthe he financial sector 2014 2013 > $100 M > $30 M to $100 M > $10 M to $30 M to $10 M > $100 M > $30 M to $100 M > $10 M to $30 M to $10 M High 14.5% 14.4% 15.8% 12.8% 27.8% 25.3% 21.1% 14.6% Median 11.5% 9.7% 10.2% 8.1% 17.8% 16.1% 14.1% 9.3% Low 6.2% 5.6% 4.5% 1.6% -7.3% -1.3% 4.5% 2.0% Table 1: One year returns, by group, 2013 and 2014 PLOOLRQ KDG WKH ORZHVW RQH\HDU median return (8.1%). The median return for all participants was 10.3% as compared to 16.1% in 2013. While each of the four groups had lower median one-year returns in 2014 as compared to 2013, returns in the range of 10% are still considered acceptable absolute returns. The variation in the range in one-year returns in 2014 as compared to 2013 is worth noting (see Table 1). In 2014, the Larger Funds had the lowest range in returns (difference between highest and lowest return) (8.3%) compared to 2013 when this group had the highest range (35%). "The variation in the range in one-year returns in 2014 as compared to 2013 is worth noting." GUARDIAN ETHICAL MANAGEMENT :VJPHSS`9LZWVUZPISL 0U]LZ[PUNMVYH:THSS>VYSK .\HYKPHU ,[OPJHS 4HUHNLTLU[ .,4 PZ H QVPU[ ]LU[\YL IL[^LLU .\HYKPHU *HWP[HS 37 VUL VM *HUHKH»Z SVUNLZ[LZ[HISPZOLK PU]LZ[TLU[ THUHNLTLU[ ÄYTZ HUK 5,0 0U]LZ[TLU[Z OVTL [V ,[OPJHS -\UKZ ¶ *HUHKH»ZSLHKPUNZVJPHSS`YLZWVUZPISLT\[\HSM\UKMHTPS`MVYTVYL[OHU `LHYZ .,4 JVTIPULZ [OL PU]LZ[TLU[ THUHNLTLU[ L_WLY[PZL VM .\HYKPHU *HWP[HS37HUK[OLJVTWYLOLUZP]LLU]PYVUTLU[HSZVJPHSNV]LYUHUJL HUKLUNHNLTLU[WYVNYHTKL]LSVWLKI`,[OPJHS-\UKZ -VYTVYLPUMVYTH[PVU WSLHZLJVU[HJ[)YPHU/VSSHUK! IOVSSHUK'N\HYKPHUJHWP[HSJVT ^^^NLTWVY[MVSPVZJVT Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 49 "Note that over the past ten years, the median oneyear return for the up to $10 million group has often had the lowest returns, when compared to the other groups." 20% 15% 10% 5% 0% -5% to $10 M -10% >$10 M to $30 M >$30 M to $100 M -15% >$100 M to 2014 to 2013 to 2012 to 2011 to 2010 to 2009 to 2008 to 2007 to 2006 -20% to 2005 Figure 3 shows the historical median one-year returns by group. Note that over the past ten years, the median one-year UHWXUQ IRU WKH XS WR PLOOLRQ JURXS has often had the lowest returns, when compared to the other groups. The historical median returns over rolling 10-year periods are shown in Figure 4. Each group showed slight increases in their 10-year median returns in 2014. Notwithstanding the good results achieved in 2014, the overall 10-year median return of 6.5% continues to remain below the amount required to support most universities’ spending rate and FRYHULQÁDWLRQDU\SUHVVXUHV Figure 3: Median one-year endowment returns by group 10% 9% 8% 7% 6% 5% 4% to $10 M 3% >$10 M to $30 M 2% >$30 M to $100 M 1% >$100 M to 2014 to 2013 to 2012 to 2011 to 2010 to 2009 to 2008 to 2007 to 2006 to 2005 0% Figure 4: Median 10-year endowment returns by group CAUBO Connection stay up-to-date in between issues of UM! Did you know that CAUBO now has an electronic newsletter? CAUBO Connection is sent out four times a year, in between issues of the University Manager magazine. It is full of timely information about upcoming CAUBO events, new research reports, and other products and services for members, delivered straight to your inbox. You can check out past issues of CAUBO Connection online at www.caubo.ca under Resources and Publications. If you are not already receiving CAUBO Connection, and you would like to start, just send an email to Lynne Séguin at [email protected] and ask to be added to the mailing list. Stay up-to-date on everything CAUBO has to offer! 50 UNIVERSITY MANAGER • Fall 2015 Info-ACPAU et GU, pour tout savoir sur ce qui se passe dans le secteur! Saviez-vous que l’ACPAU a maintenant un bulletin électronique? Intitulé Info-ACPAU, il est diffusé quatre fois par an, en alternance avec Gestion Universitaire. Il regorge des renseignements les plus à jour sur les activités à venir, la publication de nouveaux rapports de recherche et d’autres produits et services destinés aux membres de l’Association. Vous pouvez le recevoir par courriel et consulter en ligne les numéros déjà parus, à www.caubo.ca, sous « Ressources et publications ». Si vous ne recevez pas déjà Info-ACPAU, il VXIÀWG·HQIDLUHODGHPDQGHSDUFRXUULHOj/\QQH Séguin, à l’adresse [email protected]. Restez au fait de tout ce que l’ACPAU peut vous offrir! Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS LOOKING FOR... • A strategic partner? • Private real estate investments? • A solution to your university’s student housing needs? Centurion Asset Management Inc.’s (“Centurion”) private real estate investments are supported by a strong ŚŝƐƚŽƌLJŽĨĐĂƉŝƚĂůƉƌĞƐĞƌǀĂƟŽŶĂŶĚƐƚĂďůĞƌĞƚƵƌŶƐĨŽƌĨŽƵŶĚĂƟŽŶƐ͕ĞŶĚŽǁŵĞŶƚƐĂŶĚƉĞŶƐŝŽŶƉůĂŶƐ͘ ĞŶƚƵƌŝŽŶŝƐƚŚĞůĂƌŐĞƐƚZ/dŽǁŶĞƌŽĨƐƚƵĚĞŶƚŚŽƵƐŝŶŐŝŶĂŶĂĚĂĂŶĚƉƌŽǀŝĚĞƐŝŶƐƟƚƵƟŽŶĂůͲŐƌĂĚĞƐƚƵĚĞŶƚ ŚŽƵƐŝŶŐƐŽůƵƟŽŶƐ͘ To learn more, call or visit us online today. Respect | Integrity | Simplicity | Excellence 1.888.992.5736 | centurionreit.com IMPORTANT INFORMATION:dŚŝƐĐŽŵŵƵŶŝĐĂƟŽŶŝƐĨŽƌŝŶĨŽƌŵĂƟŽŶƉƵƌƉŽƐĞƐŽŶůLJĂŶĚŝƐŶŽƚ͕ĂŶĚƵŶĚĞƌŶŽĐŝƌĐƵŵƐƚĂŶĐĞƐŝƐƚŽďĞĐŽŶƐƚƌƵĞĚĂƐ͕ĂŶŝŶǀŝƚĂƟŽŶƚŽ ŵĂŬĞĂŶŝŶǀĞƐƚŵĞŶƚŝŶĞŶƚƵƌŝŽŶZ/dŽƌZKd͘&ŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶŽƌĨƵůůĚŝƐĐůĂŝŵĞƌƐ͕ƉůĞĂƐĞǀŝƐŝƚƵƐŽŶůŝŶĞĂƚǁǁǁ͘ĐĞŶƚƵƌŝŽŶƌĞŝƚ͘ĐŽŵŽƌĐĂůůƵƐĂƚϭ͘ϴϴϴ͘ϵϵϮ͘ϱϳϯϲ͘ Brookfield Brookfield Investment Management, Inc. 30-year history1 of active investment in public securities markets Over $18 billion1 of assets under management Differentiated focus on listed Real Asset investment strategies Strong long-term performance track records Real Assets and Opportunistic strategies and products structured for Canadian investors For more information, contact: Ms. Angela Vidakovich T 416-956-5229 E angela.vidakovich@brookfield.com 1 $VRI-XQHDQGUHIHUVWR%URRN¿HOG,QYHVWPHQW0DQDJHPHQW,QFDQGLWVDI¿OLDWHVDQGVXEVLGLDULHV %URRN¿HOGLQYHVWPHQW0DQDJHPHQW&DQDGD,QFLVDQLQYHVWPHQWPDQDJHUKHDGTXDUWHUHGLQ7RURQWRZLWKUHJLVWUDWLRQVLQ$OEHUWD%ULWLVK &ROXPELD0DQLWRED1RYD6FRWLDDQG6DVNDWFKHZDQ4XHEHFLVSHQGLQJ%URRN¿HOG,QYHVWPHQW0DQDJHPHQW,QFLVD86LQYHVWPHQW DGYLVHUUHJLVWHUHGZLWKWKH6HFXULWLHV([FKDQJH&RPPLVVLRQDQGGRHVQRWKDYHLWVPDLQKHDGTXDUWHUVLQ&DQDGD%URRN¿HOG,QYHVWPHQW 0DQDJHPHQW ,QF LV UHJLVWHUHG DV D SRUWIROLR PDQDJHU LQ 2QWDULR DQG UHJLVWHUHG XQGHU WKH 0, 3DVVSRUW 6\VWHP DV D SRUWIROLR PDQDJHULQ$OEHUWD%ULWLVK&ROXPELD0DQLWRED1HZ%UXQVZLFN1RYD6FRWLD2QWDULR4XHEHFDQG6DVNDWFKHZDQ3URVSHFWLYHLQYHVWRUV DUHDGYLVHGWRFRQGXFWWKHLURZQGXHGLOLJHQFHLQFOXGLQJZLWKRXWOLPLWDWLRQOHJDODQGWD[FRQVHTXHQFHVSULRUWRPDNLQJDQLQYHVWPHQW Asset Mix As shown in Figure 5, the Larger Funds have the highest allocation to equity and alternative assets while having the lowest allocation to fixed income. They also distinguish themselves by allocating the least to bonds. Alternative assets in this context are any LQYHVWPHQWV WKDW DUH QRW À[HG LQFRPH RU publicly-traded equity. The most common alternative assets for endowments are real estate, hedge funds and private equity. The redeveloped survey, launching in 2016, has improved asset class categories which will allow us to provide more detailed reporting on these asset classes in future years. "The most common alternative assets for endowments are real estate, hedge funds and private equity." December 2014 - in quartiles by fund size 70.0% n=9 n=10 n=25 n=24 >$100M >$30M to 100M >$10M to $30M to $10M 57.9% 18.8% 61.9% 6.3% 52.6% 8.4% 38.9% 1.3% 21.8% 27.7% 35.6% 52.9% 1.5% 4.0% 3.5% 6.8% 60.0% 50.0% 40.0% 30.0% 20.0% 10.0% 0.0% Equity Alternative Fixed Income Cash Figure 5: Average asset allocation by size of endowment fund The heavy bars indicate median values, purple boxes show the 25th to 75th percentile ranges, and extended lines show the 10th to 90th percentile ranges. 16.0% 14.0% 12.0% 10.0% 8.0% 6.0% 4.0% to 2014 to 2013 to 2012 to 2011 to 2010 to 2009 to 2008 to 2007 to 2006 to 2005 to 2004 to 2003 to 2002 to 2001 0.0% to 2000 2.0% Figure 6: 10-year endowment returns for years ending December 31 To reach members of the postsecondary community through advertising in the University Manager, please contact me directly. Al Whalen, Marketing Manager 1-866-985-9782 [email protected] Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 53 “ IN OUR VIEW, ACTIVE MANAGEMENT CAN RESULT IN OUTPERFORMANCE THROUGH MARKET CYCLES.” THAT’S THE POWER OF ACTIVE MANAGEMENT. SM Our skilled active managers can exploit market inefficiencies by actively selecting securities and managing risk to create longer-term value for investors. MFS examines the value of skilled active management in our white paper, “There’s No Substitute for Skill.” To find out more, access our white paper at MFS.com/getactive ©2015 MFS Investment Management 33409.1 Tides of change in the financial sector Pension Change in Assets and Investment Returns There were 56 university pension plans that participated in the survey this year, ZLWKWRWDOSHQVLRQDVVHWVRIELOOLRQ ²DELOOLRQRULQFUHDVHRYHUWKH previous year. (Figure 7) As Figure 8 shows, pensions in the Larger group had the highest one-year median return (11.2%) while median returns for the three Smaller groups were all around 10%. The highest return was 14.7%, earned by a plan worth over PLOOLRQ DQG WKH ORZHVW UHWXUQ was a gain of 7.5% by a fund worth EHWZHHQ PLOOLRQ DQG PLOOLRQ The median return for all plans in 2014 was 10.4%, similar to the median return for endowment funds. While one-year returns are of interest, in order to assess the financial health and sustainability of pension plans it is important to look at longer-term returns. Figure 9 shows historic moving average 10-year returns. The median 10-year return has been relatively constant for the past three years— in 2014 it was 6.9%—after the steady decreases that were observed for a number of years. Committees of plans with an upcoming valuation should already be reviewing assumptions with their plan actuary to ensure that they are still appropriate and determine what changes may be required in light of the potential impact that Figure 10 shows the average asset allocation mix by size of pension plan. Fixed income allocations are relatively similar within each sub-group. Similar to the results from previous years, where plans differ is in their allocations to alternative assets versus equities. The Larger pension funds have the highest allocation to alternative assets and the lowest to equity. The exact opposite is observed in the Smaller funds, with very little invested in alternative assets. Again, alternative assets are any LQYHVWPHQWVWKDWDUHQRWÀ[HGLQFRPHRU publicly-traded equity. The heavy bars indicate median values, purple boxes show the 25th to 75th percentile ranges, and extended lines show the 10th to 90th percentile ranges. 56 55 56 56 54 Asset Mix 16.0% 14.0% 2014 2013 50 2011 12.0% 2012 50 2010 2009 8.0% 44.7 39.4 35.5 31.4 34.4 31.3 6.0% 4.0% to 2014 to 2013 to 2012 to 2011 to 2010 to 2009 to 2008 to 2007 to 2006 to 2005 to 2004 to 2003 to 2002 Figure 7: Survey statistics - pension plans 0.0% to 2001 2014 2013 2012 2011 2010 2.0% 2009 28.1 2008 34.3 2007 34.4 2006 30.1 2005 25.4 Total Pension Plan Assets ($billions) 2004 10.0% to 2000 2008 2007 2006 2005 2004 52 54 55 57 Participants (Pension Plans) low bond yield might have on pension contribution levels. Figure 9: 10-year pension plan returns for years ending December 31 11.2% >$500 M 9.9% > $150 M to $500 M 9.9% > $30 M to $150 M to $30 M 10.3% 18% 16% 14% 12% 10% 8% 6% 4% 2% 0% December 2014 - in quartiles by fund size 70.0% n=7 n=10 n=16 n=24 to $30M >$30M to 150M >$150M to $500M > $500M 62.5% 1.0% 60.2% 3.0% 57.1% 6.2% 51.2% 15.0% 32.5% 27.2% 33.2% 31.8% 4.0% 9.6% 3.5% 2.0% 60.0% 50.0% 40.0% 30.0% 20.0% 10.0% High Median Low Figure 8: One-year returns (by pension plan size) 0.0% Equity Alternative Fixed Income Cash Figure 10: Average asset allocation by size of pension plan Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 55 Asset class Index one-year four-year 10-year Canadian equities S&P/TSX Composite (capped) 10.6% 5.2% 7.6% US equities S&P 500 (CAD) 23.9% 20.1% 7.3% Global equities MSCI World (CAD) 14.4% 14.1% 5.7% EAFE equities MSCI EAFE (CAD) 3.7% 8.8% 4.1% Emerging market equities MSCI Emerging Markets (CAD) 6.6% 1.7% 8.1% Canadian bonds DEX Universe Bond 8.8% 5.1% 5.3% Canadian long bonds DEX Long-Term Bond 17.5% 8.2% 7.4% Canadian real return bonds DEX Real Return Bond 13.2% 4.6% 5.7% Canadian short-term DEX 91-day T-Bill 3.1% 2.9% 3.8% 1.5% 1.5% 1.7% Inflation as measured by the Canadian consumer price index: Figure 11: Returns of indices at December 31, 2014. Source: RBC Dexia Pooled Fund Survey (Source: RBC Dexia Pooled Fund Survey) Conclusion The index returns for traditional asset classes and the variation of returns across different asset classes are shown in Figure 11. A high of 23.9% for the one-year return of the S&P 500 (CAD) and a low of 3.1% for Canadian short-term bonds is observed. On a 10-year basis, Canadian equities returned 7.6%, US equities 7.3% in Canadian dollars, and Canadian bonds 5.3%. These UHWXUQVFRPELQHGZLWKLQÁDWLRQZKLFKDW universities generally exceeds traditional PHDVXUHVRILQÁDWLRQDUHQRWVXIÀFLHQWWR maintain real endowment values. Indeed, this market environment is one reason why endowments have shifted their asset allocations away from traditional to alternative asset classes, and continue to adjust their spending rates and methods. In the survey, alternative asset classes are categorized under ‘other’ and represent 19% of the average endowment fund on a dollar-weighted basis. Compare this to the 2001 survey, where the average endowment asset allocation consisted of RQO\HTXLWLHVDQGÀ[HGLQFRPH Those charged with the oversight of endowment and pension plans are continuously riding the tides of change as they examine on an ongoing basis whether these plans are achieving their goals, and make the necessary adjustments to improve expected results. In times of change, investment committees need to understand what they can manage – spending in the case of endowments, risk in the case of pensions – and what they cannot, and respond accordingly in order to deliver results that allow universities to grow and excel going forward. 56 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS Canadian University Endowment Funds Institutions Toronto British Columbia McGill Alberta Queen’s Calgary Manitoba McMaster Western Ontario Dalhousie Victoria (UT) York Simon Fraser Victoria (BC) Guelph Saskatchewan Waterloo Montréal Ottawa Carleton Laval New Brunswick Mount Allison Ryerson Windsor Wilfrid Laurier Concordia Trinity (UT) Lakehead Memorial Moncton Brock Acadia Northern BC MacEwan Brandon HEC Montréal Winnipeg Lethbridge Trent Mount Royal Laurentian King’s (NS) Regina Bishop’s Sherbrooke PEI Saint Mary’s Cape Breton Mount St. Vincent Saint-Paul UQAM Huron Vancouver Island Trinity Western Sudbury OCAD Saint-Boniface Fraser Valley ETS Thorneloe Emily Carr Redeemer Algoma Huntington Athabasca Sainte Anne UQTR SIAST St. Francis Xavier 2014 Ranking 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 Weightings: Mean Median Dollar-weighted mean Assets $ Millions 2,060 1,401 1,356 1,057 852 715 605 551 546 511 476 434 378 377 325 317 317 280 246 197 166 163 157 113 99 91 88 85 82 80 78 77 74 71 60 59 59 54 54 51 49 45 41 40 39 37 36 34 31 26 20 20 19 18 17 16 15 15 10 9 7 5 5 5 3 3 2 0 Canadian Equity 25% 25% 21% Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS Equity Canadian Foreign 13% 30% 26% 35% 10% 38% 19% 53% 20% 43% 36% 39% 29% 38% 21% 43% 21% 33% 17% 46% 6% 20% 15% 55% 34% 34% 28% 34% 19% 49% 18% 39% 24% 18% 22% 34% 7% 45% 35% 35% 20% 36% 27% 33% 20% 54% 29% 33% 31% 33% 17% 17% 34% 28% 14% 33% 74% 21% 34% 20% 24% 29% 14% 45% 39% 32% 25% 37% 21% 57% 36% 28% 18% 45% 27% 47% 40% 38% 19% 41% 25% 25% 31% 21% 39% 30% 25% 43% 29% 37% 16% 34% 28% 29% 49% 28% 20% 39% 20% 40% 5% 3% 29% 17% 28% 35% 20% 39% 36% 32% 29% 33% 32% 34% 24% 26% 22% 24% 0% 0% 35% 18% 0% 0% 42% 24% 41% 29% 29% 33% 32% 27% 18% 2% 0% 0% Foreign Equity 32% 33% 37% Appendix I Fixed Income 22% 19% 21% 16% 18% 24% 21% 31% 24% 22% 6% 30% 26% 28% 29% 27% 58% 36% 23% 26% 30% 39% 27% 38% 36% 45% 25% 21% 5% 46% 39% 41% 29% 29% 22% 36% 20% 26% 22% 40% 40% 49% 32% 22% 35% 34% 44% 23% 41% 40% 25% 54% 38% 41% 31% 38% 35% 50% 53% 100% 47% 100% 35% 30% 38% 41% 48% 100% Fixed Income 35% 32% 24% Other 35% 20% 31% 12% 20% 0% 12% 4% 23% 15% 68% 0% 6% 10% 3% 16% 0% 9% 26% 5% 13% 0% 0% 0% 0% 21% 14% 32% 0% 0% 8% 0% 0% 10% 0% 0% 16% 0% 0% 0% 10% 0% 0% 10% 0% 16% 0% 0% 0% 0% 68% 0% 0% 0% 1% 0% 0% 0% 0% 0% 0% 0% 0% 0% 0% 0% 31% 0% 2013 Ranking 1 2 3 4 5 6 7 8 9 10 11 12 14 13 15 17 16 18 19 20 21 22 23 24 28 26 27 29 30 32 31 34 33 35 36 38 37 40 39 41 42 43 44 45 47 46 48 49 50 51 52 53 54 55 57 56 Assets $ Millions 1,839 1,271 1,217 979 774 638 546 521 482 482 457 405 336 348 295 277 288 245 225 190 155 142 138 108 82 84 83 77 75 74 74 69 69 64 56 52 54 48 50 48 46 41 38 35 33 33 31 30 28 24 20 18 17 15 14 15 58 59 60 62 61 63 13 9 9 7 7 4 64 3 66 2 65 25 2 108 Other 8% 0% 17% UNIVERSITY MANAGER • Fall 2015 57 G A I N M O R E C E RTA I N T Y Defined benefit pension plan sponsors say they face many uncertainties in 2015. 80% 66% 64% are worried about interest rate levels are concerned about market volatility are increasing their focus on risk management 1 One thing is certain. Our 150 years of experience in investment management are the result of talented people, a rigorous process and unique private assets. Gain the private market advantage with Sun Life Investment Management Inc. P R I VAT E F I X E D I N C O M E C A N A D I A N CO M M E RC I A L M O RTG AG E C A N A D I A N R E A L E S TAT E F U N D LIABILITY DRIVEN INVESTMENT Sun Life Investment Management – solutions for institutional investors. 1 The 2015 Sun Life Investment Management Defined Benefits Plan Sponsor Executives study was conducted by Rogers Customer Insights, January 19 – March 6 and March 10 – 20, 2015. The 100 self-selected respondents come from the Canadian Institutional Investment Network database and include persons serving in executive or management roles at the pension plans. Margin of error +/-8.7%. Sun Life Investment Management is the brand name under which the investment operations of Sun Life Assurance Company of Canada and Sun Life Investment Management Inc. operate. Sun Life Investment Management Inc. is a Canadian registered portfolio manager, investment fund manager and exempt market dealer and is the manager and distributor of the funds. Subscriptions for units of a fund will only be considered on the terms of the offering memorandum of the fund, which will be available to qualified Canadian institutional investors. This communication is intended to be general in nature only and does not constitute a specific offer to buy and/or sell securities, insurance or investment services. Investors should consult with their professional advisors before acting upon any information contained herein. Canadian University Pension Funds Appendix II Equity Canadian Foreign 2014 Ranking Assets $ Millions Fixed Income Other 2013 Ranking Assets $ Millions Toronto 1 3,783 13% Montréal 2 3,374 13% 32% 23% 32% 1 3,246 33% 37% 17% 2 Québec 3 3,367 3,050 16% 30% 32% 23% 3 Laval 4 3,049 2,702 11% 27% 44% 19% 4 York 2,430 5 1,995 14% 45% 36% 5% 5 1,767 British Columbia (Faculty) 6 1,922 29% 28% 34% 9% 6 1,744 Ottawa 7 1,873 10% 46% 20% 25% 7 1,728 Queen’s 8 1,748 22% 35% 28% 15% 8 1,647 McMaster 9 1,595 20% 48% 32% 0% 9 1,436 Western Ontario 10 1,354 21% 40% 40% 0% 10 1,275 Waterloo 11 1,317 4% 31% 57% 8% 11 1,198 Memorial 12 1,280 28% 33% 25% 14% 1,161 Institutions Guelph 13 1,274 23% 40% 33% 4% 12 British Columbia (Staff) 14 1,272 15% 21% 45% 20% 14 1,091 McGill (Accumulation) 15 1,203 16% 37% 31% 17% 13 1,137 Saskatchewan 16 1,163 26% 34% 40% 0% 15 1,070 Manitoba 17 1,093 37% 23% 35% 6% 16 1,033 Dalhousie 18 1,064 15% 35% 34% 16% 17 962 Carleton 19 1,030 31% 38% 27% 4% 18 957 Ryerson 20 1,026 1% 28% 30% 41% 19 933 Victoria BC (Comb. & Money) 21 1,006 22% 36% 31% 11% 20 900 Sherbrooke 22 847 31% 35% 34% 0% 21 778 Concordia 23 846 3% 32% 44% 21% 22 777 Windsor 24 634 31% 31% 39% 0% 23 577 Wilfrid Laurier 25 459 23% 29% 37% 12% 24 404 École Polytechnique 26 421 26% 29% 42% 4% 25 373 Brock 27 417 15% 48% 38% 0% 26 361 HEC Montréal 28 357 18% 46% 21% 16% 27 333 Laurentian 29 351 26% 31% 36% 7% 29 319 Regina DB 30 345 19% 45% 29% 8% 28 324 Simon Fraser (Academic) 31 322 26% 38% 37% 0% 30 297 Simon Fraser (Admin. & Union) 32 294 28% 32% 35% 6% 31 263 Trent 33 285 29% 30% 41% 0% 32 260 New Brunswick 34 276 20% 34% 46% 0% 33 254 Moncton 35 264 29% 29% 38% 4% 34 252 Victoria BC (Staff) 36 229 14% 32% 39% 16% 37 208 Lakehead 37 221 33% 35% 32% 0% 35 221 PEI 38 213 28% 28% 28% 15% 38 196 McGill (Pensioner) 39 198 0% 30% 59% 11% 36 209 Brandon 40 156 34% 26% 40% 0% 39 144 Saint Mary’s 41 144 23% 35% 42% 0% 40 135 Winnipeg 42 125 17% 37% 36% 10% 41 126 Acadia 43 123 31% 31% 38% 0% 42 115 Bishop’s 44 116 33% 30% 28% 10% 43 108 Regina DC 45 113 19% 43% 35% 2% 44 95 St. Francis Xavier 46 96 35% 24% 40% 1% 45 87 Northern BC 47 72 44% 20% 35% 1% 46 63 Mount Allison (Academic) 48 52 30% 35% 35% 0% 47 50 Victoria (UT) 49 51 27% 36% 37% 0% 48 45 Mount Allison (Non-Academic) 50 34 19% 40% 42% 0% 49 30 Sainte-Anne 51 29 30% 29% 38% 4% 51 27 Saint-Boniface 52 28 23% 37% 38% 3% 50 28 Trinity (UT) 53 26 33% 29% 38% 0% 53 23 24 King’s (NS) 54 26 38% 29% 34% 0% 52 Algoma 55 23 41% 29% 30% 0% 55 21 Saint-Paul 56 23 35% 31% 34% 0% 54 22 Weightings: Canadian Equity Foreign Equity Fixed Income Other Mean 23% 33% 36% 8% Median 23% 32% 36% 4% Dollar-weighted mean 18% 34% 34% 14% Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 59 Real estate from the ground up. We know the opportunities. Real estate investments are playing a growing role in both DB and DC plan portfolios — and the demand for investment stability and diversity continues to rise. We can help. Invesco’s real estate team is on the ground worldwide, with more than 420 employees in 15 countries. It’s the kind of bottom-up, local-market intelligence that can provide your plan with superior real estate solutions — through both REITs and direct private real estate arrangements. With a 30-year track record and a senior management team that has worked together for more than 28 years,† you can expect a proven investment process and exceptional management stability. Whether your focus is the U.S., Europe, Asia or global, we can help you tailor a real estate strategy to meet your plan’s needs. Singular focus. Exceptional solutions. Find out more about our institutional strategies. Call us at 416.324.7442 or visit www.institutional.invesco.ca. All data is as at June 30, 2015. † Senior management is comprised of six founding members of the Invesco Real Estate business platform. Invesco® and all associated trademarks are trademarks of Invesco Holding Company Limited, used under licence. © Invesco Canada Ltd., 2015 Vagues de changement dans le secteur financier Par Serge Germain, Directeur général, comité de retraite, Université de Sherbrooke 68 66 68 64 2014 2013 2012 2011 2010 2009 2008 2007 2006 61 67 66 69 67 72 67 2004 2005 10,9 2011 15,3 11,0 2010 14,0 10,8 2009 2014 8,7 2008 2013 10,9 2007 12,1 10,4 2006 2012 9,0 Total de l’actif des fond de dotation (milliards de $) 7,9 Caisses de retraite • PLOOLRQVHQDFWLIV‘Petites caisses de retraite’ – 6 fonds • !PLOOLRQVjPLOOLRQV²IRQGV • !PLOOLRQVjPLOOLRQV – 16 fonds • > 500 millions ‘Grandes caisses de retraite’ – 24 fonds Au nom du Comité des placements et de la trésorerie, j’aimerais remercier tous ceux et celles qui ont participé à notre sondage. La OLVWHGHVpWDEOLVVHPHQWVSDUWLFLSDQWVÀJXUH aux Annexes I et II, qui suivent cet article. Participants (fonds de dotation) 2005 Fonds de dotation • PLOOLRQVHQDFWLIV‘Petits fonds de dotation’ – 10 fonds • !PLOOLRQVjPLOOLRQV²IRQGV • !PLOOLRQVjPLOOLRQV²IRQGV • > 100 millions ‘Grands fonds de dotation’ – 24 fonds 2004 Figure 1 : Statistiques du sondage – fonds de dotation Fonds de Dotation 11.5 % 10.2 % 9.7 % >100 M$ 8.1 % > 30 M$ à 100 M$ Variation des actifs et rendements Au total, 68 universités ont participé au sondage et ont déclaré des actifs de dotation d’une valeur globale de 15,3 milliards de dollars. Cette valeur est supérieure à celles de 2013 et de 2012, qui s’élevaient respectivement à 14 milliards et à 12,1 milliards de dollars (Figure 1). Soulignons au passage que quatre universités ont des fonds de dotation qui dépassent le milliard de dollars. Ces quatre fonds ont une valeur globale de 5,9 milliards, ce qui représente 38 % des actifs déclarés dans le sondage. Comme le montre la Figure 2, le groupe GHVJUDQGVIRQGVGHGRWDWLRQ!0D enregistré le rendement annuel médian le > 10 M$ à 30 M$ Le thème du congrès 2015 de l’ACPAU, « Vagues de changement », décrit les changements considérables qu’ont subis les universités dernièrement, parfois dans un contexte plutôt tumultueux. Les établissements doivent s’approprier ces changements et en canaliser l’énergie pour être concurrentiels et exceller dans les années à venir. Les trésoriers, les professionnels GHVÀQDQFHVHWOHVFRPLWpVGHFRQVHLOGHV universités doivent constamment gérer ces changements et s’y adapter pour maintenir des caisses de retraite et des fonds de GRWDWLRQELHQÀQDQFpVSRUWHXUVGHO·pTXLWp intergénérationnelle. Le présent article est l’aboutissement d’un processus lancé en février, alors que nous invitions nos établissements membres à participer au sondage canadien le plus complet sur les placements des fonds de dotation et caisses de retraite des établissements d’enseignement postsecondaire. En avril et mai, le bureau national de l’ACPAU en a dépouillé les données exhaustives pour en faire le résumé que voici. Il est primordial pour nous de pouvoir compter sur une participation stable de façon à pouvoir comparer les résultats d’année en année et entre les établissements. Comparativement à l’année précédente, nous avons connu cette année une légère hausse de participation à la fois au sondage sur les fonds de dotation et à celui sur les FDLVVHV GH UHWUDLWH$X[ ÀQV GX VRQGDJH nous avons créé les catégories suivantes de manière à faciliter la comparaison entre les universités. < $10 M Introduction 18 % 16 % 14 % 12 % 10 % 8% 6% 4% 2% 0% Haut Médiane Bas Figure 2 : Rendements annuels 2014 (selon la taille du fonds de dotation) <<Le présent article est l’aboutissement d’un processus lancé en février, alors que nous invitions nos établissements membres à participer au sondage canadien le plus complet sur les placements des fonds de dotation et caisses de retraite des établissements d’enseignement postsecondaire>> 62 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS <<L’écart entre les rendements annuels en 2014, comparativement à 2013, est particulièrement remarquable.>> 2014 2013 > 100 M$ > 30 M$ 100 M$ > 10 M$ 30 M$ <10 M$ > 100 M$ > 30 M$ 100 M$ > 10 M$ to 30 M$ < 10 M$ High 14,5 % 14,4 % 15,8 % 12,8 % 27,8 % 25,3 % 21,1 % 14,6 % Médiane 11,5 % 9,7 % 10,2 % 8,1 % 17,8 % 16,1 % 14,1 % 9,3 % Bas 6,2 % 5,6 % 4,5 % 1,6 % -7,3 % -1,3 % 4,5 % 2,0 % Tableau 1 : Rendements annuels par groupe, 2013 et 2014 20 % 15 % 10 % 5% 0% -5 % < 10 M$ -10 % >10 M$ à 30 M$ >30 M$ à 100 M$ -15 % >100 M$ fin 2014 fin 2013 fin 2012 fin 2011 fin 2010 fin 2009 fin 2008 fin 2007 fin 2006 fin 2005 -20 % Figure 3 : Médianes des rendements annuels des fonds de dotation, par groupe 10 % 9% 8% 7% 6% 5% 4% < 10 M$ 3% >10 M$ à 30 M$ 2% >30 M$ à 100 M$ 1% >100 M$ fin 2014 fin 2013 fin 2012 fin 2011 fin 2010 fin 2009 fin 2008 fin 2007 fin 2006 fin 2005 0% plus élevé (11,5 %) et celui des petits fonds 0 OH UHQGHPHQW DQQXHO PpGLDQ le moins élevé (8,1 %). La médiane des rendements de l’ensemble des participants est de 10,3 %, comparativement à 16,1 % l’année précédente. Bien que les quatre groupes aient en reg i s tré u n ren d em en t a n n u e l médian plus bas en 2014 qu’en 2013, des rendements avoisinant les 10 % sont tout de même considérés comme acceptables. L’écart entre les rendements annuels en 2014, comparativement à 2013, est particulièrement remarquable (voir le Tableau 1). En 2014, le groupe GHV JUDQGV IRQGV DIÀFKDLW O·pFDUW OH SOXV petit (différence entre le rendement le plus élevé et le rendement le plus bas) (8,3 %) alors qu’il enregistrait le plus grand en 2013 (35 %). La Figure 3 présente l’évolution des médianes des rendements annuels par groupe. Soulignons qu’au cours des dix dernières années, le rendement annuel médian du groupe des petits fonds a souvent enregistré les rendements les plus bas de tous les groupes. La Figure 4 présente les rendements médians sur une période continue de 10 ans. Tous les groupes ont vu leur rendement médian sur 10 ans augmenter légèrement en 2014. Toutefois, malgré les bons résultats enregistrés en 2014, le rendement médian global de 6,5 % sur 10 ans demeure trop faible pour subvenir au rythme de dépenses de la plupart des universités et pour contrer OHVSUHVVLRQVLQÁDWLRQQLVWHV Figure 4 : Rendement médian des fonds de dotation sur 10 ans, par groupe Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 63 Vagues de changement dans le secteur financier Composition de l’actif Comme le montre la Figure 5, le groupe des grands fonds détient la plus grande proportion d’actions et d’actifs non traditionnels et la plus petite proportion d’actifs à revenu fixe. Il est aussi le groupe qui consacre la plus petite part de son actif aux obligations d’épargne. Par actifs non traditionnels, on désigne ici les placements autres que OHVWLWUHVjUHYHQXÀ[HRXOHVWLWUHVFRWpV en bourse. Les actifs non traditionnels les plus communément détenus par des fonds de dotation sont l’immobilier, les fonds spéculatifs et les capitaux-propres. Dans la prochaine version du sondage (prévue pour 2016), nous détaillerons davantage ces catégories d’actifs, ce qui nous permettra de présenter des renseignements plus précis. Caisses De Retraite Variation des actifs et rendements Au total, 56 universités ont participé à la partie du sondage sur les caisses de retraite cette année et ont déclaré un actif de retraite d’une valeur globale de 44,7 milliards de dollars, une hausse de 5,3 milliards ou de 13,5 % par rapport à l’année précédente (Figure 7). Comme le montre la Figure 8, le groupe des grandes caisses de retraite a enregistré le meilleur rendement annuel médian (11,2 %), tandis que celui des trois plus petits groupes tournait autour de 10 %. C’est une caisse d’une valeur de SOXVGH0TXLDDIÀFKpOHUHQGHPHQW le plus élevé (14,7 %), et une caisse valant HQWUH0HW0TXLDHQUHJLVWUpOH plus bas (7,5 %). En 2014, l’ensemble des caisses a connu un rendement médian de 10,4 %, ce qui est semblable au rendement médian des fonds de dotation. Participants (caisses de retraite) Décembre 2014 - par trimestre et par taille du fonds 54 2014 2013 50 2012 2010 2009 2008 2007 2006 30,0 % 2005 2004 40,0 % 2011 50 52 50,0 % 56 55 60,0 % 55 n=24 56 n=25 54 n=10 57 n=9 56 70,0 % 20,0 % 44,7 39,4 Figure 7 : Statistiques du sondage caisses de retraite Figure 5 : Répartition de l’actif moyen, en dollars pondérés par groupe La ligne horizontale épaisse indique la médiane, le carré gris, la valeur du 25e au 75e percentile, et la ligne verticale, la valeur du 10e au 90e percentile. 16,0 % 10,3% 9,9% 14,0 % 9,9% 11,2% 6,5 % 6,0 % 4,0 % >500 M$ 8,0 % > 150 M$ à 500 M$ < 30 M$ 10,0 % > 30 M$ à 150 M$ 12,0 % 18 % 16 % 14 % 12 % 10 % 8% 6% 4% 2% 0% Haut Médiane Bas Figure 8 : Rendements annuels (selon la taille de la caisse de retraite) fin 2014 fin 2013 fin 2012 fin 2011 fin 2010 fin 2009 fin 2008 fin 2007 fin 2006 fin 2005 fin 2004 fin 2003 fin 2002 fin 2001 fin 2000 2,0 % 0,0 % 2014 6,8 % 2013 3,5 % 35,5 4,0 % 2012 1,5 % 31,4 52,9 % 2011 35,6 % 34,4 27,7 % 2010 21,8 % 31,3 1,3 % 2009 8,4 % 28,1 6,3 % 2008 18,8 % 34,3 38,9 % 2007 < 10M $ 52,6 % 34,4 >10 M$ à 30 M$ 61,9 % 2006 >$30 M$ à 100 M$ 57,9 % 25,4 >100 M$ 2005 Action Non traditionnels Revenu fixe Comptant 2004 0,0 % 30,1 Total - Actifs des caisses de retraite (milliards de $) 10,0 % Figure 6 : Rendements des fonds de dotation sur 10 ans, par année, au 31 décembre 64 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS La ligne horizontale épaisse indique la médiane, le carré gris, la valeur du 25e au 75e percentile, et la ligne verticale, la valeur du 10e au 90e percentile. 16,0 % 14,0 % 12,0 % 10,0 % 8,0 % 6,0 % 4,0 % fin 2014 fin 2013 fin 2012 fin 2011 fin 2010 fin 2009 fin 2008 fin 2007 fin 2006 fin 2005 fin 2004 fin 2003 fin 2002 fin 2001 0,0 % fin 2000 2,0 % Figure 9 : Rendements des caisses de retraite sur 10 ans, par année, au 31 décembre Décembre 2014 - par trimestre et par taille du fonds 70,0 % n=7 n=10 n=16 n=24 < 30 M$ >30 M$ à 150 M$ >150 M$ à 500 M$ > 500 M$ 62,5 % 60,2 % 57,1% 51,2 % 1,0 % 3,0 % 6,2 % 15,0 % 32,5 % 27,2 % 33,2 % 31,8 % 4,0 % 9,6 % 3,5 % 2,0 % 60,0 % 50,0 % 40,0 % 30,0 % 20,0 % 10,0 % 0,0 % Actions Non traditionnels Revenu fixe Comptant Bien que les rendements annuels soient intéressants, il est important d’examiner les rendements à long terme pour évaluer ODVDQWpÀQDQFLqUHHWODYLDELOLWpGHVFDLVVHV de retraite. La Figure 9 montre l’évolution des rendements moyens (moyenne mobile) sur 10 ans. Le rendement médian sur 10 ans a été plutôt stable au cours des trois dernières années – il était de 6,9 % en 2014 – après une décroissance constante pendant plusieurs années (Figure 9). Les comités dont la caisse de retraite fera bientôt l’objet d’une évaluation devraient déjà être en train d’examiner la solidité des hypothèses avec leur actuaire et, au besoin, de prévoir des ajustements en fonction de l’impact possible de faibles rendements obligataires sur les taux de cotisation. Composition de l’actif La Figure 10 présente la répartition des actifs selon la taille de la caisse de retraite. La part qu’occupent les placements à revenu fixe est assez semblable dans chaque sous-groupe. À l’image des années précédentes, les caisses diffèrent au chapitre des actifs non traditionnels par opposition aux actions. Le groupe des grandes caisses de retraite détient la plus grande proportion d’actifs non traditionnels et la plus faible proportion d’actions. On constate exactement le contraire du côté des petites caisses, qui investissent peu dans les actifs non traditionnels. Par actifs non traditionnels, on désigne encore ici les placements autres TXHOHVWLWUHVjUHYHQXÀ[HRXOHVWLWUHVFRWpV en bourse. Figure 10 : Répartition de l’actif moyen, par taille de la caisse de retraite <<Les comités dont la caisse de retraite fera bientôt l’objet d’une évaluation devraient déjà être en train d’examiner la solidité des hypothèses avec leur actuaire et, au besoin, de prévoir des ajustements en fonction de l’impact possible de faibles rendements obligataires sur les taux de cotisation.>> Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 65 Vagues de changement dans le secteur financier Conclusion Les rendements indiciels des actifs traditionnels et la variation des rendements entre différentes catégories d’actifs sont présentés à la Figure 11. On remarquera que le rendement annuel le plus élevé est celui du S&P 500 (CAN), à 23,9 %, et que le plus bas est celui des obligations d’épargne canadiennes à court terme, à 3,1 %. Sur dix ans, les actions canadiennes ont rapporté 7,6 %, les actions américaines, 7,3 % en dollars canadiens, et les obligations canadiennes, 5,3 %. Ces rendements, alliés aux pressions LQÁDWLRQQLVWHVJpQpUDOHPHQWSOXVpOHYpHV dans les universités, ne permettent pas de conserver la valeur nominale des fonds de dotation. En effet, l’état des marchés, entre autres facteurs, incite les gestionnaires de fonds de dotation à abandonner les actifs classiques en faveur d’actifs non traditionnels et à rajuster davantage leurs habitudes de dépenses. Dans le sondage, les catégories d’actifs non traditionnels sont classées sous « Autres » et représentent 19 % du fonds de dotation moyen (en dollars pondérés). Par comparaison, dans le sondage de 2001, les actifs du fonds de dotation moyen comprenaient strictement GHVDFWLRQVHWGHVSODFHPHQWVjUHYHQXÀ[H Catégorie d’actif Indice Actions canadiennes Les gestionnaires de fonds de dotation et de caisses de retraite doivent constamment affronter les vagues de changement en surveillant de près si ces fonds et ces caisses atteignent leurs objectifs et en faisant les changements nécessaires pour améliorer les résultats prévus. Les comités des placements doivent comprendre ce qu’ils peuvent gérer – les dépenses dans le cas des fonds de dotation et les risques dans le cas des caisses de retraite – et ce qu’ils ne peuvent pas, et réagir de manière à produire des résultats qui permettront aux universités de croître et d’exceller. 1 an 4 ans 10 ans S&P/TSX composé (plafonné) 10,6 % 5,2 % 7,6 % Actions américaines S&P 500 (CAN) 23,9 % 20,1 % 7,3 % Actions du marché international MSCI mondial (CAN) 14,4 % 14,1 % 5,7 % Actions EAEO MSCI EAFE (CAN) 3,7 % 8,8 % 4,1 % Actions de marchés en émergence MSCI marchés émergents (CAN) 6,6 % 1,7 % 8,1 % Obligations canadiennes Universe Bond DEX 8,8 % 5,1 % 5,3 % Obligations canadiennes à long terme Obligations à long terme DEX 17,5 % 8,2 % 7,4 % Obligations canadiennes à rendement réel Obligations à rendement réel DEX 13,2 % 4,6 % 5,7 % Obligations canadiennes à court terme Bons du Trésor à 91 jours DEX 3,1 % 2,9 % 3,8 % 1,5 % 1,5 % 1,7 % L’inflation est calculée selon l’indice des prix à la consommation pour le Canada : Figure 11 : Rendement des indices au 31 décembre 2014 (Source : Étude de fonds communs RBC Dexia) CAUBO Data at Work Les données de l'ACPAU en action CAUBO’s Financial Information of Universities and Colleges is used all over the place – by bloggers, researchers, educators and administrators across Canada! Tout le monde s’en sert, partout au Canada : blogueurs, chercheurs, ceux qui enseignent comme ceux qui gèrent. Quoi donc? Information financière des universités et collèges, une autre publication de l’ACPAU! 66 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS Fonds de dotation des universités canadiennes Établissements Toronto British Columbia McGill Alberta Queen’s Calgary Manitoba McMaster Western Ontario Dalhousie Victoria (UT) York Simon Fraser Victoria (BC) Guelph Saskatchewan Waterloo Montréal Ottawa Carleton Laval New Brunswick Mount Allison Ryerson Windsor Wilfrid Laurier Concordia Trinity (UT) Lakehead Memorial Moncton Brock Acadia Northern BC MacEwan Brandon HEC Montréal Winnipeg Lethbridge Trent Mount Royal Laurentian King’s (NS) Regina Bishop’s Sherbrooke PEI Saint Mary’s Cape Breton Mount St. Vincent Saint-Paul UQAM Huron Vancouver Island Trinity Western Sudbury OCAD Saint-Boniface Fraser Valley ETS Thorneloe Emily Carr Redeemer Algoma Huntington Athabasca Sainte Anne UQTR SIAST St. Francis Xavier 2014 Rang 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 Pondération: Moyenne Médiane Moyenne pondérée en $ Actif total en Actions millions de $ Canadiennes Étrangères 2 060 13 % 30 % 1 401 26 % 35 % 1 356 10 % 38 % 1 057 19 % 53 % 852 20 % 43 % 715 36 % 39 % 605 29 % 38 % 551 21 % 43 % 546 21 % 33 % 511 17 % 46 % 476 6% 20 % 434 15 % 55 % 378 34 % 34 % 377 28 % 34 % 325 19 % 49 % 317 18 % 39 % 317 24 % 18 % 280 22 % 34 % 246 7% 45 % 197 35 % 35 % 166 20 % 36 % 163 27 % 33 % 157 20 % 54 % 113 29 % 33 % 99 31 % 33 % 91 17 % 17 % 88 34 % 28 % 85 14 % 33 % 82 74 % 21 % 80 34 % 20 % 78 24 % 29 % 77 14 % 45 % 74 39 % 32 % 71 25 % 37 % 60 21 % 57 % 59 36 % 28 % 59 18 % 45 % 54 27 % 47 % 54 40 % 38 % 51 19 % 41 % 49 25 % 25 % 45 31 % 21 % 41 39 % 30 % 40 25 % 43 % 39 29 % 37 % 37 16 % 34 % 36 28 % 29 % 34 49 % 28 % 31 20 % 39 % 26 20 % 40 % 20 5% 3% 20 29 % 17 % 19 28 % 35 % 18 20 % 39 % 17 36 % 32 % 16 29 % 33 % 15 32 % 34 % 15 24 % 26 % 10 22 % 24 % 9 0% 0% 7 35 % 18 % 5 0% 0% 5 42 % 24 % 5 41 % 29 % 3 29 % 33 % 3 32 % 27 % 2 18 % 2% 0 0% 0% Actions canadiennes 25 % 25 % 21 % Clllic Cli Clic C Click liic ick HERE HE H ERE R E to to return re return to TABLE OF CONTENTS Actions étrangères 32 % 33 % 37 % Annexe I Revenus fixes 22 % 19 % 21 % 16 % 18 % 24 % 21 % 31 % 24 % 22 % 6% 30 % 26 % 28 % 29 % 27 % 58 % 36 % 23 % 26 % 30 % 39 % 27 % 38 % 36 % 45 % 25 % 21 % 5% 46 % 39 % 41 % 29 % 29 % 22 % 36 % 20 % 26 % 22 % 40 % 40 % 49 % 32 % 22 % 35 % 34 % 44 % 23 % 41 % 40 % 25 % 54 % 38 % 41 % 31 % 38 % 35 % 50 % 53 % 100 % 47 % 100 % 35 % 30 % 38 % 41 % 48 % 100 % Revenus fixes 35 % 32 % 24 % Autres 35 % 20 % 31 % 12 % 20 % 0% 12 % 4% 23 % 15 % 68 % 0% 6% 10 % 3% 16 % 0% 9% 26 % 5% 13 % 0% 0% 0% 0% 21 % 14 % 32 % 0% 0% 8% 0% 0% 10 % 0% 0% 16 % 0% 0% 0% 10 % 0% 0% 10 % 0% 16 % 0% 0% 0% 0% 68 % 0% 0% 0% 1% 0% 0% 0% 0% 0% 0% 0% 0% 0% 0% 0% 31 % 0% 2013 Rang 1 2 3 4 5 6 7 8 9 10 11 12 14 13 15 17 16 18 19 20 21 22 23 24 28 26 27 29 30 32 31 34 33 35 36 38 37 40 39 41 42 43 44 45 47 46 48 49 50 51 52 53 54 55 57 56 Actif total en millions de $ 1 839 1 271 1 217 979 774 638 546 521 482 482 457 405 336 348 295 277 288 245 225 190 155 142 138 108 82 84 83 77 75 74 74 69 69 64 56 52 54 48 50 48 46 41 38 35 33 33 31 30 28 24 20 18 17 15 14 15 58 59 60 62 61 63 13 9 9 7 7 4 64 3 66 2 65 25 2 108 Autres 8% 0% 17 % UNIVERSITY MANAGER • Fall 2015 67 Vagues de changement dans le secteur financier Caisses de retraite des universités canadiennes Établissements Toronto Montréal Québec Laval York British Columbia (corps prof.) Ottawa Queen’s McMaster Western Ontario Waterloo Memorial Guelph British Columbia (personnel) McGill (accumulation) Saskatchewan Manitoba Dalhousie Carleton Ryerson Victoria BC (comb./cot. déterminées) Sherbrooke Concordia Windsor Wilfrid Laurier École Polytechnique Brock HEC Montréal Laurentian Regina DB Simon Fraser (corps prof.) Simon Fraser (admin. et syndicat) Trent New Brunswick Moncton Victoria BC (personnel) Lakehead PEI McGill (retraités) Brandon Saint Mary’s Winnipeg Acadia Bishop’s Regina DC St. Francis Xavier Northern BC Mount Allison (corps prof.) Victoria (UT) Mount Allison (personnel) Sainte-Anne Saint-Boniface Trinity (UT) King’s (NS) Algoma Saint-Paul Pondération: 2014 Rang 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Actif total en millions de $ 3 783 3 374 3 367 2 702 1 995 1 922 1 873 1 748 1 595 1 354 1 317 1 280 1 274 1 272 1 203 1 163 1 093 1 064 1 030 1 026 21 1 006 22 % 22 23 24 25 26 27 28 29 30 847 846 634 459 421 417 357 351 345 31 Annexe II Revenus fixes 23 % 37 % 32 % 44 % 36 % 34 % 20 % 28 % 32 % 40 % 57 % 25 % 33 % 45 % 31 % 40 % 35 % 34 % 27 % 30 % Autres 32 % 17 % 23 % 19 % 5% 9% 25 % 15 % 0% 0% 8% 14 % 4% 20 % 17 % 0% 6% 16 % 4% 41 % 2013 Rang 1 2 3 4 5 6 7 8 9 10 11 Actif total en millions de $ 3 246 3 050 3 049 2 430 1 767 1 744 1 728 1 647 1 436 1 275 1 198 12 14 13 15 16 17 18 19 1161 1 091 1 137 1 070 1 033 962 957 933 36 % 31 % 11 % 20 900 31 % 3% 31 % 23 % 26 % 15 % 18 % 26 % 19 % 35 % 32 % 31 % 29 % 29 % 48 % 46 % 31 % 45 % 34 % 44 % 39 % 37 % 42 % 38 % 21 % 36 % 29 % 0% 21 % 0% 12 % 4% 0% 16 % 7% 8% 21 22 23 24 25 26 27 29 28 778 777 577 404 373 361 333 319 324 322 26 % 38 % 37 % 0% 30 297 32 294 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 285 276 264 229 221 213 198 156 144 125 123 116 113 96 72 52 51 34 29 28 26 26 23 23 28 % 32 % 35 % 6% 31 263 29 % 20 % 29 % 14 % 33 % 28 % 0% 34 % 23 % 17 % 31 % 33 % 19 % 35 % 44 % 30 % 27 % 19 % 30 % 23 % 33 % 38 % 41 % 35 % 30 % 34 % 29 % 32 % 35 % 28 % 30 % 26 % 35 % 37 % 31 % 30 % 43 % 24 % 20 % 35 % 36 % 40 % 29 % 37 % 29 % 29 % 29 % 31 % 41 % 46 % 38 % 39 % 32 % 28 % 59 % 40 % 42 % 36 % 38 % 28 % 35 % 40 % 35 % 35 % 37 % 42 % 38 % 38 % 38 % 34 % 30 % 34 % 0% 0% 4% 16 % 0% 15 % 11 % 0% 0% 10 % 0% 10 % 2% 1% 1% 0% 0% 0% 4% 3% 0% 0% 0% 0% 32 33 34 37 35 38 36 39 40 41 42 43 44 45 46 47 48 49 51 50 53 52 55 54 260 254 252 208 221 196 209 144 135 126 115 108 95 87 63 50 45 30 27 28 23 24 21 22 Actions Canadiennes Étrangères 13 % 32 % 13 % 33 % 16 % 30 % 11 % 27 % 14 % 45 % 29 % 28 % 10 % 46 % 22 % 35 % 20 % 48 % 21 % 40 % 4% 31 % 28 % 33 % 23 % 40 % 15 % 21 % 16 % 37 % 26 % 34 % 37 % 23 % 15 % 35 % 31 % 38 % 1% 28 % Actions canadiennes Actions étrangères Revenus fixes Autres Moyenne 23 % 33 % 36 % 8% Médiane 23 % 32 % 36 % 4% Moyenne pondérée en $ 18 % 34 % 34 % 14 % 68 UNIVERSITY MANAGER • Fall 2015 Click HERE to return to TABLE TABL LE OF OF CONTENTS CO CON C ON O NT TENT TEN TE EN ENT E NT N TS Professional Development Perfectionnement Professionnel Targeted, practical and effective. Ciblé, pratique et efficace. October 1 and 8, 2015 12:00 p.m. – 1:30 p.m. ET Two-part webinar Academic Collective Bargaining in Universities: A Primer 21 et 22 octobre 2015 Colloque 'HX[LqPH FROORTXH IUDQFRSKRQH GHV VHUYLFHV GHV ÀQDQFHV présenté par le BCI et l'ACPAU, Québec (QC) October 26 to November 27, 2015 Online Course University Culture and Governance November 16 and 17, 2015 Workshop Advanced Resource Management, Toronto, ON 26 novembre 2015 Atelier Mieux comprendre les particularités du monde universitaire, Montréal (QC) January 11 – February 25, 2016 Online Course Fundamentals of the Research Enterprise June 12 – 14, 2016 Annual Conference CAUBO 2016: The Power of Collaboration Quebec City, QC Now available online: The Guide to Communications in a University Context and its companion document, Strategies for Communicating in a University Context. Both documents are free to download from www.caubo.ca. Click HERE to return to TABLE OF CONTENTS UNIVERSITY MANAGER • Fall 2015 69 Doing business with our ADVERTISERS Company Addenda Capital Investment Management AON Hewitt Athabasca University Faculty of Business EÀQDQFH BNY Mellon Asset Management %URRNÀHOG,QYHVWPHQW0DQDJHPHQW,QF Centurion Asset Management Inc. Chartwells Website Phone www.addenda-capital.com www.aonhewitt.com/canada www.business.athabascau.ca ZZZEÀQDQFHFD www.bnymellon.com ZZZEURRNÀHOGFRP www.centurionreit.com www.dineoncampus.ca Page 514-287-7373 CIBC Mellon www.cibcmellon.com Commissionaires CURIE D.L.G.L. Ltd. D.P. Murphy Hotels and Resorts Eckler Ltd. Enterprise Holdings Canada Foyston, Gordon & Payne Inc. Greystone Managed Investments Inc. Guardian Ethical Management Invesco Trimark Ltd. Kyocera Document Solutions Letko Brosseau Global Investment Management MFS Investment Management MNP LLP Moneris Morneau Shepell National Bank Pavilion Advisory Group Phillips, Hager & North Investment Management Ltd. PricewaterhouseCoopers LLP Romspen Mortgage Investment Fund RP Investment Advisors Russell Investments Shure Canada Sun Life Investment Management TD Asset Management The Retired Teachers Association of Ontario RTO TORON AMI International Asset Management University of Guelph College of Business + Economics www.commissionaires.ca www.curie.org www.dlgl.com www.dpmurphyhotelsandresorts.com www.eckler.ca/vision www.caubo.ca/supplier_contracts/car_rentals www.foyston.com www.greystone.ca www.gemportfolios.com www.institutional.invesco.ca www.kyoceradocumentsolutions.ca www.lba.ca www.mfs.com/getactive www.mnp.ca www.moneris.com www.morneaushepell.com www.nbc.ca www.pavilioncorp.com/advisory-services 800-561-4650 514-393-4899 (Brian Cyr) 416-775-5876 (Michael Parsons) 416-956-5229 (Angela Vidakovich) 888-992-5736 647-328-0709 416-643-6365 (Shane Kuros) or 416-643-5373 (Tim Rourke) 888-688-0715 905-336-3366 450-979-4646 (Richard Rousseau) 902-564-6555 416-696-3000 613-274-6931 (Melanie Smith) 416-848-1919 416-309-2182 (Michael Gillis) 800-253-9181 416-324-7442 30 47 8 44 31 52 51 4 28 866-954-5101 26 20 11 14 16 70 15 71 49 60, 61 7 56 54 72 23 42 2 48 www.phn.com 855-408-6111 36 www.pwc.com/ca/education www.romspen.com www.rpia.ca www.russell.com/ca/institutional www.shurecanada.com www.sunlifeinvestmentmanagement.com www.tdaminstitutional.com 416-863-1133 416-966-1100 647-776-1777 866-737-2228 800-363-8855 855-807-7546 888-834-6339 26 3 44 45 21 58 34 28 800-307-8557 416-862-9800 877-500-0792 (Maggie Kiel) 816-319-7450 416-380-2765 www.rto-ero.org/join-us 800-361-9888 www.toron-ami.com 800-463-7475 35 www.leadership.uoguelph.ca 888-622-2474 37 Two Great Brands. One Global Business Rental Solution. As your preferred provider, we offer CAUBO institutional and affiliate members two great car rental options with the service, value and convenience from brands they’ve come to know and trust. National Car Rental has long been favored by frequent renters at airports for speed and vehicle choice. Enterprise Rent-A-Car is the first choice for travelers who need to rent near their home or office. For more information, visit www. caubo.ca/supplier_contracts/car_rentals Or contact: Melanie Smith [email protected] (613) 274-6931 Deux grandes marques. Une solution d’affaires à l’échelle mondiale. À titre de fournisseurs préférentiels de l’ACPAU nous offrons à ses membres institutionnels et affilés deux grands choix en matière de location de voitures, assortis de service, de valeur et de commodité qu’ils connaissent et auxquels ils font confiance. Two Great Brands. One Global Business Rental Solution. Les voyageurs aériens assidus préfèrent la rapidité de service et les choix de véhicules que leur offre Location d’autos National tandis que les voyageurs qui louent à proximité de leur résidence ou de leur bureau font de Location d’autos Enterprise leur premier choix. Afin d’obtenir plus d’information, consulter www. caubo.ca/supplier_contracts/car_rentals National, National Car Rental, Emerald Club and the flag are trademarks of Vanguard Trademark Holdings, USA LLC. Enterprise and the “e” logo are trademarks of Enterprise Holdings, Inc. © 2014 Enterprise Holdings, Inc. F00492 9.14 JH 70 UNIVERSITY MANAGER • Fall 2015 Ou veuillez communiquer avec: Melanie Smith [email protected] (613) 274-6931 Click HERE to return to TABLE OF CONTENTS The Power of Disciplined Investing® Fixed Income Equities Real Assets Multi-Asset Core Income & Growth Real Estate Target Date Funds Bond Plus Canadian, U.S., Global, International, China Mortgages Balanced Infrastructure Alternative Balanced LDI Canadian Small Cap To learn more about how we can work with you to meet your investment needs, please contact: Michael Gillis, Senior Vice-President, Business Development 416.309.2182 [email protected] Greystone.ca This article is for informational purposes only, is not meant as specific investment advice and is not a recommendation to buy or sell any particular security. Commentary and investment capabilities reflected represent the opinions of Greystone Managed Investments Inc. at the date of this article and was developed from sources that Greystone believes to be reliable. Copyright © Greystone Managed Investments Inc. All rights reserved. Take the Lead. Effective Business Resilience is more than a thorough response to unexpected events. It’s taking the lead, preparing more effectively than the competition, and responding before your competitors. Creating a culture of increased resilience by integrating best practices and stress testing internal controls ensures your internal audit function can assist in shielding your organization from threats, protect the continuity of your operation, and keep you one step ahead. Will you lead or follow after a disaster? Contact Cliff Trollope, National Business Resilience Lead at 416.515.3851 or [email protected]