Part 811
Transcription
Part 811
50(811) 0 IEC -l- ~HAPITRE~~TRACTI~NÉLECTRIQUE CHAPTER811:ELECTRICTRACTION I7IABA?311:3JIEKTPI4YECKAIIT%I--A SECTION 811-Ol- SECTION 811-Ol- PA3,?JEJI 811-Ol811-01-01 TERMES GÉNÉRAUX GENERAL TERMS O%l.IJRE TEPMHHbI traction électrique Système de traction dans lequel l’énergie est fournie aux moteurs de traction sous forme électrique. electric traction Elektrische Zugforderung traccib eléctrica trazione elettrica elektrische tractie trakcja elektryczna elektrisk fordonsdrift ; eltraktion A traction system in which electric energy is supplied to traction motors. sneK-rpnrecltafl Tflra CaCTeMa TII,-%,, B KOTOpOii WIeKTpWeCKaR JHeprWl nOAaeTCa Ha TRroBbE ABIJraTeJIH. 811-01-02 traction à courant continu Système de traction dans lequel l’énergie électrique est fournie aux véhicules moteurs sous forme de courant continu par des sources extérieures. d.c. traction Gleichstrom-ZugfiSrderung traccibn a corriente continua trazione a corrente continua gelijkstroomtractie trakcja prqdu stalego likstrijmsdrift A traction system in which electric energy is supplied to motor vehicles from external direct current sources. TUIX Ha POCTORHHOMTON 811-01-03 CrWTeMa TRrII, eAE%HIInbI IIOABIITHOrO B KOTOpOii JJIeKTpWeCKaR COCTaBa OT BHe”IHAX 3HepriSSl IIOAaeTCII EICTO’IHAKOB Ha TFIrOBbIe IIOCTOIIHHOrO TOKa. traction à courant (alternatif) monophasé Système de traction dans lequel l’énergie électrique est fournie aux véhicules moteurs sous forme de courant alternatif monophasé, par des souces extérieures. Note. - Le courant monophasé fourni aux véhicules moteurs peut avoir, soit la fréquence du réseau général national de distribution (fréquence industrielle), soit une fréquence particulière au réseau de chemin de fer (fréquence spéciale). single-phase a.c. traction A traction system in which electric energy is supplied to motor vehicles from external single-phase alternating current sources. Note. - The single-phase current supplied to the motor vehicle may be either at the frequency of the national distribution system (industrial frequency) or at the particular frequency of the railway system (special frequency). Tara Ha oflno<Pa3noMnepeMennoM ToKe CiiCTeMa TRlx, eAIIHAUbI nepeMeHHor0 LQxm4eyame. IIoABM,KHOrO CneuHanbHoti B ~0~0p0fi IIOABIDKHOrO WIeKTpmecKan COCTaBa OT 3Heprm BHeIIIHIIX IIoAaeTcsl IICTOYHAKOB Ha TIIrOBbIe oAHo@a3Horo TOKa. - OAHO@a3HbIü COCTaBa, YaCTOTbI MOxeT TEK, 6bITb IIOAaBaeMblb mi60 mene3HOAOpO~HO~ Ha IIpOMbIJUeHHOii JHeprOCHCTeMbI. TIIrOBJ’EO eAHHHJ.Iy YaCTOTbI, mi60 Einphasen-Wechselstrom-Zugforderung traccibn a corriente (alterna) monof&ica trazione (a corrente alternata) monofase eenfasewisselstroomtractie trakcja prqdu (przemiennego) jednofazowego enfasdrift 50(811) 0 CE1 811-01-04 traction à courant (alternatif) triphasé Système de traction dans lequel l’énergie électrique est fournie aux véhicules moteurs sous forme de courant alternatif triphasé, par des sources extérieures. three-phase a.c. traction A traction system in which electric energy is supplied to motor vehicles from external three-phase alternating current sources. Drehstrom-Zugforderung traction a corriente (alterna) trifasica trazione (a corrente alternata) trifase draaistroomtractie trakcja prqdu (przemiennego) Gjfazowego trefasdrift Tara Ha Tpexaa3noM nepeMeHaoMToKe TUrU, B KOTOpOk CHCTCMa eAHHIIUb1 nOABII,KHOrO nepeMeHHor0 811-01-05 JJICKTpWIeCKaR COCTaBa OT 3HCprWI BHCIIIHBX IIOAaeTCFI IICTOYHHKOB Ha TIIrOBbIe TpeXaa3HOrO ToKa. traction thermoélectrique Système de traction dans lequel l’énergie fournie par des moteurs thermiques, portés par les véhicules moteurs, est transmise électriquement aux essieux moteurs. thermo-electric traction thermoelektrische Zugforderung traccitm termoeléctrica trazione termoelettrica thermo-elektrische tractie trakcja spalinowo-elektryczna termoelektrisk drift A traction svstem in which the energv bv_ nrime movers on motor -_ sunnlied _. _ vehicles is electrically transmitted to the driving axles. Tenao3aeKTprtrecKanTflra CkïCTeMa TIIrE1, ABUraT‘ZWIMA, cocraaa, 811-01-06 B KOTOpOfi 3HCprWI, YCTaHOBnCHHbIMW nepenaercn Ha BbIpa6aTbIBaCMaR TSrOBbIX TeIIJIOBbIMH CAPIHMUaX na senymue OCA3nexrpasecxnM UOABIITHOrO nyreM. traction par accumulateurs électriques Système de traction dans lequel l’énergie est fournie par des accumulateurs électriques portés par le véhicule moteur ou une remorque. hattery-electric traction A traction system in which the energy is supplied by electric batteries carried on the motor vehicle or a trailer. Batterieelektrische-Zugfijrderung traction por acumuladores eléctricos trazione ad accumulatori accumulatorentractie trakcja akumulatorowa elektryczna elhatteridrift aKKyMynflToptian3aeKTpnrecKafl Tflra CHCTeMa TRI-II, aKKyM,‘,,SITOpaMM, IIOABkiwtHOrO 811-01-07 B KOTOpOii 3HCprkiH yCTaHOBi”eHHblMH BbIpa6aTbIBaCTCR Ha TRrOBOii 3JICKTpWlCCKlïMl4 H.JIH IIpUUCIIHOii CAHHI4Ue COCTaBa. traction par énergie cinétique accumulée Système de traction dans lequel l’énergie est fournie par des volants d’inertie portés par le véhicule moteur ou une remorque. stored kinetic energy traction A traction system in which the energy is supplied by flywheels carried on the motor vehicle or a trailer. Tflra OT Energiegespeicherte Zugfcrderung traction por energia cinètica acumulada trazione ad accumula d’energia cinetica vliegwieltractie trakcja akumulacyjna kinetyczna svanghjulsdrift HaltonneHHoÏïKnHeTerecaoii 3Heprua CHCTCMa TRrPi, IIpI4 YCTaHaBAllBaCMbIMA Ha KOTOpOfi TSU-OBOk 3HeprMR WIH C03AaCTCII IIpkïUeIIHOii CAHHkiUC MaXOBWKaMA, lIOABHX(HOr0 COCTâBB. SECTION SECTION Ml-02 - TYPES DE VÉHICULES 811-02 - TYPES OF VEHICLES PA3AEJI 811-02 - BklAbI IIOABkiXHOI’O 811-02-01 matériel roulant Ensemble des véhicules, motorisés ou non. rolling stock A general term covering a11vehicles with or without motors. COCTABA Fahrzeugpark material rodante materiale rotabile rollend materieel tabor fordonspark ; rullande materiel 50(811) 0 811-02-01 -3- IEC llO,l(BEUiWOiiCOCTBB OGJJJEG TepMHH, C ABlWaTWIRMH 811-02-02 paCnpOCTpaHBBXIWïtiCSI Ha 6e3 HHX. BCe BAAbI nOABuXHOr0 COCTaBa Anli véhicule Terme général servant à désigner tout élément de matériel roulant, par ex. une locomotive, une voiture ou un wagon. vehicle A general term denoting any single item of rolling stock, e.g. a locomotive, coach or a wagon. a Fahrzeug vehiculo veicolo voertuig pojazd fordon eAuHuua noanrnxeoro cocTana 0611~ati 811-02-03 o6o3HasaromBti TePMYIH, HaIIpHMep, JIOKOMOTAB, n~o6oCi A3 BYIAOBIIOABWKHOrOCOCTaBa, IIaCCaxKMpCKP%ti An%4 TPy30BOti BaI-OH. véhicule moteur engin moteur (déconseillé) Terme général servant à désigner moteurs de traction. tout véhicule équipé d’un ou plusieurs motor vehicle Triebfahrzeug vehiculo motor veicolo motore krachtvoertuig pojazd siluikowy ; ciqgnik dragfordon A general term denoting any vehicle fitted with one or more traction motors. Tflroaafl ennfi8ua no~nlcxnoro cocTaaa 06~~ti TepMBH, 06osHa~atomBti CHa6XSHHyFO 811-02-04 OnHAM n1o6y10 EinH HeCKOnbKHMH emïHHUy TRrOBbIMU nOABHxHOr0 COCTaBa, ABuraTeABMB. unité motrice Terme général servant à désigner élément automoteur. une locomotive, une automotrice ou un traction unit A general term denoting a locomotive, motor-coach or train-unit. Triebfahrzeugeinheit unidad motriz mezzo di trazione krachtvoertuigeenheid zespti trakcyjny dragfordonsenhet TRTOBBB‘?ABHUUB 06u~ïil TePMI?H, MOTOpBarOHHyIO 811-02-05 o6o3HasamwMfi nOKOMOTI?B, MOTOPHblti BaI-OH WIM CeKUIIIO. parc moteur Ensemble des unités motrices d’un réseau de chemin de fer ou d’une autre administration. traction fleet A general term covering a11the traction units belonging to a particular railway or other administration. Triebfahrzeugpark parque motor parco (dei mezzi) di trazione krachtvoertuigpark park pojazdow silnikowych dragfordonspark JlOKOMOTABHbIfi IlapK 061uGi TepMnH, o603HaBaromuii npuHaAne~amnx 0TAenbHoii meneseoti Aoporn. 811-02-06 COBOKynHOCTb TIITOBbIX Aopore un31 ynpaaneamo enaH~u, xene3Hoü locomotive Véhicule moteur, non incorporé dans un élément automoteur et ne portant aucune charge utile, destiné à remorquer ou pousser d’autres véhicules. locomotive A motor vehicle intended to move other vehicles and not carrying a payload nor forming part of a train-unit. JIOKOMOTIIB Tsrosan eABHHua, npeAHa3naBenHaR nna COCTaBa, He kïcnonb3yeMas IIOABIi)KHOl’O OIIJIa9PiBaeMbIX I’Py30B BoXAeHBB Apyrex eAnHu4 Ha Heu AAB nepeBo3xu H He RBJISIEOILtaIICII YaCTbIO MOTOpBarOHHOfi CeKUIIiI. Lokomotive locomotora locomotiva locomotief lokomotywa lok(omotiv) 50(811) 0 CE1 811-02-07 Elektrischer Triebwagen automotrice Véhicule moteur ferroviaire, charge utile. généralement électrique, portant lui-même une motor coach motor car automotor automotrice (se elettrica) ; elettromotrice motorriituig wagon &nikowy (wagon samojezdny) motorvagn A railway motor vehicle, generally electric, itself carrying a payload. MOTOPHMÜ Bat-OH TIIrOBaR XenesHonopoHcHa~ IIpeHMyIUeCTBeHHO 0nnawBaeMbIx 811-02-08 IIOABIIXHOrO ewiHma kicnonb3yeMarr JneKTpIWeCKaX, mn COCTaBa, nepeeosaa Ha Heii rpy30B. Gepiicktriebwagen furgon automotor automotrice-bagagliaio motorrijtuig voor het vervoer van goederen wagon silnikowy bagaiowy resgodsmotorvagn fourgon automoteur Automotrice spécialisée pour le transport des colis ou des bagages. motor luggage van motor baggage car (USA) A motor coach specially tïtted for the conveyance baggage. of parcels and luggage or 6aRlîKHbIir MOTOPHbIii BaTOH MOTOpHbIk Knann 811-02-09 BarOH, ClIeullanbHO lIpeAHa3HaWHHbIti AJIR IICpeBO3KH PyYHOfi 6araHta. Mm élément automoteur Triebwagenzugeinheit Groupe de véhicules comportant au moins un véhicule moteur et constituant le plus petit ensemble autonome, indivisible en service, d’un train à unités multiples. unfdad motofa un’ta d1 trazrone treinstel zesp% pociqgowy trakcyjny motorvagnssatt (motor) train-unit A group of vehicles including at least one motor vehicle and forming the smallest self-contained unit, indivisible in service, of a multiple-unit train. MOTOpBaI-OHHafl CeKUWR rpynUaCA~H~UnOABe~HOr0 TRrOBZiI eAI%HIIUa aBTOHOMHyH) 811-02-10 COCTaBa,aBHCKOTOPbIXCAy9a~XTOJIbKO IIOABBXHOI'O HeAenHMym COCTaBâ, B 3KCnJyaTaUm COCTaBnFIEOLUaR UOe3AHym OAHa HaRMeHbILIyKl eAnHMUy. Beiwagen remolque rimorchio aanhangrijtuig wagon doczepny 16pvagn ; slapvagn remorque Véhicule non motorisé incorporé dans un élément automoteur. trailer A vehicle without motors, forming part of a train unit. npeueneoü BaroH COCTaBJISWXUaX 811-02-11 COCTaBa, IIOABkiXHOl-0 EAHHeUa YaCTb He MOTOpBarOHHOfi 060pyAOBaHHaR ABHraTeJmMki, CeKUHH. Triebfahrzeug ohne Fiihrerraum vehiculo motor sin cabina de conduccion automotrice Ise elettrical senza cabina di guida ; ele‘ttromotricesenza cabina di guida krachtvoertuig zonder bestuurderscabine wagon silnikowy niesterowniczy ..... motrice sans cabine de conduite Véhicule moteur ne possédant pas de cabine de conduite. non-driving motor vehicle A motor vehicle without a drivers cab. npauenaafl Tflroaane~nHwua no~enm~orococ~aaa 'h-osaff eAEIHMUa ynpaaneeun. I'IO~BPiXHOrO COCTaBa, He 060pyAOBaHHaR Ka6IIHOk 50(811) 0 811-02-12 IEC -5train à unités multiples rame automotrice réversible Train comportant un ou plusieurs éléments automoteurs pouvant être commandés simultanément d’une même cabine de conduite et pouvant circuler, sans modification de la composition, dans les deux sens de marche, à vitesse normale. mehrfachgekuppelte Triebwagenzugeinheit tren de unidades mtiltiples ; composiciLm automotriz reversible treno automotore (a comando multiplo) trein met aan beide einden een stuurstand pociqg z zespdow nawrotnych motorvagnstag multiple unit train (reversible) motorcoach train A train comprising one or more train units which cari be controlled simultaneously from one cab and able to operate at normal speed in either direction without re-marshalling. noe3n, ynpasnseMblü no CucTeMeMuorux e.4uuuu MOTOPBBrOHHbIii BO‘23a (WHOYHOI-0 JIBBXEBBBR) nOes& HeCKOJIbKIIX COCTORmllii 113 OAHOfi HJIH KOTOpbIilMOxeTynpaB~5lTbCHO~HOBpeMeHHO cnoco6eH ABEIraTbCH nepecocTaBneHmI 811-02-13 C 3anaHHOii MOTOpBarOHHbIX- CeKUHti, H3OAHOtiKa6IIHbIHKOTOpbIti CKOpOCTbIO 06013x B HanpaBneHHBX 6e3 noesna. rame articulée Gelenktriebwagen Groupe de véhicules dans lequel les extrémités adjacentes consécutifs sont portées par un bogie commun. de deux véhicules articulated unit A group of vehicles in which the adjacent carried on a common bogie. rpynna eAllHIIU 811-02-14 eAumiu nonaknxnoro nOABBxHOr0 coc-raaa, COCTaBa HaXOAaTCa ends of adjoining B KOTOPO~~ Ha o6meii vehicles comeHeHm are unidad articu’ada automotrice (se elettrica) articolata ; elettromotrice articolata gelede trein- of tramstel pociqg zespofowy przegubowy boggiledat tagsatt CMexHbIx TeJIexKe. voiture-pilote remoraue à cabine de conduite Steuerwagen remolaue con cabina Voiture ou remorque comportant une cabine ou un poste permettant la rimorchio pilota conduite d’un train poussé ou de l’élément automoteur dont elle fait partie. aanhangrijtuig met stuurstand wagon sterowniczy mautivervagn driving trailer control trailer A trailer provided with a driver’s cab from which it is possible to drive the train-unit or push-pull train of which the trailer forms part. npuuenuofi aarou c Ka6naofi ynpanaeean (npnuenuoii) BaroH ynpaeseusn rIpwenaoi% BarOH, 06OpyAOBaHHbIti Ka6PiHOii ynpaBneHnn, no3BonaIowiU ynpaB~BTb~B~xeH~eMMOTOpBarOHHOiiCeKU~~Im~nOe3Aa,cOBepmaIom~ro Ye.,IHO9HOe 811-02-15 ABIIxeHAe,YaCTbIO KOTOpOrO OH IIBJIReTCII. Triebwagen (im iibertragenen motrice Véhicule moteur incorporé moteur thermique. Note. - En tramways. français,ce dans un élément terme désigne aussi une automoteur électrique automotrice dans ou à ‘Oche motor motrice (anche tranviaria) motorrijtuig ; motorwagen le cas des w~z sllulku~ ; wagon sllnikuw ..... power car A term applied to the motor vehicles of some types of diesel or electric train unit. Note. - In French, the term “motrice” is also used to designate the motor car on a tramway system. MOTOPHbIé Bal-OH TepMHH, pa3JIWiHbIX OTHOC~IUH~CII TllnOB ZZpm4eraffyre. 0603HWieHIiR K TFirOBbIM AYrJeJIbHbIX QpaHUy3cKG TpaMBatiHOrO eA&iHlSUaM II 3JIeKTpIJ'SeCKPïX TepM5iH MOTOpHOr0 "motrice'> BarOHa. nOABHXHOr0 MOTOpBal-OHHbIX wznonb3yeTcrr COCTaBa CeKIWti. TaKxe nna Sinne) 50(811) 0 CE1 811-02-16 train poussé train réversible Train comportant le plus souvent une locomotive à l’une des extrémités et une voiture pilote à l’autre et pouvant circuler dans les deux sens, a vitesse normale et sans modification de la composition. Wendezug tren reversible treno navetta ; treno reversibile trekduwtre’n pociqg nawrotny pusb-pulltag push-pull train A train generally having a locomotive at one end and a driving trailer at the other, able to operate at norma1 speed in either direction without re-marshalling. noesn, cosepmatomeii ueaeoreoe nOes& B KOTOpOM COCTaBa, a IIpHUeIIHOfi cnoco6ea ABBxeHAe KaK C 3aAaHHOfi HaXOAATCR IIpaBMnO, BaI-OH C Ka6HHOü ,L,BMi-aTbCII nepecocrasnennn 811-02-17 JIOKOMOTIIB, yIIpaBneHkiH CKOpOCTbK) B B OAHOM - Ha ApyI’OM 06onx KOHUe II KOTOpbIk, HaIIpaBJIeHPiRX 6e3 noesna. Rangierlokomotive locomotora de maniobras locomotiva di manovra rangeerlocomotief lokomotywa manewrowa viixellok locomotive de manoeuvre Locomotive spécialisée pour le service de manoeuvre. shunting locomotive A locomotive designed for shunting service. MaHCJBpOBbllïJlOKOMOTElB nOKOMOTIIB, 811-02-18 IIpeAHa3Ha4eHHbIfl AJISI MaHeBpOBbIX pa6o-r. Abdriicklokomotive locomotive de butte Locomotive de manoeuvre destinée au mouvement gare de triage. de trains sur la butte d’une hump locomotive A shunting locomotive shunting yard. locomotora para “asificar locomotiva di spinta per selle di lancio heuvellocomotief lokomotywa rozrzqdowa lok for vallv%xling designed to propel trains over the hump in a hump ,-O,,O’,HbIii JIOKOMOTUB MaHeBpOBbIii BaroHon 811-02-19 JIOKOMOTBB, 9epe3 ropKy IIpenHa3HaYeHHbIfi AJISI IIepenBWKeHWI COCTBBOB naplte. B CO~TH~OBOYH~M Industrielokomotive locomotive industrielle Locomotive utilisée sur une voie privée (embranchement, voie d’usine, etc.) et locomotora i”dustria’ locomotiva (per servizio) industriale ne comportant pas nécessairement tous les organes de sécurité des locomotiindustrielocomotief ves de grands réseaux. lokomotywa przemyslowa industrilok industrial locomotive A locomotive used on a private siding (factory siding, etc.) and not necessarily having a11the safety devices provided on main-line locomotives. llpOMbllUJleHHbIü JIOKOMOTBB flOKOMOTHB, 811-02-20 IIpPIMeHReMbIfl Ha OTAenbHbIX HeO6R3aTeJIHO 06OpynOBaHHbIfi ~10K01d0TkiB0~ yCTpOlkTBaMA BCeMI4 r‘yTSTX (IIpOMbIUIneHHbIX HeO6XOLViMbIMPi JVls M TJI.) EI MarHCTpaJIbHbIX 6e30IIaCHOCTH. locotracteur locomoteur Véhicule moteur de faible puissance destiné à exécuter des manoeuvres de peu d’importance ou à remorquer ou pousser des trains de petit tonnage. small-power locomotive A motor vehicle of low output intended for minor shunting operations moving light trains. or for MOTOBOS Tm-osaa eJ&iaaua rIpenHa3HaYaeMaR IUIA AJIR BOH(AeHIIR IIOABlGKHOrO ,ilJISI lIpOPi3BOJWTBa rIOe3,qOB Manoro COCTâBB He6OJIbUIHX neca. Manol MaHeBpOBblX MOIUHOCTH, OI’IepaUHii Kleinlokomotive locomotora de pequeiia potencia ; locotractor locotrattore locomotor lokomotywa manewrowa lokomotor 50(811) 0 811-02-21 IEC -7locomotive de mine Grubenlokomotive Locomotive employée dans des galeries de mines ou dans des installations fond. du mine locomotive A locomotive used in mine galleries or in underground ‘ocomotora de mina locomotiva di miniera mijnlocomotief lokomotywa kopalniana gruvlok installations. PY~HUYHbIÏi JlOIEOMOTliB j-lOKOMOTI?B, npHMeH5IeMbIti Ha pyAHW,HbIX IIyTFIX PL"I4 B IIOA3eMHbIX coopy?KeHHsx. 811-02-22 locomotive de halage tracteur de halage Treidellokomotive tractor para sirga Véhicule moteur destiné au halage des péniches et des bateaux sur les canaux. Locomotiva di “aggio sleeptractor lokomotywa holownicza : ciagnik holowniczy ..... barge tractor A motor vehicle intended for hauling ships or barges on canais. 6yKCllpHblt-i JIOKOMOTIIB Tm-osax C~AOB 811-02-23 eAI4HFïIIa IUIH 6apxc no~BI0KHoro BnOJIb COCTaBa, IIpeAHa3HaYeHHaff AJIH BOxneHFiII KaHaJIOB. véhicule moteur double Doppeltriebfahrzeug Unité motrice composée aucun fonctionnerisolémenten ne peut de 2 véhicules moteurs service attelés ensemble et dont normal. twin motor vehicle A traction unit made up of two motor vehicles coupled together, which cari run separately in normal service. cunoeuuanruronan THroean MexAy eLUïH&Iua co6ol 3KCIIJIyaTauHH 811-02-24 vebicu’o motor dob’e mezzo di trazione doppio dubbel krachtvoertuig pojazd silnikowy ukrotniony podwojny dubbellok no one of euunuua nounuuînorococraaa IIOABAX(HOr0 TRrOBbIX He MOEeT COCTaBa, eAllHIIu, COCTOIImaR HI4 OnHa pa60TaTb 113 AByX 113 KOTOpbIX IIpI4 CueIIJIeHHblX HOpMaJIbHOfi OTAe,IbHO. Dreifachtriebfahrzeug véhicule moteur triple Unité motrice composée de 3 véhicules moteurs attelés ensemble aucun ne peut fonctionner isolément en service normal. et dont triple motor vehicle vehicu’o motor We mezzo di trazione triplo drievoudig krachtvoertuig pojazd silnikowy ukrotniony potrojny trippellok A traction unit made up of three motor vehicles coupled together, no one of which cari run separately in normal service. CTpO‘ZHHaS,Tfl,-OBBB eAlcH,U,a llO,L(BUXHOrO COCTaBa Tnroearr MexAy enMHRua co6oH 3KCnJIyaTaukIa 811-02-25 nOABAaHOr0 TflrOBbIX He MOTeT COCTaBa, enAH&iu, HI, pa60TaTb COCTOIIUIPR OnHa W3 TpeX 113 KOTOpbIX IIpH CueIIJIeHHbIX HOpMaJIbHOii OTAeJIbHO. véhicule moteur à courant continu Véhicule moteur dont l’alimentation extérieure à courant continu. électrique est fournie par une source d.c. motor vehicle A motor vehicle to which electric power is supplied from an external source of direct current. rnronan eununua no~eaxuorococrasa Tsrosan ~OCTO~HHOI-OTOK~ enriukrua nonsnw(nor0 coc-raaa, nkrramfe OT BHeIIIHerO ACTOYHAKa IIOCTORHHOrO TOKa. KOTOPO~~ 0cymecTnnffeTcff Gleichstromtriebfahrzeug vehiculo motor de corriente continua mezzo di trazione a corrente continua gelijkstroom krachtvoertuig pojazd (silnikowy) pradu stalego likstrijmsfordon 50(811) 0 CE1 811-02-26 véhicule moteur monophasé Véhicule moteur dont l’alimentation électrique extérieure à courant alternatif monophasé. est fournie par une source single-phase a.c. motor vehicle A motor vehicle to which electric power is supplied of single-phase alternating current. from an external source raronaa eflunuua nounaatuoro cocraaa ouuo~a3noro Tsroeas eAr?HFfUa OT BH’ZIIIHWO 811-02-27 IIOABA~HOrO MCTOYHAKa COCTaBa, OAHO@aSHOrO IIllTaHIlC nepeMeunor0 roua KOTOPOfi IICjYJCMCHHOrO Einphasen-Wechselstromtriebfahrzeug vehiculo motor monofasico mezzo di trazione monofase eenfasekrachtvoertnig pojazd (silnikowy) prqdu jednofazowego enfasfordon OCyIIICCTBLWZTCFI TOKa. Drehstromtriebfahrzeug véhicule moteur triphasé Véhicule moteur dont l’alimentation électrique extérieure à courant alternatif triphasé. est fournie par une source three-phase a.c. motor vehicle A motor vehicle to which electric power is supplied from an external source of three-phase alternating current. vehicu’o motor trifasico mezzo di trazione trifase draaistroomkrachtvoertuie pojazd (silnikowy) prqdu &ojfazowego trefasfordon rnroaaa euuuuua no,unuutuoro cocrana rpex<pa3noro nepeMenuor0 roua ‘fin-osaa CAPiHPïUa IIOABHTHOrO COCTaBa, IIkiTaHIlC KOTOPOti OT nueumero ncroukinxa -rpex@asuoro nepeMennor0 roxa. 811-02-28 OCyIIlCCTBiWl’ZTCR véhicule moteur bi-tension Zweispannungstriebfahrzeug Véhicule moteur dont l’alimentation électrique peut être fournie par l’une ou l’autre de deux sources extérieures de même nature de courant et de même fréquence mais ayant des tensions de valeurs différentes. vehicu’o motor bitension mezzo di trazione bitensione krachtvoertuig voor twee spanningssystemen pojazd (silnikowy) na dwa napigcia tvt%pGtningsfordon dual voltage motor vehicle A motor vehicle to which electric power may be supplied by one or other of two external sources of the same current type and frequency but of different voltages. rflronafl e~eenua nouanatuoro cocrana na Aaa nanpfl~euna Tsrosaa BAEïHAUa COCTaBa, IIOABAXHOTO IIATaHlle KOTOPOti OCyIIICCTB~RCTCII OTO~HOrO113AByXBHCUIHHXACTOYHIIKOBTOKaO~HOrO~O~a~OAHO~ me 811-02-29 YaCTOTbI, HO pa3HbIX HTOii HaIIpZWKeHAii. véhicule moteur bi-fréquence Zweifrequenztriebfahrzeug Véhicule moteur dont l’alimentation électrique peut être fournie par l’une ou l’autre de deux sources extérieures à courant alternatif de fréquences différentes. vehicu’o motor bifrecuencia mezzo di trazione bifrequenza krachtvoertuig voor twee frequenties pojazd (silnikowy) na dwie czqstotliwosci tvafrekvensfordon dual frequency motor vehicle A motor vehicle to which electric power may be supplied by one or other of two external sources of alternating current of different frequencies. TRrOBBII BAtlHBI@ IlOflBIlXHOI-0 COCTilBa ,LlBOiiHOiiYBCTOTbI Tarosari CAPïHkïqa OCyl!J’ZCTBJGITbCII TOKa 811-02-30 OT C pa3JIMYHbIMM I,OABIiH(HOrO ODHOTO COCTaBa, 113 nayx IIHTaHH’Z BHCIIIHIIX KOTOPOï4 ACTOYHHK~B MOXET nepeMennor0 YaCTOTaMII. véhicule moteur bi-courant Zweisystemtriebfahrzeug Véhicule moteur dont l’alimentation électrique peut être fournie par l’une ou l’autre de deux sources extérieures à courants de natures différentes. vehiculo motor bicorriente mezzo di trazione bicorrente krachtvoertuig voor twee voedingssystemen pojazd (silnikowy) dwusystemowy tvasystemsfordon dual system motor vehicle A motor vehicle to which electric power may be supplied by one or other of two external sources of different current types. rflronaa e~uunua nounnucnoro cocrana na uaa pofla roua TmoBan CAIIHIIIJa OCy~‘SCTBnRTCH TOKa. IIOABW’XHOrO OT OAHOTO A3 AByX COCTaBa, BHCUIHIIX IIATaHlle IICTOYHIIKOB KOTOpOti pa3JIWiHbIX MOLCT POJlOB 50(811) 0 811-02-31 IEC -9véhicule moteur polycourant Mehrsystemtriebfahrzeug Véhicule moteur dont l’alimentation électrique peut être fournie par plus de vehiculo motor policorriente mezzo di trazione policorrente deux sources extérieures de différentes natures de courant et différentes krachtvoertuig voor meer dan één tensions ou fréquences, dont n’importe laquelle peut être sélectionnée. voedingssysteem pojazd (silnikowy) wielosystemowy multi-system motor vehicle flersystemsfordon A motor vehicle to which electric power may be supplied from more than two external sources of different current type, voltage or frequency, any one of which may be selected. TRrOBaaeut,HUua nOABtWtHOr0 COCTaBa Ha HeCKOJtbKO CNCTeM TOKa Tsroeaa IIOABHH(HOr0 OT pa3JIIVfHOrO TOKa,Hanp5DKeHHR BbI6paH 811-02-32 eAHHI4Ila OCyIUeCTBnSITbCfl pOAa mITaHue COCTaBa, HeCKOJIbKHX (60nee ~o~opoir AByX) BHeIIIHAX N YaCTOTbI,A3 KOTOpMX MOxeT HCTOYHPIKOB MO)KeT 6bITb nro6oi. véhicule moteur diesel-électrique Véhicule moteur dont la puissance de traction est fournie par un moteur diesel et une génératrice de courant continu ou un alternateur, portés par le véhicule. diesel-electric motor vehicle A motor vehicle obtaining traction power from a diesel engine generator or alternator carried on the vehicle. Al43eJlb - Trri-osas 3nercTprrrecltartTflronaa euNHt4uanOABHXtHOr0 COCTBBB ennanua co3AaeTczJ nonamxnoro AH3enb-reHepaTopoM YCTaHOBJIeHHbIM 811-02-33 and d.c. cocraaa, TIIrOBaB nOCTOBHHOr0 Ha eAHHI4Ue nOABWKHOr0 MOIIIHOCTb AJIH KOTOPOii nepeMeHHor0 TOKa, COCTaBa. Turbinentriebfahrzeug vehiculo motor a turbina (transmision Véhicule moteur dont la puissance de traction est fournie par une turbine et eléctrica) une génératrice de courant continu ou un alternateur, portés par le véhicule. mezzo di trazione a turbina (a trasmissione véhicule moteur à turbine (à transmission électrique) elettrica) turbine motor vehicle (electric transmission) A motor vehicle obtaining traction power from a turbine and d.c. generator or alternator carried on the vehicle. ~~~60~03 (c Tm-osaa eAIIHAUa co3AaeTcx 3neKTpwIecKoti turbine-elektrisch-krachtvoertuig pojazd turbinowy turboelektriskt fordon nepeAa9eü) nOABWKHOr0 ~yp6~I~oti yCTaHOBAeHHblMI4 811-02-34 Dieselelektrisches Triebfahrzeug vehiculo motor diesel-eléctrico mezzo di trazione diesel elettrico diesel-elektrisch krachtvoertuig pojazd (silnikowy) spalinowo-elektryczny dieselelektriskt fordon COCTaBa, Id reHepaTopoM Ha eAI4HPIIJe TRrOBaSI nocToffHIfor0 nOABPIX(HOr0 MOIIIHOCTb KOTOpOti IIJI~ nepeMewor0 ToKa, COCTaBa. véhicule moteur à crémaillère Véhicule moteur dont l’effort de traction est transmis en tout ou partie à un engrenage prenant appui sur une crémaillère installée entre les rails. rack motor vehicle A motor vehicle on which all or part of the tractive effort is transferred means of gearing to a rack fitted between the rails. by Zahnradtriebfahrzeug vehicuLo motor cremalLera mezzo di trazione a cremagliera tandradkrachtvoertuig pojazd o napedzie zebatkowym kuggstangsfordon Tm-onau eArtHmtanouaameoro cocTana ,unn sy6uaToü XenesHoiï nopora Trrrosan ero 4acTb eAAHH~anOABHTHOrOCOCTaBa,BKOTOpOti yCTaHOBJIeHHyI0 811-02-35 BCeTRrOBOeyCIUIHeH~H nepenaercrr nocpencreok4 sy6Yaroü nepenarn MexAy na sy6raryro peiky, peJIbCaMIL locomotive à essieux accouplés Locomotive dont certains essieux sont accouplés mécaniquement en un ou plusieurs groupes. en rotation, coupled-axle locomotive A locomotive in which certain axles are coupled motion, in one or more groups. mechanically, in rotary JlOKOMOTUB COCnapeHHblMU OCRMH .J~~KOMOTI~B, OnpeAeJIeHHbIX B KOTOpOM OCeii B OAHy npeAycMoTpeH0 HJIII HeCKOnbKO MexaHwIecKoe rpynn. CnapHBaHkIe Lokomotive mit gekuppelten Radsiitzen locomotora de ejes acoPlados locomotiva ad assi accoppiati locomotief met gekoppelde asaandrijving lokomotywa o osiach sprzeionych (mechanicznie) lok med kopplade axlar 811-02-36 50(811) 0 CE1 lO- locomotive à essieux indépendants Locomotive rotation. dont les essieux moteurs ne sont pas liés mécaniquement individual axle drive locomotive A locomotive in which the driving axles are not mechanically rotary motion. Lokomotive mit Einzelradsatzantrieb locomotora de ejes independientes locomotiva ad assi indipendenti locomotief met afzonderlijke asaandrijving lokomotywa o osiach napqdzanych indywidualnie in enkelaxeldrivet lok en coupled JIOKOMOTUBC UHjJ‘IBU~yaJIbHbIM npUBOnOM OCek JI~KOM~THB, ABWKYIWX 811-02-37 B ae npenycMorpen0 K~T~POM Mexanmfecxoe cnapasanne OCeti. Magnetschwebefahrzeug vehiculo de sustentacion magnética veicolo a sospensione e guida (elettro) magnetica magneetkussenvoertuig pojazd o zawieszeniu magnetycznym maglev véhicule à sustentation et guidage (électro)magnétiques Véhicule qui, en service normal, ne circule pas sur des roues, mais est supporté et guidé par des forces magnétiques. magnetically supported vehicle maglev A vehicle which, in normal service, does not roll on wheels, but is supported and guided by magnetic forces. e~&UIU~a IIOABUXHOI-0 COCTBBBC MBrHUTHbIM nOABeCOM ~A~H~~anOABa~HOrOCOCTaBa,KOTOpannp~3KCnnyaTauu~AB~~eTCsHenO nonnepHcnsaerca penbcaM,a 811-02-38 II HanpaBnReTcs MarHHTHbIMI4 cHnaMI4. Luftkissenfahrzeug vehiculo de sustentation neumatica veicolo a cuscina d’aria Véhicule qui, en service normal, ne circule pas sur des roues, mais est supporté et guidé par des coussins d’air comprimé, à basse pression, produit sur le luchtkussenvoertuig pojazd na poduszce powietrznej véhicule. luftkuddefordon ; svavare véhicule à coussin d’air véhicule à sustentation et guidage pneumatiques air-cushion vehicle A vehicle which, in normal service, does not roll on wheels, but is supported and guided by streams of low pressure compressed air produced on the vehicle. eAunuua no~numuoro cocrasa na no3~yImoti nonyume ~A~H~~a~OAB~~HOrOCOCTaBa,KOTOpa~~p~3KC~~~aTa~~~AB~~eTC~He~o penbcaM, Hkl3KOrO 811-02-39 a noAAepmnsaeTc5I M HanpannneTcrr AaBneHYlR,CO3AaBaeMbIM Ha eAAHHUe noToKoh4 caaTor0 IIOABIGKHOrO Bo3Ayxa COcTaBa. véhicule à volant d’inertie Véhicule qui utilise pour sa propulsion d’inertie. l’énergie emmagasinée par un volanl inertia storage vehicle (by a flywheel) Schwungradfahrzeug vehiculo de volante de inercia veicolo (con propulsione) a volano vliegwielvoertuig pojazd z k&em zamachowym sv%ngdjulsdrivetfordon A vehicle using the energy stored in a flywheel for its propulsion. rupo6yc EAHHHna IIOABiUKHOrO COCTaBa, WeTJHeprH~,HaKOIIneHHOI-d 811-02-40 ABlGKeHHe KOTOpOrO OCyIIIecTBnReTcR 38 B MaXOBHKaX. électrobus Véhicule moteur sur route dont l’énergie motrice est fournie par une batterie portée à bord du véhicule. battery-electric road vehicle An electrically powered road vehicle to which the energy is supplied from a battery carried on the vehicle. sneKTpo6yc EAHH&sua 6e3penbCOBOrO KoTopaR pa60TaeT OOABIGKHOrO COCTaBa. llOABHTHOr0 OT aKKyMYnflTOpOB, COCTaBa C JneKTpWIeCKOfi YCTaHOBneHHbIX Ha Tnroti, eAUHIIUe Batterieelektrischer Bus electrobus veicolo (stradale) ad accumulatori accumulatorwegvoertuig samochod akumulatorowy batteridrivet vtigfordon 50(811) 0 811-02-41 - IEC 11 - tramway (électrique) (véhicule) StraBenbahntriebwagen Véhicule moteur circulant, seul ou avec des remorques, sur des voies dont les tranvia (vehiculo) tram 0 veicolo tranviario rails sont souvent implantés dans la chaussée publique. (elektrische) tram tramwaj (electric) tramcar sparvagn street-car (USA) A motor vehicle running alone or with trailers on tracks of which the rails are often embedded in the public highway. WleKTpUWCKilii TpaMBaÏi (eAUHUUa Trrrosaa HUX, eAUHUIla npenna3naraeMas 064eCTBeHHOrO 811-02-42 noABUwcHor0 IIOABIGKHOrO COCTaBa c ABkixeHUR nna COCTaBa) npUuenHbIMU II0 BarOHaM penbcaM mm Ha 6e3 Aoporax IIOnb30BaHUR. tramway (électrique) de (mode Stragenbahn transport) Mode de transport utilisant des véhicules moteurs circulant sur des rails implantés dans la chaussée ou sur une plateforme indépendante. (electric) tramway A transport system using motor vehicles running on rails embedded public highway or on an independent route. in the tranvia (modo de transporte) sistema tranviario ; tranvia (elektrische) tramweg komunikacja tramwajowa D .. sparvag (3JltWTpU’leClCUi-f)TpaMBk-4 CUCTeMa TpaHCIIOpTa COCTaBa, npeAHa3HaqaeMaa 06meCTBeHHOrO 811-02-43 C UCIIOnb3OBaHUeM nna IlOnb30BaHUR TRrOBbIX nBUxeHU2 no MJIA UMeIOmaS eAUHUU penbcaM OTAenbHbIti IIOABWKHOrO Ha Aoporax MapIIIpyT. trolleybus Obus 1. Véhicule moteur sur pneus circulant sans rails sur la voie publique, seul ou tro’ebus avec une remorque, et auquel l’énergie électrique est fournie par une ligne de filobus ; sistema filoviario ; filovia trolleybus contact aérienne. trolejbus 2. Mode de transport utilisant des trolleybus. tradbuss trolleybus 1. An electrically driven pneumatic-tyred vehicle running without rails on public roads, alone or with a trailer, and drawing its power from an overhead contact line. 2. A transport system using trolleybuses. rpoaaeti6yc 1. EAUHUUa 6e3penbcoBoro FIHeBMaTAYeCKHMM pa6oraroman IIOABUmHOrO IIIUHaMU, OT C KOHTaKTHOfi COCTaBa npUuenHbIM CeTU Ha C 3neKTpWIeCKOii TarOti 6e3 BarOHOM UJIU Aoporax 06meCTBeHHOrO II Hero, nOnb30BaHUa. 2. CUCTeMa 811-02-44 TpaHCIIOpTaC HCIIOJIb30BaHUeM Tponneii6ycon. cabine de conduite Partie d’un véhicule constituant un compartiment de ce véhicule ou du train. séparé, réservé à la conduite driver%cab A part of a vehicle used for driving the vehicle or train, forming a separate compartment. Fiihrerraum cabina de conducciOu cabina di guida bestuurderscabine ; stuurstand van de machinist kabina sterownicza forarhytt ua6euaynpasneenn YaCTbeAUHUUbI eAUHUueti 811-02-45 JIOABUH(HOr0 Un14 npeAcTannaIomaa COCTaBa,UCIIOnb3yeMaaAnRyIIpaBneHU~3TOii ~0601%0TAenbHoe noMemeHUe. poste de conduite Führerraum (ohne Trennwand) séparé, réservé à la Puesto de conduccion posto di guida stuurstand stanowisko sterownicze driving position forarplats A part of vehicle used for driving the vehicle or train, not in a separate compartment. Partie d’un véhicule ne constituant pas un compartiment conduite de ce véhicule ou du train. 811-02-45 50(811) 0 CE1 noce ynpaeaeena MecTo 3TOI2 811-02-46 12- Ha eAUmIne eAUHUneii noAmnKHor0 UAA CocTaBa, nOe3AOM ,nnx ynpaeneana UcnonbsyeMoe A He OTAeAeHHOe OTOCTaJIbHOii YaCTU. Hilfsfiihrerraum puesto de conduccion auxiliar posto di guida ausiliario (rangeer) hulpstuurstand kabina sterownicza dodatkowa operatijrsplats for vaxling poste de conduite auxiliaire Poste permettant la conduite en cours de manoeuvre. shunting control position A driving position for use in shunting operations. BC”OMOI-aTeJIbHbIfi “OCT yIIpaBJIeHU%I flOCTynpaBneHUU,UCnOAb3yeMbIti 811-02-47 npU npOBeAeHUI4 pa6o-r. MaHeBpOBbIX ..... Begleiterraum Emplacement d’un véhicule prévu pour l’agent responsable des commandes du chauffage, de l’éclairage et des portes, du frein d’urgence, etc. Puest de contra’ ..... conducteursruimte przedzial sterowniczy odbiorow nietrakcyjnych guard’s position betjaningsplats A part of a vehicle containing controls used by the guard e.g. heating, lighting and door controls, emergency brake, etc. “OCT KOHAYKTOpa ~ecToHaeAUHUuenOABU~HOrOCOCTaBa,rAeHaXOAUTC~~eAe3HOAopo~HbI~ orsesaromnti cny~amUii, 3aKpb,aaHUeAaepeti 38 oTonneHUe, II npUBeAeHUe SECTION 811-03 - TRAFFIC PA3,?JEJI 811-03 - OKbEM n TOpM03aUT.n. 811-03 - TRAFIC ET CHARGE SECTION 811-03-01 orkpbmanue ocaemeHUe, BAetiCTBUe3KCTpeHHOrO DES TRAINS AND TRAIN LOADS IIEPEB030IC I/i MACCA trafic Ensemble de données qui caractérisent l’importance du service assuré sur une ou plusieurs lignes, pendant une certaine période. On peut considérer soit l’importance des parcours, soit l’importance conjuguée des parcours et des charges. Note. - kilomètres Le trafic s'exprime le plus souvent ou en voyageurs-kilomètres. en trains-kilomètres, en l-IOES,!JA Verkehr trafic0 traffico verkeer ;vervoer przebieg ; praca przewozowa trafik(volym) tonnes- traffic The total data defining the amount of traffic running over one or more lines during a certain period. The distance covered or the combined distance covered and load conveyed may be taken into consideration. Nofe. -Theamountoftrafficisgenerallyexpressedintrain-miles,ton-miles, train-kilometres, tonne-kilometres or passenger-kilometres. o6aeM nepeBo3oK COBOKynHOCTb rpy30B unu AaHHbIX, naccaxoIpoB XapaKTepU3yIOmUX Ha OnpeAeJIeHHOrOnepUOAaBpeMeHU. paccrosaue unU ConoKynHocTb ZZphwe~afufe. - 06aeM O~H~M UnU KOJIUYeCTBO HecKonbKUx ysacTKax nepeBO3UMbIX B TeYeHUe B OCHOByOueHKUMOryT6bITbnOAO~eHbI npo6era a Maccbr nepeao3nMoro rpysa. nepeao30K 06bIYHO BbIpa~aeTCs B noe3Ao-KUno~eTpax,ToHHo-KUno~eTpax,nacca~Upo-KunoMeTpax. 811-03-02 trafic brut total Produit de la longueur d’un parcours par les charges brutes totales déplacées sur ce parcours, pendant une certaine période. total gross traffic The product of the length of a journey and the total gross load, including motor vehicles, run over that distance during a certain period. Gesamtbruttoverkehr trafico bruto total traffico lordo totale totaal bruto verkeer praca przewozowa calkowita brutto total bruttotrafik 50(811) 0 811-03-02 811-03-03 IEC - 13 - nonuhtu o6beM nepesosou npOH3BeneHHe ,qmiHbI BbIIIOnH5IIOLIJerO 3TOT npo6era Ha noJnIyK~ npo6er3aOnpeneneHHbId Maccy 6py~~o nepHOA noesna, BpeMeHYI. trafic brut remorqué Produit de la longueur d’un parcours par les charges brutes remorquées ce parcours, pendant une certaine période. sur gross traffic hauled The product of the length of a journey and the gross load hauled over that distance during a certain period. Bruttoverkehr trafico bruto remolcado traffico lordo rimorchiato bruto vervoer praca przewozowa pociqgowa brutto bruttotrafik exklusive dragfordon o6aeM nepeeosou noesfla IIpou3senemïe npo6era A,IAHbI Ha Maccy 6pyTTO npuuenabrx eAHHkïII no~e~mHorococTasa,nepe~e~aeMbIxHa3~opaccTo~H~e3aonpe~ene~HbIii nep&IOn 811-03-04 BpeMeHEf. trafic utile Produit de la longueur d’un parcours par les charges utiles transportées ce parcours, pendant une certaine période. sur net traffic The product of the length of a journey and the payload conveyed distance during a certain period. over that Nettoverkehr trafic0 net0 traffico netto netto verkeer ; nuttig verkeer praca przewozowa netto nettotrafik none3KbrÏi o6%eM nepesosou IIpousaeneaue nepeivfemaebroro 811-03-05 npo6era na none3ayro h4accy (nerro) noesna, na 3ro paccroaaae 3a onpeneneaabrfi nepnon speMemi. Anmibr charge utile (d’un train) Masse totale des chargements (voyageurs, bagages et marchandises) du train. payload (of a train) The total mass of the passengers, luggage and goods in the train. none3Kafl Macca(noesga) Macca naccaxorpon, 811-03-06 Garaxa II rpy3a Nutzlast (eines Zuges) carga util (de un tren) carico utile (di un treno) ; massa netta (di un treno) nuttige treinbelading fadunek (handlowy) pociqgu nyttoiast B noesne. charge normale (d’un élément automoteur) Masse totale spécifiée de voyageurs et de bagages qu’un élément automoteur doit pouvoir porter en service normal. normal load (of a train unit) The specilïed total mass of passengers and luggage, on which the performance of the train unit in normal service is based. Normallast (einer Zugeinheit) carga normal (de una unidad motora) carico normale (di un’unità di trazione) normale treinbelading ladunek nominalny (zespofu trakcyjnego) normallast HopManbHaK Macca (nan MOTOPBWOHHOk ceKumi) Macca naccaxinpoa CeKl.viR 811-03-07 npH II Garawta, na HOpManbHOii ~0T0pym paccsnrana h4oropsarokmas 3KcnnyaTaumi. charge exceptionnelle (d’un élément automoteur) Masse maximale de voyageurs et de bagages qu’un élément automoteur peut porter en toute sécurité. La charge exceptionnelle peut s’accompagner d’une réduction des performances. crush load (of a train unit) The maximum mass of passengers and luggage which cari be safely accommodated in the train unit. It may reduce the performance. KpKTH'leCKafl MaCCa(nJlK MOTOpBa~OHHOti CeKuKK) Han6onbmas 6bITb AOnyCTHMaSI nepeBeseHb1 KpIITWIeCKOii XapaKTepPïCTHK. MaCCbI 6e3 naCCaXmpOB Macca pHCKa MOlKeT B II Garaxa, MOTOpBarOHHOti npI4BeCTH K yXyAlIIeHHI0 KOTOpbIe CeKUHH. MOryT npeBbIIIIeHHe 3KCnJIyaTa9UOHHbIX Uberlast (einer Zugeinheit) carga excepcional (de una unidad motora) carico massimo (di un’unità di trazione) maximale treinbelading hdunek maksymalny (zespoht trakcyjnego) maxlast 811-03-08 14- 50(811) 0 CE1 charge (brute) remorquée charge d’un train Masse de l’ensemble des véhicules remorqués (Brutto) Anhaengelast ; Zuglast carga (bruta) remolcada ; carga de un tren massa (lorda) rimorchiata treinbelasting masa ciqgniona (pociqgu) brutto vaguvikt y compris leur chargement. (gross) load hauled trailing load The mass of a11the vehicles hauled, including their loads. Macca Bpyrro noesna Macca Gpyrro npuuenubtx e~uuau no~Bameor0 cocrana Macca rpy3a. 811-03-09 BCeX npWCnHbIX CAAHHU nOABHHcHOr0 COCTaBa, BKJIIOYBII MaCCy charge brute totale (d’un train) Total de la charge brute remorquée et de la masse des véhicules moteurs. total gross load (of a train) The total of the gross load hauled and the mass of the motor vehicles which haul it. Gesamtzuggewicht (eines Zuges) carga bruta total (de un tren) massa (lorda) totale (di un treno) trein belasting inclusief locomotief masa calkowita (pocipgu) brutto tagvikt nonuaa Macca Bpyrro noezna CyMMa MaCCbI TRTOBMX 811-03-10 6pyTTO eAHHHU npHUenHbIX nOABPiIHOr0 CAHHIIU nOABWKHOI’0 COCTaBa II MaCCbI COCTaBa. charge normale d’un véhicule moteur Normallast eines Triebfahrzeuges carga normal de un vehiculo motor massa rimorchiabile normale (di un veicolo motore) normale belasting van een krachtvoertuig normal load of a motor vehicle obciqienie nominalne (pojazdu trakcyjnego) The trailing load which cari be hauled by one or more motor vehicles over a normal vagnvikt given route whilst observing a specified schedule. Charge d’un train qui peut être remorqué par un ou plusieurs moteurs sur un parcours donné en respectant un horaire spécifié. véhicules HOPMWlbHWl llepeBO3lSMaSl MBCCP (TRrOB0i-t BAUHAUbI nO~BWWHOrO COCTâBB) Macca 811-03-11 npHUCnHbIX CAr?HE%U nOABWKHOr0 nepeBe3eHbI OAHOti HJII4 HeCKOJIbKPïMA MapIIIpyTy, co6nronaa 3aAaHHOe COCTaBa, TIITOBMMII paCnEiCaHEïeM KOTOpbIe eAMHHUaMH MOTYT n0 6bITb 3aAaHHOMJ’ BpeM% charge maximale d’un véhicule moteur Masse maximale qui peut être remorquée en toute sécurité sur un parcours donné par un ou plusieurs véhicules moteurs. Elle peut s’accompagner d’une réduction des performances. maximum load of a motor vehicle The maximum load which cari be safely hauled by one or more motor vehicles over a given route. It may reduce the performance. eflnHmb1 MaucuManbuafl nepeeo3uMaft Macca (TWOBO~ CocTaBa) HaaGonbrrrax MOI-YT MaCCa 6bITb CAHHkïUaMPi npauenabrx nepeBC3eHbI nOABIITHOT0 MaKCEfMaJIbHOii 6e3 COCTaBa nepeBO3HMOii 3KCWIYaTaUBOHHbIX CAHHIJII pkiCKa n0 MaCCbI nOABWKHOr0 OAHOl? IlJIA 3aAaHHOMJ’ MOxeT COCTaBa, MapIIIpyTy. KOTOpMe TRTOBbIMH npeBbIUIeHHe K yXyAUIeHEiE0 Xap?KTepHCTHK. SECTION 811-04 - MODES SECTION D’EXPLOITATION 811-04 - METHODS PA3AEJi 811-04 - PEWdMbI 811-04-01 uo~smcHor0 HeCKOJIbKBMH npFiBeCTH Grenzlast eines Triebfahrzeuges carga maxima de un vehiculo motor massa rimorchiabile massima (di un veicolo motore) maximale belasting van een krachtvoertuig obciaienie maksymalne (pojazdu trakcyjnego) maximal vagnvikt OF USE 3KCIlJIYATAQHH marche à vide Marche d’une automotrice bagages. Leerfahrt (Leerzug) ou d’un élément automoteur sans voyageurs, ni empty running The running of a motor coach or a train unit without passengers or luggage. marcha sin carga marcia a vuoto onheladen rijden przebieg proiny tomkorniug 50(811) 0 811-04-01 - IEC npo6er 15- IIOPOXGHRKOM ABH)KeHkïe MOTOpHOrO BarOHa HJIH MOTOpBarOHHOti CeKUHkl6e3 naCCaWIpOB II Garaxa. 811-04-02 Leerfahrt (Lz, Lok allein) marcha de maquina aislada marcia di una locomotiva isolata rijden ais losse locomotief przebieg luzem (lokomotywy) ensamt lok marche haut-le-pied Marche d’une locomotive non attelée à un train. light running locomotive running light The running of a locomotive not coupled to a train. cne~oaauae pe3epeom npo6er JlOKOMOTUBZiIlOPOXHflKOM flBWKeHHe 811-04-03 6e3 JIOKOMOTBBa nOe3Aa. marche sur L’erre Marche d’un train avec courant de traction freins. coupé et sans application des coasting The free running of a train with no traction current and no brakes applied. Auslauf marcha por inercia marcia per inerzia uitlopen jazda z wybiegu ; jazda rozpedu rullning e3Aa Ha sbI6ere 811-04-04 CB060AHbIfi XOA npPïMCHCHI4R TOPM030B. nOC3Aa IIpH OTK,IIOYeHHOM IICTOYHAKC nATaHAR I4 6e3 conduite multiple Marche dans laquelle le train est remorqué ou poussé par plusieurs véhicules moteurs conduits chacun par sa propre équipe. assisted operation Operation in which the train is worked by two or more motor vehicles, each driven by its own crew. Unterstiitzende Traktion conduccion mutiple marcia in trazione multipla rijden met bemand extra krachtvoertuig trakcja ukrotniona lokkoppling CJle~OBiXHKeMHOrOKPaTHOii TRI-Oii ABIITeHAe noe3Aa nOABIILHOr0 811-04-05 C COCTaBa IIOMOUbIO npH HaJIWiIIH ABYX IIJIti 6piraAbI 6onee TIIrOBbIX B KaxAOti eAIIH&iII Pi3 HYIX. (marche en) double traction Conduite multiple dans laquelle deux véhicules moteurs sont placés en tête du train. double heading Assisted operation train. in which two motor vehicles are placed at the front of the Doppeltraktiou marcha con doble traction (marcia in) doppia trazione rijden met voorspan trakcja podwojna czofowa lokdubblering cnenoeaeue ~noüuoü rurotï ABWKKeHPïe nOe3Aa YCTaHOBJIeHHbIX 811-04-06 C nOMOUbK) B rOJIOBe ABYX TRrOBbIX eAHHllII IlOABWKHOrO COCTaBa, nOe3Aa. marche en pousse renfort en queue Marche dans laquelle un véhicule moteur, attelé ou non, est ajouté en queue d’un train pour concourir, par poussée, à son déplacement. banking assisting in rear pusher operation (USA) Running in which a motor vehicle, coupled or uncoupled, of a train to assist in its propulsion. is added to the rear cne~onauuecronKaueM ,!jB&ixeHkfe nOC3Aa, nenpuuennenuaa nOATaflKHBaH&ïR. K XBOCTY TmOBaR KOTOpOrO eAIIHHua AO6aBnRCTCsI nOABIUKHOr0 IIpHUenJICHHax COCTaBa Hm Ann Nachschiebefahrt marcha en multiple traccion por cola (spinta di) rinforzo in coda rijden met extra opdruk jazda pomocniczo-popychowa paskjutning 811-04-07 16- 50(811) 0 CE1 marche en unités multiples Marche dans laquelle plusieurs véhicules moteurs seule cabine ou d’un seul poste de conduite. sont commandés d’une multiple unit operation Operation in which several motor vehicles are operated from one driver’s cab or driving position. cnenoeame no cmreMe hmorIIx egtmA4 ABIIXCeHHe nOe3Aa,IIpH COCTBBâ Fahrt in Vielfachsteuerung (Zugsteuerung) marcha con unidades multiples comando in multiplo rijden in treinschakeling ; rijden in multipleschakeling trakcja ukrotniona o sterowaniu centrafnym multipelkijrning KOTOpOOM ynpaBnnIoTcSl PI3 HeCKOJIbKOTRrOBbIX OAHOki Ka6IIHbI eAAHIWnOABIITHOr0 ynpar5neHm-I PIJIII nocTa ynpaaneHwz-4. 811-04-08 marche en refoulement Marche dans laquelle le véhicule moteur, attelé ou non et occupé par son équipe de conduite, est placé en queue du train et le pousse. propelling movement Running in which the motor vehicle, coupled located at the rear of the train and pushes it. or not and with its crew, is Schiebefahrt marcha por cola del tren treno spinto geduwd rijden jazda popychowa ..... CJICAOBaHK‘ZC JIOKOMOTRBOMB XBOCT‘?nOe3Aa Cnoco6 se~emia noesna, cocTaBa,np&IUenneHaaa XBOCTe 811-04-09 noe3Aa npa ~0~0p0M TRroBaa crn&i HenpHUenneHHan,c PI TOJIKaeT eAHHwa 6paraAoii noAamKHOr0 pa3MemaeTcS B ero. marche en réversibilité Wendezugbetrieb Marche dans laquelle le véhicule moteur est attelé à une extrémité du train et marcha reversible le pousse ou le tire, le conducteur étant toujours placé dans une cabine de marcia con treni navetta ; marcia con treni reversibili conduite en tête du train. rijden met een trekduwtrein jazda nawrotna push-pull operation push-pulldrift A method of operation in which a motor vehicle is coupled to one end of the train and pushes or pulls it, the driver being always located in a driver’s cab at the head of the train. 4enHorHoe mumem4e Cnoco6 CJIeAOBaHPIa nOeJAa, npH KOTOpOM TZ4rOBaR eAHHBIla nOABIGKHOr0 COCTaBaHaXOAllTC~HaOAHOMKOHU~nOe3Aa~TO~KaeTYr~~Tam~TerO;np~ 3TOM 811-04-10 MaIIIEIHEICT BCerAa HaXOAIITCa B Ka6AHe B rO,IOBe nOe3Aa. télécommande par radio Commande à partir d'une par radio des équipements cabine de conduite entête d’un ou plusieurs véhicules moteurs, d'untrain ou à partir d’un poste fixe. radio control The transmission by radio ofdriving control signals for one or more motor vehicles, either from a driver’s cab at the head of a train or from a tïxed Funkfernsteuerung control por radio telecomando radio radiobesturing sterowanie radiowe radiostyrning location. ynpaeneuue no pana0 ~epeAarac~raanonynpaBneHaaAB~~eH~e~noe3AanopaA~oHaOAHy~n~ HeCKO,IbKO ynpasnemis, 811-04-11 TarOBbIX eAIIH11II HaxoAameiics nOABIITHOr0 B ronose noesAa, COCTaBa nu60 nu60 conpeAeneHHor0 I13 Ka6HHbI MeCTa. conduite (d’un train) Ensemble équipements des manoeuvres de traction à exécuter et de freinage sur les appareils pour assurer de commande le démarrage, des le réglage de la vitesse et le freinage d’un train ou d’un véhicule. driving Al1 the operations carried out on the traction and brake control equipment start the vehicle or train, control its speed and brake it. to Fahren conduccion comando (di un treno) ; condotta (di un treno) besturing sterowanie (pociqgiem) manovrering 50(811) 0 811-04-11 - IEC 17 - ynpanneeue ~suxeuaeM COBOKYIIHOCTb Tll,-05% B noe3na OIIepaIJI%ii, TOPMOW(eHAeM BbItIO~HHeMbIX AJIR 3aIlyCKa ee (ero) II perynripoaaami Ha 06OpyAOBaHkïH eAHHEiUb1 IIOABWKHOTO c~0p0c~n nan~erinn )‘IIpaBneHkïSl COCTaBa HJIII ri npouecca TOPMO~KeHHR. 811-04-12 conduite manuelle Mode de conduite dans lequel la conduite du train ou du véhicule nécessite l’intervention d’un agent à bord. manual operation Handbetrieb conduccion manual condotta presenziata handbediening sterowanie rqczne manuel1 manovrering A method of driving in which the controls must be operated by a driver on the train or vehicle. pyreoeynpasaeHaensu~eHneM Cnoco6 )‘tIpaBneHHSl ABU)l(eHYleM IIOC3Aa npn K0~0p0M 0pranaMri ynpaeneamr 811-04-13 HJIH CAAHAUbI Mannnynupyer IIOABkGKHOI-0 COCTBBâ, h4ammmc-r. conduite automatique Mode de conduite dans lequel la marche du train est commandée automatiquement, sans l’intervention du conducteur, qui, pour autant qu’il y en ait un, n’exerce que des fonctions de surveillance. automatic train operation automatischer Betrieb conduccion automatica condotta automatica automatische treinbesturing sterowanie automatyczne automatisk manovrering A method of operation in which the movement of the train is automatically controlled without the intervention of a driver, who, if provided, exercises only a supervisory function. anrohraruuecuoe ynpasneeue flnuuteueehr r@MHUHII AeiiCTBHR, OCY~CCTBJIRCTCR BbIIIOJIHFlCT 811-04-14 TOJIbKO ynpanneane K0~0p0M IlpH a aBTOMaTWIeCKA, KOHTPOnbHbIe MNIIAHUCT, nnmuenneM WJIA OH noesna IIpEïCyTCTByeT, @YHKUHM. conduite à un seul agent Mode de conduite dans lequel un agent unique occupe la cabine de conduite du train, qui est équipée en conséquence. Note. - Le terme français “conduite à un seul agent” couvre les deux modes de conduite définis par les termes anglais “single-manning” et “one man operation”. Ein-Mann-Besetzung conduccion por un solo agente condotta con un solo agente eenpersoonsbemanning sterowanie o zalodze jednoosobowej enbemanning single-manning A method of operation in which the driver% cab is occupied by only one man who carries out a11the driving operations. ynpasneaae KIpmum B 0~~0 nu40 netimsm, IIOABIGKHMM nptï COCTaBOM KOTOPOM OCJ’IIWCTBn~lOTC5l ace onepaunn TOJIbKO OAHIIM no ynpasnenmo JIAUOM Pi3 Ka6HHbI ynpasnemn. 811-04-15 ..... Mode de conduite d’un train dans lequel la conduite ainsi que les autres opérations fonctionnelles (par exemple, la commande des portes, le chauffage, l’éclairage, etc.) sont effectuées par un S~u1 agent. one man operation one person operation A method of use of a train in which a11the driving and other operational duties (e.g. control of doors, heating, lighting, etc.) are performed by only one man. . . . . . .. . . . np&IHulUI ACiiCTBWI, ITOABM~HbIM oTonneme, IIpH COCTaBOM 0cBeweHMe KOTOPOM (B TOM II -r.n.) BCC A&CTBHff, WïC.JIe CBR3aHHbIC OTKPbIBaHMC 0cytuecmnmoTcx C j’IIpaBJICHHeM M 3aKpbIBaHPiC -ronbKo OAHI~M ABCpeii, nmoh4. Ein-Mann-Betrieb manejo por una sola persona ..... eenpersoonsbediening sterowanie i obshtga jednoosobowa enmansbetjaning SECTION 18- 50(811) 0 CE1 811-05 - MOUVEMENT SECTION DES TRAINS 811-05 - TRAIN MOVEMENT PA3AEJI 811-05 - ABHXEHHE 811-05-01 IIOE3AA effort résistant total Somme des forces s’opposant au mouvement Gesamtfahrwiderstand esfuerzo resistente total forza resistente totale totale treinweerstand opor trakcji calkowity totalt tàgmotstànd du train ou du véhicule. total (train) resistance The sum of the forces opposing the movement of a train or vehicle. nonHoe conpoTaBJleHwe~BuXCeHulO ~pOH3BeAeHHe eAkiHHUy 811-05-02 CYMMbI BCeX YAeJIbHbIX IIOABWKHOI-0 COnpOTLlBJIeHHii Ha MaCCy nOe3Aa IUIH COCTaBa. résistance spécifique (d’un train) spezifischer Fahnviderstand resistencia especifica resistenza specifica (di un treno) specifieke treinweerstand op6r trakcji jednostkowy specifikt tàgmotstand Effort résistant par unité de masse d’un véhicule ou d’un train. specific train resistance The resistance to motion per unit mass of a vehicle or train. y~enbuoeconpoTuBneHee~BWmeHuto COnpOTISB,IeHPIe cocTaBa 811-05-03 tuni ABkDKeHkNO, OTHeCeHHOe K eJ.OlHHUe MâCCbI nOABWKHOT0 noe3Aa. résistance spécifique au roulement spezifischer Rollwiderstand Résistance spécifique due aux frottements qui se produisent entre roues et resistencia especifica a la rodadura resistenza specifica a1 rotolamento rails et entre d’autres parties en mouvement, en palier et en alignement. specifieke rolweerstand opor jednostkowy toczenia specific rolling resistance specifikt rullmotstànd The specific resistance due to friction between wheel and rail and between other moving parts, on straight and level track. yAeJTbHOe COupOTuBJleHue ABRîXeHlllOHa upflMOM rOpH30HTaJTbHOM uyTl4 YAeJIbHOe a COnpOTliBneHEïe TaKxe MexAY l-OPH30HTaJIbHOM 811-05-04 ABWKeHHIO OT TpeHWl MeHcAy ABA~YLLWMACR APYrHMA KOJIeCOM ‘IWTRMM II PeJIbCOM, Ha IIPSIMOM nyTU. résistance spécifique due aux courbes Résistance spécifique due à la composante les courbes. de frottement qui se produit dans specific resistance due to curves The specific resistance curves. due to the component of rolling friction produced in spezifischer Kurvenwiderstand resistencia especifica a las curvas resistenza specifica in curva specifieke boogweerstand opor jednostkowy jazdy na lukach specifikt kurvmotstànd yAeJIbHOeCOnpOTuBJTeHue ~BuXeHlilO B KpuBOu YAeJIbHOe 811-05-05 COnpOT~BJIeHlie AB&ï~eHliK? OT TpeHHS B KPHBbIX. résistance spécifique de l’air spezifischer Luftwiderstand resistencia especifica a1 aire resistenza specifica dell’aria specifieke luchtweerstand opor jednostkowy aerodynamiczny specifikt luftmostand Résistance spécifique due aux effets de la pression d’air sur la paroi frontale du véhicule de tête d’un train et du frottement de l’air sur les parois latérales, les toitures, le dessous des véhicules, etc. specific air resistance The specific resistance due to the effect of air pressure on the front of the train and of air friction on the sides, top, bottom, etc. yaenbuoe conpoTesfieHne sosnyxa Ynenbnoe YaCTb HIIXHH)~ conporuaneaue, nOe3Aa YacTM H c03naaaebroe AaanetmeM ao3nyxa na BCJIeACTB&ie noesna II T.A. TpeHAII BOJAJ’Xa 0 6OKOBIIHb1, no6onym BepXHIOW H 50(811) 0 811-05-06 - IEC 19- résistance spécifique due à la rampe ou à la pente Résistance spécifique due à la composante de la force de gravitation dans une rampe ou une pente d’inclinaison donnée. Note.Dans négative. le cas d’une pente, on admet que la valeur de cette résistance est specific resistance on inclined track @radient) The specific resistance due to the component gradient. Note.-If negative. the slope is downward of gravitational in the direction spezifischer Steigungswiderstand resistencia especifica a la pendiente resistenza specifica dovuta alla livelletta o alla pendenza specifieke hellingweerstand op6r jednostkowy na wzniesieniach i spadkach specifikt stigningsmotstand force on a given of travel the value Will be yflesrbaoe conpoTueaeHee Ha yenoHe (Ha nonheMe) YAenbHOe COIIpOTPIBneHHe OT COCTaBnNWeii CIUIbI TIIW(eCTA Ha AaHHOM ymoae. Ecnn npSfMeYaHHt'- 6yneT BenWlIIHa 811-05-07 3~0 YK~OH no HanpaBneHmo ABwKeHIIH, TO 3Ta OTpEiUaTenbHOti. facteur (d’inertie) des masses tournantes Facteur plus grand que l’unité, appliqué à la masse du train ou du véhicule, pour tenir compte de l’inertie des masses tournantes liées au mouvement du train (essieux montés, induits, etc.). allowance for rotating parts A factor greater than unity applied to the mass of a train or vehicle to make allowance for the inertia of the revolving masses inseparable from the movement of the train (wheel-sets, rotors, etc.). Zuschlag fiir rotierende Massen (Massenzuschlag) factor de inercia por las masas rotativas ; coeficiente de masas en giro fattore (inerziale) delle masse rotanti toeslag voor roterende delen wspticzynnik mas wirujqcych tillaggsfaktor for roterande massor K03@+4uueHT rteepuae npamalomexcn MBCC K03$i@iuUeHT eAmwïUbI 6onbrue CBR3aHHbIXCABWKeHHeM 811-05-08 OTHOCRIAH~~R eAAHHqb1, cocTaaa AJIII yrera IIOABWKHO~O K Macce noe3Aa miepWn3 spaualouu4xcff nOe3Aa(KOneCHbIXnap,RKOpeiiABHraTeneM mn4 Macc, A T.A.). effort de décollage Losbrechkraft Valeur maximale de l’effort résistant, juste avant que toutes les roues du train tournent. esfuerzo de arranque resistenza allo spunto lostrekkracht op6r wstqpny igàngs2ittningsmotsttInd breakaway force Maximum resistance immediately before a11the train wheels begin to turn. COIlpOTlIBJleHne ABlGXeHumnptï TpOraHW MaKCEïMaJIbHOe nepeA 811-05-09 3HaYeHFie HavanoM aparrreem COIIpOTHBJIeHWl Bcex Konec ABWKeHEGO HeIIOCpeACTBeHHO noe3Aa. effort accélérateur Beschleunigungskraft Partie de l’effort à la jante disponible pour produire l’accélération du train en translation et en rotation. des masses accelerating force That part of the force at the wheel rim available to accelerate the masses of the train in both longitudinal and rotary movement. esfuerzo acelerador forza accelerante versnellingskracht ; aanzetkracht sih przyspieszajqca accelerationskraft ycKopHmman cena YaCTb MaCCaM 811-05-10 Clin61 Ha IIOe3Aa o6oAe Koneca, B IIOCTyIIaTenbHOM Heo6xoAHMaff WIH Ii BpaIUaTeJIbHOM coo6meHm YCKOpeHWI ABEGKeHHH. effort décélérateur effort retardateur Effort disponible pour produire translation et en rotation. Verzogerungskraft esfuerzo decelerador la décélération des masses du train en decelerating force retarding force The force available to decelerate the masses of the train in both longitudinal and rotary movement. forza decelerante vertragingskracht ; remkracht sila zwolniajqca retardationskraft 811-05-10 saivejqamomaa cana TopM03flmaffcnna Cuna, HeO6XOAHMm IIOCTyIIaTenbHOM 811-05-11 50(811) 0 CE1 20 - Ann coo6meaan H BpaIIlaTenbHOM 3aMeAnemx MaccaM noe3Aa B ABM~eHIIII. accélération résiduelle Restbeschleunigung Accélération qui, à une vitesse donnée, résulte de la différence entre l’effort de traction disponible et l’effort nécessaire au maintien de cette vitesse. ~“~~~~n~~e$~~a restversnelling przyspieszenie wyrownawcze restacceleration residual acceleration The acceleration which, for a given speed, corresponds to the difference between the available tractive effort and the tractive effort necessary to maintain that speed. 0craTovHoe ycKopeHne YCKOpeHHe, M‘?HcAy KOTOpOe HCO6XOAUMbIM 811-05-12 IlpI pCanEï3yeMbIM 3aAaHHOfi TIITOBbIM CKOpOCTI4 J’CHJIPiCM AJIH IIOAAepmaHHR 3TOk COOTBCTCTByeT A Tpe6yeMbIM pa3HOCTM TRI-OBMM YCHnFieM, CKOPOCTA. Anfahrt démarrage Début de la période de mise en vitesse, pendant laquelle l’équipement fonctionner dans des conditions de surcharge de courte durée. peut arranque awiamento aanzetten rozruch atm4 ---- _ starting The first part of the accelerating work under short-time conditions period, during which the equipment of overload. may llJWOBOi-4 pt3iUiM HaqanbHbIti MON?T IIepPiOA pa6OTaTb IIOesAa, B TeYeHHe )‘CKOpeHHSl npH KpaTKOBpCMeHHbIX KOTOPOI-0 06OpyAOBaHae IIepel-PyJKaX. SECTION 811-06 - FREINAGE SECTION 811-06 - BRAKING PA3AEJI 811-06 - TOPMOXEHHE 811-06-01 Bremssystem système de freinage Moyens dont sont équipés les véhicules pour maintenir ou arrêter un véhicule ou un train. la vitesse, la réduire sistema de frenado sistema di frenatura remsysteem system hamowania bromssystem braking system A set of equipment vehicle or train. fitted on vehicles to hold or reduce speed or to stop a CUCTtZMBTOPMOXCEIHUR KoMnneKT o6opyAoBaHHn, IIpCAHa3HaYeHHOI-0 EUIF, OCTaHOBKU 811-06-02 Ana yCTaHOBJIeHHOr0 OrpaHWeHIUl eAIIHHUb1 IlOABEDKHOrO Ha IIOABIIXHOM HnkI YMeHbIIICHUR COCTaBa HnM CKOPOCTU COCTaBe, ABM~eHUR IIOe3Aa. mode de freinage Bremsmethode Indication concernant la façon de produire l’effort de freinage : électrodynamique, électromagnétique, mécanique, etc. tipos de freno modo di frenatura remtype typ Gmulca bromstyp brake type A term indicating electromagnetic, how the braking mechanical, force is produced : electrodynamic, etc. C~OCO~TOPMOXBHWR TepMPïH, yKa3bIBaIO~Hii 3neKTpOAHHaMH’WK~ti, Ha C~OCO~ 3neKTPOMaTHHTHbIti, CO3AaHtWI TOpMOSHOti MeXaHWIecKAfi H T.A. CMnbI : 50(811) 0 811-06-03 -2l- IEC freinage mixte Combinaison de différents gemischtes Bremssystem frenado mixto frenatura mista gecombineerd remsysteem typ hamulc6w mieszany kombinerat bromssystem modes de freinage. combined braking system Combination of different brake types. KOM6AHRPOBBHHOBTOpMOXCeHUe CoseTanUe 811-06-04 cnoco6oB pa3nwIHbrx TOpMO~eHUU. juxtaposition (de modes de freinage) Opération qui a pour effet de mettre matiquement plusieurs modes de en œuvre freinage, manuellement indépendamment ou auto- ou simultané- sovra~~osizione remsysteem met verschillende remtypen system hamowania zloiony blandat bromssystem ment. composite braking system A braking system comprising or automatically, separately more than one brake type, operated or kombinierte Bremsung yustaposici6n (sistema de frenado) manually together. CUCTt?MaCMtXUaHHOTOTOPMOXt?HllR CUCTeMa KOTOpbIe COCTOffmaFI TOpMOwteHUa, npUBOARTCU B AeiiCTBUe 83 HeCKOJIbKUX BpyYHyIO TUnOB TOpM030B, UJIU aBTOMaTUYeCKU, BMeCTe UnU B OTAeJIbHOCTU. 811-06-05 conjugaison (de modes de freinage) iiberlagerte Bremsung Opération qui a pour effet d’additionner automatiquement les efforts de conjugacitm (sistema de frenado) plusieurs modes de freinage, de sorte que l’effort total obtenu soit égal à integrazione samenwerkende remming l’effort requis à tout instant. hamowanie zespofowe blandad bromsning blended braking Composite braking component brake required at any in which the forces produced types are automatically by two or more of the controlled to provide the total force instant. .CMWlaHHOe TOpMOXCEeHlN? C~OCO~ TOpMOHteHUs, aBTOMaTUYeCKU TOpMOJHaU 811-06-06 npU KOTOpOM CKJIaAbIBaIOTCR, CUJIa PaBHa HeCKOJIbKUX YCHJIUR a nOJIyYaeMaR B 3aAaHHOM Tpe6yeMOÜ TUnOB B pe3yJIbTaTe TOpM030B 3TOrO o6tnan pe9UMe. substitution (de modes de freinage) Opération qui a pour effet de supprimer automatiquement l’effort d’un mode de freinage pour le remplacer par celui d’un ou de plusieurs autres. substitutional braking Composite matically braking in which the force produced eliminated in order to be replaced by ablosende Bremsung sustituci0n (sistema de frenado) sostituzione vervangende remming hamowanie zamienne alternativbromsning by one brake type is autothat of one or more others. 3aMematomee TopMoXceHae C~OCO~ TOpMOXreHUsJIpU HeCKoIIbKUX 811-06-07 KOTOpOM ucKnwIaeTcs aBTOMaTUYWKA TUnOB Ap,‘rUX u )‘CUJlUe 3aMeUReTcU OAHOTO TUna ycUnueM TOPMO3a onnoro UnU TOpM030B. freinage de maintien Méthode d’utilisation sensiblement constante du système de freinage destinée à maintenir pendant la descente des longues pentes. maintain an la vitesse holding brake A method of operating the braking system to uniform speed when descending long gradients. approximately ,,O,I,TOpMaîIîHBaHHe C~OCO~ aeiiCTBUU npUMepH0 CUCTeMbI nOCTOaHHOU TOpMOH(eHUR, CKOPOCTU npUMeHUeMbIU ABU)f(eHUR Ha .WIUHHbIX AJIs nOAnep~aHU5I CII,‘CKaX. Beharrungsbremsung .I frenado de contenc’on frenatura di mantenimento ; frenatura di trattenuta aanhoudende remming hamowanie stabilizujpce prqdko86 hàllbromsning 811-06-08 22 - 50(811) 0 CE1 Verziigerungsbremsung freinage de ralentissement Méthode d’utilisation l’annuler. du système de freinage pour réduire la vitesse sans retarding brake frenado de retardo frenatura di rallentamento remmen voor snelheidsvermindering podhamowanie inbromsning A method of operating the braking system to reduce speed without bringing the train to a standstill. TOpMO2lN?Hue Cnoco6 CKOPOCTU 811-06-09 3aMeAJleHWfl AeiiCTBu,3 He A0 CUCTeMbI nonaoii TOPMO)KeHUR, 0cTaHoBKu npUM'ZHS?eMbIfi AJISI CHUX(eHuR noe3Aa. Anhaltebremsung frenado de detencion frenatura d’arresto (normale) remmen om te stoppen zahamowanie to a stoppbromsning freinage d’arrêt Méthode d’utilisation du système de freinage pour annuler la vitesse. stopping brake A method of operating standstill. the braking system to bring a train completely OCTBHOB0',HO‘?TOPMO11CBHu~ Cnoco6 AefiCTBUR CKOPOCTUA~ 811-06-10 CuCTeMbI nomoii IlpUMeHSIeMbIti TOPMO)KeHHB, 0cTaHoBKu AJIff CHU~eHuSI noe3Aa. freinage (automatique) d’arrêt au but automatische Zielbremsung Système de freinage destiné à arrêter un train à un point prescrit, indépendamment de sa vitesse initiale et sans l’intervention du conducteur pour régler l’effort de freinage. frenado automatico de parada frenatura (antomatica) d’arresto a bersaglio automatische doelrem hamowanie (automatyczne) docelowe malbromsning automatic spot brake A braking system which brings a train or a vehicle to a standstill at a predetermined point, regardless of its initial speed and without the need for a driver to control the brake force. aBTOMaTUYWKOeTOPMO%?HklB CUCTeMa TOPMOaeHUS-4, OCTBHOBKU nOe3Aa He3aBHCUMO OT ero HeO6XOAUMOCTU 811-06-11 UJIU B 3aAaHHOM MeCTe npenna3na~ennarr eAUHI (ee) Ans nOABUxtHOr0 TOPM03H08 U CUJIM nonnon B 3aAaHHOM CKOPOCTH HaqanbHoii B PeryJIupOBaHUU ocytnecraneaux COCTaBa IIPU MeCTe, OTCyTCTBuu MaIIIUHUCTOM. frein d’urgence Notbremse 1. Dispositif destiné à commander, aussi rapidement que possible, le ou les freins d’un train ou d’un véhicule. , soit .aar l’intermédiaire du conducteur, soit indépendamment de celui-ci. freno de emergencia freno d’emergenza noodrem hamulec awarvinv “” * nijdhroms 2. Systeme de freinage additionnel pouvant défaillance du système normal de freinage. entrer en action en cas de emergency brake 1. A means of actuating the brakes on a train or vehicle as rapidly as possible, initiated by the driver or independently. 2. An alternative sytem. aBa@Hblli 1. CpeACTBO TOPMOSOB He3aBuCuMO 2. braking system for use in the event of failure of the normal TOPMOS AJIR IIOe3Aa MaKCUManbHOTO UJIU 6bICTpOrO nOABWKHOr0 IIpUBeAeHuH COCTaBa B AeiiCTBUe MBLIIIIHEICTOM UJIU OT HerO. ~OnOJIHHTenbHaSi ucnonb30BaHm eAUHUIJb1 B cnysae CuCTeMa oTKa3a TOPMOlKeHUR, ~CH~BH~ZI CucTeMbI. IIpeAyCMOTpeHHaR AJIR 50(811) 0 811-06-12 - IEC 23 - frein de stationnement Festhaltebremse Frein destiné à maintenir à l’arrêt un véhicule en stationnement et dont le fonctionnement est indépendant de toute source d’énergie sur le véhicule. Il peut être actionné, au serrage ou au desserrage, électriquement, hydrauliquement, par ressort ou à la main. freno de estacionamiento freno di stazionamento parkeerrem hamulec postojowy parkeringsbroms parking brake A brake provided to hold a vehicle stationary and which remains applied independent of any source of power on the vehicle. It may be operated, in application or release, electrically, hydraulically, by spring or by hand. CTORHO’tHbIé TOPMOJ IIpCAHa3HWlCHHbI8 TOPMO~, COCTaBâ He3aBUCUMO MO)I(eT 811-06-13 AJIR B HCIIOABWKHOM OT UCTOYHUKEI 6bITb BbIIIOJIHeH UJIU PYYHMM I’IPUBOAOM. eAUHUIJb1 )‘ACpXWBaHUff COCTOIIHYIII, IIUTaHUR KOTOPbIfi Ha eAUHUIJC C 3JICKTPAY’.ZCKUM, IIOABUTHOI’O IIpOAOnHtaCT A&CTBOBaTb IIOABUlKHOrO COCTBBa. rUApaBJIUW?CKUM, OH IIpyWïHHbIM Schleuderschutzbremse frein antipatinage Moyen permettant d’enrayer le patinage d’un essieu en actionnant le frein à air ou un autre frein. légèrement freno antipatinaje dispositivo antipattinaggio antisliprem hamulec przeciwpoilizgowy slirbroms anti-slip brake A means of controlling the slipping of a wheelset by a light application air brake or other brake. of the “pOTllBO6J’KCOBO’lHOeTOpMOXWltlC Cnoco6 yMeHbIIICHH% IIHeBMaTUYCCKOTO 811-06-14 6yKCOBaHUrt UJIU ApyrOI-0 KOJICCHOii IIapbI C nOMOIUbIO TOPMOJB. freinage mécanique mechanische Bremse Mode de freinage dans lequel l’effort de freinage est obtenu par le frottement de sabots ou de patins appliqués sur les roues ou des disques. frenado mecanico frenatura meccanica mechanisch remmen hamowanie mechaniczne friktionsbroms mechanical braking A brake type whose braking force is provided by friction blocks or pads and the wheels or separate discs. between brake MexaHarecltoe TopMoîKeaae Cnoco6 TOPMOXGSHUR, TOPM03HbIX 811-06-15 KOJIOAOK IIPU KOTOPOM UJIU 6aIIIMaKOB TOpMO3HaS 0 KOJIeCa CUJIa CO3AaCTCH UJIU OTAWIbHbIe TpCHUeM AHCKU. Drucklufthremse frein à air (comprimé) Frein mécanique dans lequel les organes de frottement sont actionnés comprimé et dont l’effet peut être réglé par variation de la pression. à l’air (compressed) air brake freno de aire comprimido freno pneumatico drukluchtrem hamulec powietrzny tryckluftsbroms A mechanical brake in which the friction members are actuated by compressed air and controlled by varying the air pressure. “HI.?BMaT”W?CK”tiTOPMOJ hkXaHUW.CKuii ACiiCTBUe nyTeM 811-06-16 TOPM03, CZ,TbIM U3MCHCHUR TOPM03HbIe BO3A’,XOM AaBJIeHUR U 3JICMCHTbI ,‘IIpaBJIeHUC KOTOPOI-0 KOTOPbIMU IIPUBOASITCR B OCYIWCTBnW?TCfl BO3AyXa. frein à vide Vakunmbremse Frein mécanique dans lequel les organes de frottement sont actionnés par un vide variable et contrôlé, agissant contre un vide plus prononcé et relativement constant. freno de vacio freno a vuoto vacuümrem hamulec prbiniowy vakuumbroms vacuum brake A mechanical brake in which the friction members are actuated by a controlled variable vacuum acting against a relatively constant higher vacuum. 811-06-16 50(811) 0 CE1 BBK)‘J’MHbIü TOPMOS MeXaHUYecKUii AefiCTBUe TOpMO3, TOpM03HbIe peI-ynUpyeMbIM OTHOCuTenbHO 811-06-17 24 - 3neMeHTbI IIepeMeHHbIM IIOCTORHHOMy KOTOpOrO BaKyyMOM, BbICOKOMy npuBOASITC5I AeticTByWwuM B BonpeKU BaKyyMy. Handbremse frein à main Mode de freinage dans lequel les organes de frottement main par des moyens purement mécaniques. sont actionnés à la handbrake A brake type in which the friction members purely mechanical means. are actuated by hand through freno de mano freno a mano handrem hamulec reczny handbroms PYYHOli TOPM03 Tan TOpM03a, BPY’IHYKJ 811-06-18 TOpM03HbIe YUCTO 3neMeHTbI KOTOpOI-0 IIpUBOASITCS B AeiiCTBUe cnoco6oM. MeXaHUYeCKUM frein à accumulation d’énergie Frein mécanique dans lequel l’effort de freinage est fourni par un ressort métallique dont l’effet est annulé par un dispositif électrique lorsque le frein est desserré. electrically released spring brake elektrische Federspeicherbremse freno por acumulac%n de energia eléctrica freno ad accumula (di energia) (elektrisch) veerbelaste rem hamulec sprqiynowy zwalniany elektrycznie elstyrd fjaderbroms A mechanical brake in which the actuating force is provided by a metallic spring, SOarranged that the brake is released by the force of the spring being overcome by a device powered by electricity. “PyXUiHHblÏi TOPMOS C 3JICKTpli’lI2CKlSM 0T”yCKOM “pJ’X”H MeXaHUYeCKUti TOpMO3, MeTannUrecKoü npyxusol, 0TnycKe Toph403a cuna, C 3neKTpuYeCKUM 811-06-19 B KOTOpOM FIpUBOAHOe pacnonoxewoti co3AaBaeMaa yCUnUe TaKuM ocna6naercx npyxuHoti, CO3AaeTCR o6pa3oq YTO npu YCT~OÜCTBOM IIpUBOAOM. elektromagnetische Bremse freinage électromagnétique Mode de freinage faisant appel à des électro-aimants de freinage. pour produire un effort electro-magnetic braking A brake type using electro-magnets to produce a braking force. frenado electromagnético frenatura elettromagnetica elektro-magnetisch remmen hamowanie elektromagnesowe elektromagnetisk broms 3JltXTpOMiWHUTHOL? TOpMO2KeHlW2 Cnoco6 811-06-20 Ilpu TOpMOxeHuR, IIpUMeHS?IOTCH KOTOpOM Ana C03AaHUI1 TOpM03HOil CUnbI 3neKTpOMaTHuTbI. freinage électromagnétique à frottement elektromagnetische Reibungsbremse frenado electromagnético por friction Freinage électromagnétique dans lequel l’électro-aimant agit sur un sabot ou un patin appliqué sur le rail ou sur un élément rotatif (roue, disque, tambour, frenatura elettromagnetica ad attrito elektromagnetische wrijvingsrem etc.). hamowanie elektromagnesowe tarciowe elektromagnetisk friktionsbroms electro-magnetic friction braking Electre-magnetic braking in which the electro-magnet acts on a shoe, block or pad applied to the rail or to a rotating part (wheel, disc, drum, etc.). ,,,p”K”“OHHOe 3JEKTPOMB~HHTHOeTOpMOXeHUe 3neKTpOMarHuTHOe 3a C’IeT TpeHU5l BpaIuaM3IuyIOcn 811-06-21 TOpMOHteHue, KOnOAKU AeTanb UnU (KOneCO, IlpU KOTOpOM 6amMaKa AuCK, TOpM03HaR Cuna 3neKTpOMarHUTa 6apa6an u 0 CO3AaeTCR penbC UnU TA). freinage électromagnétique sur rail Freinage électromagnétique à frottement dans lequel l’effort de freinage est réalisé par le frottement d’un électro-aimant appliqué directement sur les rails. electro-magnetic track brake electro-magnetic rail brake Electre-magnetic friction braking in which the electro-magnets directly to the rails. are applied elektromagnetische Schienenbremse ; elektromagnetische Zugbremse frenado electromagnético sobre rail frenatura elettromagnetica a pattini railrem hamowanie elektromagnesowe doszynowe elektromagnetisk skenbroms 50(811) 0 811-06-21 - IEC p‘%IbCOBO‘?3JI‘XTpOMZWHUTHOCTOpMOXW2HRW Q>pUKUUOHHOe cUna 811-06-22 25 - 3JIeKTpOMarHUTHOe cosnaexx -rpenUeM TOpMOgeHUe, 3neKTpoMarnuTa "PU KOTOpOM TOpMO3HaSI 0 penbc. freinage par solénoïdes Freinage électromagnétique mécanique appliqué sur dans lequel I’électro-aimant les roues ou des agit sur un frein disques. solenoid braking Electre-magnetic braking in which a mechanical or on discs, is operated by electro-magnets. brake, acting on the wheels Solenoidbremse frenado por solenoides frenatnra meccanica ad azionamento elettromagnetico solenoïde remmen hamowanie solenoidowe elektromekanisk broms COJlCHOElAHOe TOpMOXCHllt? 3JIeKrpOMarHUTHOe TOpMOTeHUe, AetiCTByIOmUii npU unu Koneca Ha KOTOpOM AUCKU, MeXaHUYeCKUti npUBOAUTCH B TOpM03, AeI%CTBUe 3lIeKTpOMarHUTaMU. 811-06-23 elektrische Bremse frenado eléctrico frenatura elettrica elektrisch remmen hamowanie elektryczne elbroms freinage électrique Mode de freinage fondé sur la production d'énergie électrique. electric braking A brake type in which electric energy is generated. 3neeTpHsecrtoe TopMoxceHae Cnoco6 TopMoxeHun, npu KOTOPOM 3neKTpusecKax BbIpa6aTbIBae'ICH sneprux. 811-06-24 freinage électrodynamique Freinage électrique dans lequel l’énergie est produite par les moteurs traction entraînés par le véhicule et fonctionnant en génératrices. de electro-dynamic braking Electric braking in which the energy is generated by the traction motors driven by the vehicle and acting as generators. elektrodynamische Bremse frenado electrodinamico frenatura elettrodinamica elektrodynamisch remmen hamowanie elektrodynamiczne elektrodynamisk broms 3JleKTPOAAHaMRVCCKOk? TOpMOXCCHlW 3neKTpurecKoe TRI-OBbIMU COC-raBa 811-06-25 TOpMOxeHUe, npu K~TOP~M ABUraTW"IMU,BpaIIIaEOmUMUC~ u pa60TaIOmUMU B pexuMe sneprux BbIpa6aTbIBaeTCR OT KOSIeCeAUHAUbI "OABU~HOrO reHepaTopoB. freinage par récupération Freinage électrodynamique dans lequel les moteurs de traction fournissent de l’énergie à la ligne ou à des dispositifs d’accumulation d’énergie (batteries, volants, etc.). regenerative braking Electre-dynamic the line or into braking in which the energy produced into energy storage devices (batteries, elektrodynamische Nutzbremse frenado por recuperacion frenatura (elettrodinamica) a recupero recuperatieremmen hamowanie (elektrodynamiczne) odzyskowe regenerativ hroms by the motors is fed flywheels, etc.). percynepaTlcnooe TopMoxeaae %IeKTpOAUHaMUYeCKOe BbIpa6aTbIBaeMaS yCTpOiiCTBa 811-06-26 TOpMOxteHUe, ABUraTeJIRMU, HaKOUJIeHUII nOAaeTCR KOTOpOM nw B KOHTaKTHyIO JHeprUU(aKKyMyJIWOpbI,MaXOBUKU 3HepruR, CeTb U,IU U T.n.). freinage sur résistance freinage rhéostatique (déconseillé) Freinage électrodynamique une résistance. dans lequel les moteurs de traction débitent sur resistance braking rheostatic braking (deprecated) Electre-dynamic braking in which the energy produced dissipated in resistors. by the motors is elektrodynamische Widerstandsbremse frenado por resistencia ; frenado reost&tico (desaconsejado) frenatura (elettrodinamica) reostatica weerstandsremmen hamowanie (elektrodynamiczne) rezystorowe motstandsbroms 811-06-26 50(811) 0 CE1 peocraruoe TopMoxeuue %IeKTpOLVïHaMH=IeCKOe BbIpa6aTbIBaeMaR 811-06-27 26 - TOpMOmeHHe, KOTOpOM nPu ABMi-aTeJUIMEI,paCCeHBaeTCff 3HeprEIR, B pe3IGTOpaX. freinage électrodynamique indépendant de la ligne de contact Freinage électrodynamique dans lequel l’effort de freinage est produit même si la ligne de contact n’est pas sous tension. electro-dynamic braking independent of line supply Electre-dynamic braking in which the braking effort is available even when the traction supply system is not energized. 3neurpo~uuaMuuecuoe TopMoxeuue, ue sanacflmee 3JIeKTpOAIJHaMWfeCKOe B03HHKaeTflaxe 811-06-28 npr4 TOpMOXZHHe, IIpH OTCyTCTBPWi HaIIpSlxeHWl OT uourauruou ceru K0~0p0M TopM03Hax B CACTeMe cxaa IIBTaHlWI. freinage électrodynamique dépendant de la ligne de contact Freinage électrodynamique dans lequel l’effort de freinage obtenu que si la ligne de contact est sous tension. ne peut être electro-dynamic braking dependent of line supply Electre-dynamic braking in which the braking effort is available only when the traction supply system is energized. 3JleKTpO~llHilMflWCKOe TOpMOXSHAe, 3aBElCSllUef2 OT KOHTBKTHOi?CeTI4 %IeKTpOAPïHaMWieCKOe B03HHKaeTTOJIbKO 811-06-29 IIpH TOpMOHteHHe, npH HaJlHYPiPï HanpSDKeHHR fahrleitungsunabh&tgige Bremse frenado electrodinamico independiente de la linea de contacto frenatura elettrodinamica indipendente dalla linea (di contatto) elektrodynamisch remmen onafhankelijk van de voeding hamulec (elektrodynamiczny) niezaleiny od zasilania ..... KOTOpOM TOpMOSHaR B CIICTeMe nHTaHIIR. fahrleitungsabhiingige Bremse frenado electrodinamico dependiente de la linea de contacto frenatura elettrodinamica dipendente dalla linea (di contatto) elektrodynamisch remmen afhankelijk van de voeding hamulec (elektrodynamiczny) zaleiny od zasilania ..... C&ura frein électrique par induction Mode de freinage électrique produisant un effort de freinage par induction dans un induit linéaire (rail, etc.) ou dans un élément rotatif (roue, disque, tambour, etc.). electric induction braking elektromagnetische Induktionsbremse frenado por induction eléctrica frenatura elettromagnetica a induzione wervelstroomremmen hamulec elektryczny indukcyjny induktionsbroms Electric braking in which the braking force is produced by induction in a conducting linear body (rail, etc.) or in a rotating part (wheel, disc, drum, etc.). uuflywuaomoe TopMoxeHne,npa CYeT B TOKOIIpOBOJVlWeM IIHAyKIUU4 ~JIA BO 811-06-30 3fleurpaueceoe ropMomeuue 3neKTpwiecKoe BpaIIlawwefiCx KOT~~OM TopM03Han IIpRMOJIPïHetiHOM wna TeJIe 6apa6aae AeTaJIII(KOneCe,AHcKe, co3naeTcff (peJIbCe 3a II TJI.) II T.I'I.). commande de frein Bremssteuerung Moyen mis en oeuvre par le conducteur ou par un dispositif automatique régler le fonctionnement du système de freinage. pour brake control The means by which the driver or automatic operation of the braking system. ynpaeneuae YCTPO~TBO, CBCTeMa 811-06-31 driving system regulates the control de frenos comando del freno rembediening sterowanie hamulcem bromsman8verdon Top~o3oM C IIOMOIUbM yIlpaBneH%iff KOTOpOrO peryRHpyeTpa6oTy MaUIHHEICT CNCTeMbI NIA aBTOMaTAYeCKaR TOpMO~eHNff. commande électropneumatique du frein Système où des valves commandées électriquement depuis la cabine de conduite règlent, sur chaque véhicule, l’admission et l’échappement de l’air comprimé des cylindres de frein. electro-pneumatic brake control A system where valves on each vehicle are operated electrically from the driver’s cab and control the admission or release of compressed air to or from the brake cylinders. elektropneumatische Bremssteuerung control electroneumltico de frenos comando elettropneumatico del freno elektropneumatische rembediening sterowanie elektryczne hamulcem powietrznym elpneumatiskt bromssystem 50(811) 0 811-06-31 - IEC 3JleKTpOnHeBMaTRYecKOe ynpaeaeaue CucTeMa, B KOTOpOn IIIIJIIIIIApOB CHaTbIM WIeKTpAYeCKAM 811-06-32 TOpMOSOM ynpaBJIeHIIe COCTaBa, nOABWKHOr0 27 - B03AyXOM cnoco6oM Ha KJIaIIaHaMII A BbIXOA II3 Ka6IIHbI Ka)KAOn BO3AyXa eAIIHIIIIe TOpM03HbIX nononaeane 06eCneYIIBaIomIIMII II3 HIIX, OCymeCTBJIBeTCB ynpaaneaarr. elektrisch gesteuerte Vakuumbremse frein à vide à commande électrique Système au de moyen ment frein des depuis valves la electro-vacuum A vacuum lequel situées dans de l’admission chaque d’air véhicule dans les cylindres et commandées se fait électrique- conduite. control in a valve driver’s which or freno por vacio por control eléctrico freno a vuoto a comando elettrico elektrische bediening van een vacuümrem hamulec proiniowy sterowany elektrycznie ..... brake control through the dans cabine brake cylinders from à vide atmospheric valves on air each is admitted vehicle, to the controlled brake electrically cab. 3JTeuTpOBau~MHOeyupaBJleHueTOpMO3OM CIICTeMa BaKyyMHOrO TOpM03HbIX KJIanaH ynpaBJIeHIIB nnJIIIHApOB PIlIn KJIaIIaHbI KOTOpbIMH TOpMOSOM, aTMOCI$epHbIM Ha KaxAOn B BOSAyXOM eAIIHIIIIe IIOABmKHOI-0 3JIeKTpIPIeCKIIM OCyIIIeCTBJIBeTCB KOTOpOn HanOJIHeHIIe OCymeCTBBBeTCB COCTaBa, 9epe3 ynpaBJIeIIIIe cIIoco6oM II3 Ka6IIHbI ynpaBnennB. 811-06-33 correction automatique de charge Dispositif rents permettant crans, compris de la de façon charge régler qu’ils qu’il les efforts soient de freinage proportionnels obtenus à la sur masse les du automatischer Lastwechsel correction automatica de carga diffé- véhicule y transporte. method of varying the SO that it is proportional it may be automatisk lastutbromsning brake to variabi1e automatische belastingscorrectie korekcja automatyczna hamowania wedhtg masy automatic load compensation A carico force the mass produced of the at any vehicle, given including step of braking any load which carrying. aBTOMaTA’leCKOe pe~JlupOBaHue 010~06 II3MeHeHIIB TOpMOTeHIIB eAIIHIIIIbI TOpMOJHOu CtlJlbI TOpM03HOn TaKIIM o6pa3oM, nOABIUKHOr0 CIIJIM YTO6bI COCTaBa, Ha OHa BKJIIOYaB ~~6012 6brna 3aAaHHOn CTyIIeHII IIpOIIOpuIIOHaBbHa n1o6oI rpy3, KOTOpbIti Macce OHa MOxeT Be3TII. 811-06-34 commande électrique du frein Système de moyen freinage purement moins un elektrisch gesteuerte Bremse dans lequel électrique, par ressort, selon le un frein exemple courant du mécanique un est moteur calé commandé comprimant par un plus ou moteur. braking means, motor system e.g. in a stalled which a friction brake motor compressing is controlled a spring to purely a degree by 3neuTpauecuoe ynpanaeaue TOpMO~eHIIR, OCyIIIeCTBJIBeTCB broms electrical governed by OCTaHOBBeHHbIh (PpIIKuAOHHblM CxIIMaIommI ABIIraTeBb, TOKOM YIIpaBJIeHIIe 3JIeKTpIIYeCKAM the TOpM030M cnoco6oM, HanpaMep, n’W=fHy A0 CTeneHII, ABYiraTenn. effort de freinage Effort retardateur Bremskraft exercé sur un véhicule ou un train par son système brake force force exerted on a vehicle or train by its braking system. TOpMOSHafl CUJla TOpMOJHOe yCUJtlie Ha eAIIHIIuy de bromskraft braking force 3aMeAEX‘,III~ esfuerzo frenado forza di frenatura remkracht sila hamowania freinage. retarding de CAJIa, C03AaBaeMaB IIOABIITHOrO COCTaBa CIICTeMOïI H,IH nOe3A. TOpMO)KeHIIR II AetiCTByIOIIIaR frenado elektrisch rembediening hamulec sterowany elektrycznie TOpMOSOM B KOTOpOil MCKJIIOYBTeBbHO onpeAenseh4on The de current. CncTeMa 811-06-35 eléctrico comando elettrico del freno elman&rerad electrically controlled brake A contro1 811-06-36 28 - 50(811) 0 CE1 effort de retenue GefGllebremskraft Effort exercé lors du freinage de maintien pour maintenir constante la vitesse à la descente. ~~~~~ aanhoudende remkracht sila hamowania stabilizujqcego predkosir ballbromskraft holding brake force The braking force exerted by the holding brake to maintain while descending a gradient. constant .I ~at~~~t~ speed cuaa no~ropMazcwuauun TOpMO3Ha5i CHJIa, IIOAAepxaHEIx 811-06-37 co3AaBaeMaR nOCTORHHOii B CKOpOCTH pe3yJIbTaTe IIOATOpMaHCHBaHAR AJISI HayKnOHe. Bremseigenschaft caracteristica de frenado caratteristica di frenatura remkarakteristiek cbarakterystyka hamowania bromskarakteristik caractéristique de freinage Relation existant entre l’effort de freinage et la vitesse. braking characteristic The relationship between the braking force and the speed. TOpM03Hafl XapaKTepmTma 3aBHCHMoCTb 811-06-38 MelKAy TOpM03HOii CHJIOti A CKOpOCTbH3. caractéristique stable stabilité naturelle Caractéristique d’un système de freinage électrique dont l’effort croît ou est sensiblement constant lorsque la vitesse augmente, sans recourir à un réglage ou à un dispositif automatique. stabile Kennlinie caracteristica de estabilidad caratteristica stabile ; stabilità naturale constante remkarakteristiek charaktetystyka hamowania stabilna ..... stable characteristic natural stability A characteristic of an electric braking system in which the brake force is approximately constant or increases with increasing speed without the need for adjustment manually or by an automatic device. ycrolruaaa xapaurepacruua XapaKTepHCTHKa TOpM03HaR CACTeMbI CHJIa yBe,IWIeHHeM 811-06-39 JJIeKTpWeCKOrO IIpH6JIti3HTeJIbHO CKOpOCTII npI4 TOpMO)KeHHSI, nOCTO5IHHaSI 3aAaHHOM IIOJIO~eHHH IUIH B KOTOpOti yBeJIWIHBaeTCX OpraHOB C yIIpaBneHm-4. caractéristique instable Caractéristique d’un système de freinage électrique dans lequel, pour une position donnée des organes de commande, l’effort de freinage varie en raison inverse de la vitesse du train. unstable characteristic instabile Kennlinie caracteristica de inestabilidad caratteristica instabile variabele remkarakteristiek charakterystyka hamowania niestabilna ..... A characteristic of an electric braking system in which the braking force for a given setting of the controls varies inversely with the speed of the train. ueycroiiuuaafl xapaarepncrara XapaKTepHCTHKa TOpMO3HaSl yMeHburaeTcx 811-06-40 CHCTeMbl cma AJIff JJIeKTpWIeCKOrO 3aAaHHoro c ysenwIeHtïeM TOpMOxeHUR, nonoxeHm crt0p0cTa OpraHoB B KOTOpOil ynpaBneHHrr noe3Aa. vitesse critique en régime de freinage sur résistance vitesse critique en régime de freinage rhéostatique (déconseillé) Vitesse minimale pour laquelle le freinage rhéostatique des conditions spécifiées. peut s’amorcer dans critical speed in resistance braking critical speed in rheostatic braking (deprecated) The minimum speed at which rheostatic specified conditions. braking cari be established under Kp,,TW,eCltaS, CSOpOCTb B p‘?WlM‘? p‘?OCTaTHOrOTOPMOSW!HI(R MHHtiMaJlbHaSI CKOpOCTb,npH peOCTaTHOeTOpMO~eHAe. KOTOpOfi B 3aAaHHbIX yCJIOBH%X HaYIIHaeTcR kleinste Geschwindigkeit fiir Selbsterregung der Widerstandsbremse velocidad critica en frenado por resistencia ; velocidad critica en frenado reostatico (desaconsejado) velocità critica (nella frenatura reostatica) kritische snelheid bij weerstandsremmen predkoSCminimalna hamowania rezystorowego lagsta hastighet fi5r motstandsbromsning 50(811) 0 811-06-41 IEC - 29 - décélération moyenne (en fonction du temps) Quotient ya de la réduction nécessaire pour l’obtenir : de vitesse résultant ya = vi - du freinage par le temps gemiddelde vertraging (als functie van de tijd) opbinienie hamowania Srednie medelretardation Vf t où : K est la vitesse initiale mesurée freinage a été actionné ; à l’instant où l’organe de commande de K est la vitesse finale atteinte à l’issue du freinage ; i est la durée comprise entre l’instant où l’organe de commande a été actionné et l’instant où la vitesse finale a été atteinte. de freinage mean deceleration (as a function of time) The value of deceleration E obtained by dividing the reduction the time taken to effect it : y. = in speed by vi - vr t where : K is the initial speed measured at the moment of the operation device for the brake ; Vi is the final speed obtained of the control at the end of the braking ; t is the time between the moment of operation of the control device for the brake and the moment at which the final speed is attained. cpenmee 3aMenneHue (KaK ~~HKUIIR spemeaa) Bennrnna sa&fe~nenun, ya, onpenenneMarr AeneuueM Ha Tpe6ymmeeca AJM3TOl-0 BpeM% ABHXCHPiR ya = vi - saMeAneut.in CKOPOCTII Vf t me : K - HaYaJIbHaR ynpaenenm3 i$ - KOH&YH%? t- BpCMX Ha TOpMO3 CKOpOCTb, na ~0~~03 H MOMeHTOM B MOMCHT &lCTBEW, YCTpOtiCTBE, ; CKOpOCTb, 3aMeAneHHff OIIpi?.&JI5leMaX ~OCTEfEXMaR B KOHLle TOpMO,KeHHSl MeXAj’ MOMeHTOM AOCTIIXCHPiR AeiiCTBW3 YCTpOiiCTBa KOHCYHOil mittlere Verzijgerung deceleracibn decelerazione media media (en funcibn del tiempo) CKOpOCTEI. ; ,TIpaBneHLlX 50(811) 0 CE1 811-06-42 wirksame Verzogerung deceleracion efectiva (en funcion de la distancia) decelerazione effettiva effectieve vertraging (ah functie van de afstand) opoinienie hamowania skuteczne (na danym odcinku) décélération effective (en fonction de l’espace) Quotient ye de la différence des carrés de la vitesse initiale et de la vitesse finale par le double de la distance de ralentissement parcourue : y,vw? e 21 où : 1 est la distance qui sépare la position du train ou du véhicule, au moment de l’action sur la commande de frein, de sa position lorsque la vitesse finale est atteinte ; K est la vitesse initiale mesurée freinage a été actionné ; à l’instant où l’organe de commande effektiv retardatron de Vr est la vitesse finale atteinte à l’issue du freinage. effective deceleration (as a function of distance) The value of deceleration ye obtained by dividing the difference of the squares of the initial and final speeds by twice the distance travelled while the reduction of speed is taking place : where : 1 is the distance between the position of the train or vehicle at the moment of the operation of the brake control and its position when the final speed is attained ; V; is the initial speed measured device for the brake ; Vi is the final speed obtained 3<P+2KTUBHOk? Benurmia 3aMeAJTeHUe at the moment II KOHCYHOfi BO BpCïW CHWKCHIIR (KBK (PYHKUUR CKOpOCTCü 1 - UyTb MCxAy B MCCTOM MOMCHT MCCTOUO.FIO,Ke”HCM K - HaYaJIbHaR YlIptiBnCHHR F 811-06-43 PaCCTORHUB) pL3HOCTx KBaApaTOB paCCTOaHU‘% UpOiiACHHOe ti-v: = 21 HaXOTAeHAII ACZiCTBH% COCTBBa YCTpOiiCTBa UpEl AOCTIGKCHIIII CKOpOCTb, Ha TOpM03 - KOHCYHZiR AeneHHeM Ha J’ABOCHHOC CKOpOCTH. y. COCTBBa of the control at the end of the braking. saMe&aenHR Y~, OIIpeAenxeMa% HaYa,IbHOii of operation CKOpOCTb, KOHWHOii OII’XAWIBeMaX MJIII eAIIHPillb1 YnpaBneHHfl CKOpOCTII B MOMeHT Ha UOABII~HOrO TOpM03 kl eë ; A&CTBUR YCTpOiiCTBa ; AOCTlWaCMaST B KOHLle TOPMOZHHR. distance d’arrêt Bremsweg Distance parcourue par un train ou un véhicule, entre le moment où l’organe de commande du frein a été actionné et celui où le train s’arrête. distancia de parada spazio d’arresto remweg droga hamowania bromsstr&cka stopping distance The distance travelled by a train or vehicle between the point at which application of the brake is initiated and that at which the train cornes to a standstill. TOPM03HOïi PaccTomnIe, MOMeHTB 811-06-44 UyTb IIpOXOAPIMOe IIpUB0Ak-t nOe3AOM B ACtiCTBHe EIJIA eAHHHUCii TOpM03a A0 UOJIHOfi UOABH~HOrO COCTaBa OT OCTaUOBKU. temps d’établissement (du freinage) Reaktionszeit (der Bremse) tiempo de estabilizacion (de frenado) Temps séparant l’instant où l’organe de commande du frein est actionné de l’instant où l’effort de freinage atteint effectivement sa valeur spécifiée à la tempo di ritardo aanspreektijd (van het remmen) vitesse considérée. czas zadzialania (hamulca) ansattningstid response time (of braking) The time between the moment of operation of the brake control and the moment the brake force has attained a specified value at a given speed. 50(811) 0 811-06-44 IEC -3lBpeMB Cpa6aTblBaHlHl (TOPMOîKeHRfl) hpHOA BpeMeHPI Ha TOPM03 CIUIbI 811-06-45 MGKA)’ II MOMBHTOM ITpH 3aAaHHOii MOMeHTOM BO3ACiCTBIDI AOCTWKCHAII J’CTpOfiCTBa YCTaHOBReHHOrO )‘IlpaBReHW-, 3HaYCHHSl TOPM03HOfi CKOPOCTH. réponse du freinage Diagramme de la variation de l’effort de freinage en fonction du temps, depuis l’instant où l’organe de commande du frein est actionné, jusqu’à l’instant où l’effort de freinage atteint effectivement sa valeur spécifiée. braking response Bremsreaktion respuesta de frenado risposta di frenatura remdiagram charakterystyka zadzialania (hamulca) bromsdiagram A diagram of braking force variation as a function of time from the moment of operation of the control device for the brake to the moment the braking force has effectively attained a specified value. XapaKTepWTllKa ~pa@ïK Cpa6aTblBaHliSl TOPMOJ% H3MeHeHkïR BOJACïNTB&ïH YCTaHOBRCHHOl-0 811-06-46 TOPM03HOü YCTpOliCTBa CIUIbI YIIpaBReHHR 3HaYCHAR KaK @yHKLWl Ha TOPM03 TOPM03HOti BPCMCHH A0 MOMeHTa C MOMCHTa AOCTHXGSHIGl CIUIM. électrovalve valve électropneumatique Valve commandée ou à vide. électriquement et commandant un circuit d’air comprimé magnet valve electro-pneumatic valve An electrically line. operated valve which controls a compressed-air Magnetventil ; elektropneumatisches Ventil electrovalvula ; valvula electroneumatica elettrovalvola magneetventiel ; elektropneumatisch ventiel zawor elektropneumatyczny magnetventil or vacuum 3JWKTPOMiWHATHblÏi KJlallaH 3neKTponuesMaTuqecKuBuzanau Knanau C SVIeKTpO~pHBOAOM, IIHeBMaTWIeCKOfï 811-06-47 KOTOPMËI JVIpaBRSIeT BBKYYMHOfi URI4 Mi?lrJcïCTpaRbKL électrovalve modérable de freinage Electrovalve qui fournit de l’air à une pression proportionnelle ment proportionnelle au courant qui la parcourt. ou inverse- variable magnet valve A form of magnet valve in which the pressure of the compressed air delivered by the valve is directly or inversely proportional to the current flowing in the solenoid. Regelmagnetventil electrovalvula variable de frenado elettrovalvola moderabile (di frenatura) regelbaar magneetventiel zawor elektropneumatyczny regulowany ..... peQ2lHpJ’eMblii 3JleKTPOMZ-iTHATHblé KJlilllaH Tnn 3netcrpoMarnrirnoro KnananoM cxaroro IIOCTyIIalOLLWO 811-06-48 knanaua, B 3JIeKTPOMLWHAT B K0~0p0~ .zraanemïe nonaaaehloro IIpOlIOpLWOHiUIbHO BO3A)‘Xa B IIpfIMOM senwime AJIA 06paTHOM TOKB, HanpaBRCHHRX. Schleuderschutzventil electrovalvula antipatinaje elettrovalvola antipattinaggio anti-slipmagneetventiel zawor hamulca przeciwposlizgowego magnetventil fi3r slirbroms électrovalve d’antipatinage Electrovalve utilisée pour commander le frein d’antipatinage. anti-slip magnet valve A magnet valve used to control the anti-slip brake. llpOTllBO6J’KCOBO=lHblÏi3JWKTPOMZWHHTHblkKJlZNlaH 3JICKTPOMaI’HATHbIfi ITPOTAB06OKCOBOSHbIM 811-06-49 knanan, PïCIIORbJyeMblti Ana ynpasnenns TOPMOECHHCM. manostat Automate où chaque manoeuvre déterminée d’un fluide. des contacts se produit pour une pression pressure switch A switch in which the contacts are operated at a predetermined pressure. liquid or gas Druckschalter interruptor de presion pressostato drukschakelaar facznik cisnieniowy tryckvakt - 32 - 50(811) 0 CE1 811-06-49 BbIKJIIOWTWIb, B OnpCACJICHHOM KOTOPOM AaBJIeHPIH KOHTBKTbI El3a IlpIJBOASITC5I SECTION AetiCTBHe IIpH 811-07 - ADHÉRENCE SECTION Ml-07 PA3AEJI Ml-07 811-07-01 B HJIR XHAKOCTH. - ADHESION - CIJEI-IJIEHME adhérence Haftreibung Frottement qui se produit entre les roues d’un véhicule et les rails et permet ainsi la transmission d’un effort de traction ou de freinage. adhere”cia aderenza adhesie przyczepnol& adhesion adhesion The friction between the wheels of a vehicle and the rails, which makes possible the transmission of tractive effort and braking force. cueunenne TpeHHe MCXAy o6ecne%ïaaIomee 811-07-02 KOJWXMLI CAHHBUbI BOJMO,KHOCTb facteur d’adhérence coefficient d’adhérence IIOABMXHOTO IICpCAaW COCTaBa CIIJIM TRI-H II PWIbCaMPï, Ii TOPMOXCHUR. Haftreibungsbeiwert factor de adherencia ; coeficiente adherencia (desaconsejado) coefficiente d’aderenza adhesiecoëfficiënt (déconseillé) Valeur maximale du rapport de l’effort tangentiel à l’effort suivant la normale au contact entre roue et rail. Note. freinage. Les valeurs de ce facteur sont différentes factor of adhesion coefficient of adhesion pour la traction de et le wsp&qrnnik przyczepn&i adhesionskoefficient (deprecated) The limiting ratio of the tangential and normal forces at the point of contact between wheel and rail. Note. - The values of this factor are different for traction and braking. x03*@uweHT cueuneuufl npCAC!nbHOC OTHOIJICHklC TOPMOXCHIIX K KaCaTCnbHOii HOpMUIbHOii COIIjXSKOCHOBeHIIR KOJICCZI C PWIbCOM. fl@‘MeYaHYre. 3HZPICHHC - COCTaBJIREOlUeti COCTaBJISTIOIIJeti K03@$HIWHTa CIIJIM CHJIbI TXIX4 TIIXCCTII pa3JlUYHbI B AJIH FUIPI TOYKC TXI-H II TOPMOXCHHR. 811-07-03 dispositif d’antipatinage (en traction) Dispositif destiné à remédier au patinage lorsqu’elles exercent un effort de traction. (glissement) des roues motrices, anti-slip device A device which corrects slipping of driving wheels during traction. Schleuderschutzeinrichtung dispositivo antipatinaje (en traction) dispositivo antislittamento anti-slipiurichting urzqdzenie przeciwpo8lizgowe slirskydd UpOTUBO6yKCOBOWlO~YCTPOiiCTBO npeL[na3HaYeHHOe pextan4e TIITH. YCTPO~CTBO, KOJIeC 811-07-04 B AJI5I yCTpaHCHWI 60KCOBaHm BeApLWX dispositif d’antienrayage (en freinage) Dispositif destiné à remédier au glissement qu’elles exercent un effort de freinage. ou à l’enrayage des roues, lors- wheel slide protection device A device which corrects skidding or locking of any wheels during braking. U,,OTUBO”XHOe YCTpOliCTBO YCTPO~~CTBO, 3aKJIAHUBaHIIR IIPeAHa3HPICHHOC KOJIeCB AJI5I YCTpaHCHWl pfXMMCTOPMOTCHI4R. IIPOCKaJb3bIBaHIIR PiJII4 Gleitschutz dispositivo antirayado (en frenado) dispositivo antipattinaggio antiblokkeerinrichting urzqdzenie przeciwblokujpce fastbromsningsskydd 50(811) 0 811-07-05 IEC - 33 - cabrage déchargement d’essieu Radsatzentlastung reduccion de la carga de un eje Modification de la charge statique d’un essieu sur les rails, due à l’application de l’effort de traction ou de freinage. cabraggio asontlasting ; asdrukontlasting odciqienie osi axelomlastning Note. - Il s’exprime en valeur absolue ou en valeur relative. weight transfer A change in the static load of an axle on the rails, due to the application tractive or braking effort. Note. - It may be expressed of as an absolute or relative value. nepepacnpeneneuue uarpy3Ku n3MeHeHPie CTaTIPieCK0l-i BCJIeACTBMe npPiJIOXeHHH Harpy3KI4 CAJIM TRrII OTAeJIbHbIX OT OCeii Ha peJIbCb1 HJIA TOpMOXeHMSI. ~p~~eYaHM-e.-~epepaCnpeAeneHneHarpy3KABbIpa~aeTcaBa6COA~THbIX H.JIH OTHOCEiTeJlbHbIX 811-07-06 BeJIUYIIHaX. dispositif d’anticabrage Dispositif destiné à compenser l’effet de cabrage, soit en transférant du poids d’un essieu à l’autre, soit en modifiant l’effort de traction de certains essieux. weight transfer compensation device Radsatzentlastungsausgleich dispositivo de conipensaci0n (de reduccion de la carga de un eje) dispositivo anticabraegio compensatie-inrichting voor asontlasting urzqdzenie kompensujqce odciqienie osi axellastutjamnare A device to compensate for the effect of weight transfer, either by transferring weight from one axle to another or by modifying the tractive effort on certain axles. j'CTpO,kTBOJ,JIR BbIpaBHHBaHEffl HB,-pY3KI( Ha OCb YCT~O~~CTBO,C nyTeM TRI-A 811-07-07 nOMOUbE0 pa3rpy3KM OAHOti Ha OnpeAeneHHbIx KOTOpOrO BbIpaBHEïBaeTCR OCII A HWpyJKH ApyrOfi, Harpy3Ka Ha OCII ~1~360M3MeHeHMeM ~~360 CliJIbl OCRX. Mikroschlupf microglissement Etat d’une roue exerçant un effort de traction ou de freinage, lorsque sa co.rrimiento de la via vitesse de rotation est légèrement supérieure ou inférieure à celle corresponm’cros”ttame”to microslip dant à la vitesse du véhicule. mikropollizg Note. - Le microglissement s’exprime en pour cent ou en valeur absolue. krypning creep A condition under which a wheel producing tractive or braking effort rotates slightly faster or slower than that required by the speed of the vehicle. Note. - The value may be expressed either in percentage Ycnomie, npn ~0~0p0M HeCKOJIbKO spamaerca CKOpOCTII ABHXeHUSl Koneco, eAUHHIlb1 h’pmferamfe - a6COJIEOTHbIX BeJIHYIIHaX. co3Aamuee 6bICTpee EUNi CHJIy MeAJIeHHee, nOABMXHOr0 hhiKpocKonbxeHPieabIpaxaeTcrln1460 or in absolute terms. Txm lim SeM TopMoxeHm, Tpe6yeTCx AJIR COCTaBa. ~npOueHTaX, ns460 B SECTION 34 - 50(811) 0 CE1 811-08 - QUALITÉ SECTION DE ROULEMENT 811-08 - RIDING QUALITY PASAEJI 811-08 - XOAOBbIE 811-08-01 KAYECTBA Laufeigenschaft qualité de roulement Evaluation qualitative ou quantitative d’un véhicule circulant en ligne. des mouvements de caisse et de bogie Note. - La caisse et les bogies d’un véhicule en marche peuvent être animés de mouvements perturbateurs, en translation et en rotation, définis à l’aide d’un repère trirectangulaire lié à la voie, dont les axes sont respectivement parallèle aux rails (sens longitudinal), perpendiculaire aux rails dans le plan horizontal (sens transversal) et perpendiculaire au plan de roulement (sens dit vertical). calidad de rodadura qualità di marcia loopeigenschappen jak&& jazdy g&ngegen&ap riding quality A qualitative or quantitative indication vehicle travelling along the rails. of the body or bogie movements of a Note. - The body and bogies of a moving vehicle may be affected by linear and rotational disturbing movements which are defined by reference to a set of three mutually perpendicular axes, one along the track (longitudinal direction), one across it (transverse direction) and one vertical (perpendicular to the track surface). XOAOBbIe KaqecTaa KOJIWieCTBeHHbIii Te,IeXeK UJIAKaYeCTBeHHbIii eAAHMqb1 ~jWfMeYaHJft?s COCTaBa - nOABuXHOr0 KYJOB KOTOpbIe TeJIeXKPi pe,IbCOBOMy IIyTu nonepewoM HanpaBneHuu), nOBepXHOCTH (B u OTHOCuTeJbHO OCeü, OAHa M3 npOAOJIbHOM eJWfHuIIb1 CuCTeMbI U3 npOXOAUT HanpameHm), npyrax - no KyJOBaunu penbCaM. IIOJlBuXHOrO BpaIJJaTeJIbHbIM KOTOpbIX a TpeTbx penbcoaoro n0 ABuXyIIIeiiCR np,TMOJluHeiiHbIM OnpeAeJIREOTCR IIepIIeHAuKyJIRpHbIX 811-08-02 u nOABeprafOTCH nOKa3aTeJIbnepeMeINeHufi COCTaBa,ABuXyWeiiCff BepTuKanu ABUXeHuRM, TpeX - de translation dans le sens longitudinal. fore-and-aft oscillation Koae6auen JIuHetiHoe 811-08-03 movement along the track. monb penbcoBor0 nyTu. perturbateur de translation dans le sens transversal. lateral oscillation A linear disturbing Koae6aunn B movement across the track. nonepe9HoM HanpaBneHm. rebondissement Mouvement perturbateur de translation dans le sens vertical. bouncing A vertical linear disturbing movement. Be,,TUKaJIbHbI‘?ICOJIe6aHUB JIuaetiHoe Querbewegung oscilacibn lateral oscillazione laterale zwaaien ; schiftslag schommelen drgania poprzeczne lateral svangning noneperuo# nanpasaeuen JIuHeiiHoecMerrreHue~ 811-08-04 Langsbewegung oscilaciCm longitudinal setacciamento langsrukken drgania wzdluine longtudinell svtingning B UpOAOJIbHOM HaUpaBJleHUU cMeIueHIle ballant Mouvement (B nyTu). perturbateur A linear disturbing nonepeK (nepneHmiKynnpH0 (mouvement d’)avance et recul Mouvement B3aHMHO napaJIJenbH0 cMeweme B BepTuKanbHoM HanpaBneHuu. senkrechte Bewegung oscilacion vertical rimbalzo dansen drgania pionowe vertikal sviingning 50(811) 0 811-08-05 - IEC Schlingern movimento de lanzadera serpeggio vetergang ; sinusloop drgauia wahadlowe w planie ; wciykowanie girning lacet Mouvement perturbateur de rotation autour de l’axe vertical. nosing hunting A rotary disturbing movement about the vertical axis. BuJlBHue BpaIIlaTW‘bHOe 811-08-06 galop Mouvement ABuXeHUe BOKpyT perturbateur BepTUKaJIbHOii OCU. Nicken galope galwo stampen ; galopperen drgania wahadlowe w pionie ; galopowanie nickning de rotation autour de l’axe transversal. pitching galloping A rotary disturbing movement about the transverse axis. ranonupoeaaue ,,pOAOJ'IbHafl KaWa BpauaTe,IbHOe 811-08-07 ABuXteHUe BOKpyr IIOnepeYHOii rOpu30HTanbHOfi OCU. Wanken inclination lateral rollio waggelgang ; waggelen drgania wahadlowe w plaszczyznie poprzecznej ; kdysanie vaggning roulis Mouvement perturbateur de rotation autour de l’axe longitudinal. rolling swaying A rotary disturbing movement about the longitudinal axis. 6oKoBbIe Koae6akum nonepeqeble KoJIe6aHun BpaII&-tTeJIbHOeABUXKeHUe BOKpyT IIpOAOJlbHOii SECTION rOpu30HTaAbHOfï OCU. 811-09 - GABARITS SECTION 811-09 - GAUGES PA3AEJI 811-09 - TABAPklTbI 811-09-01 gabarit Begrenzungslinie Dimensions, en coupe transversale, définissant les dimensions maximales permises des véhicules ou les distances minimales des installations fixes. galibo sagoma limite omgrenzingsprofiel Note. - Des définitions plus détaillées concernant les gabarits sont données par les fiches de l’Union Internationale des Chemins de fer. skrajnia Cross-sectional dimensions defining the maximum permitted vehicles or the minimum dimensions of fixed structures. Note. - More detailed definitions concerning gauges publications of the International Union of Railways. dimensions konstruktionsprofil of are given in the ra6apuT PasMepbI AOnyCTuMbIe pa3MepbI nonepeworo pa3MepbI cevemïa, eAuHUII CTaUuOHapHbIX CTpOeHuk flpKt.wfaHHe. - 6Onee MCTA. nOApO6HbIe Ily6nuKaquRx MaKCUMaJIbHble 0npeAenamwie nOABUXHOr0 COCTaBa onpeneneaua UJIU ra6apuToB MuHuMaJIbHbIe npuBeAeHb1 B 00001 811-09-02 36 - 50(811) 0 CE1 gabarit de rail de contact Contour qui embrasse toutes les sections transversales du rail de contact, de ses isolateurs, de ses supports et de ses organes de protection au-dessus du plan de roulement, compte tenu de la distance d’isolement par rapport aux pièces sous tension. Lichtraumprofil für Stromschiene galibo del rail de contacto sagoma limite della rotaia di contatto profiel van vrije ruimte voor de stroomrail skrajnia trzeciej szyny konstruktionsprofil f6r strtimskena conductor rail gauge A contour which contains a11 the cross-sections of the contact rail, the insulators, supports and safety devices above rail level, allowance being made for clearances around live parts. ra6apu’r KOHTBKTHOTOpWlbC2l OVepTaHue, penbCa B KOTOpOe u30nR~uOHHOrO II0 OTHOIIIeHuH3 BCC nOtIepe9HbIe u OIIOpaMkI 3aIIGiTHbIMu CeYeHUR KOHTâKTHOrO YCTpOF-ïCTBaMu MeXAy YaCTRMu, K 3TOMy OYepTaHuIO. IIpOMeXyTKa HaIIpHXeHUeM 811-09-03 BIIUCbIBalOTCR C u30nSITOpaMu, C yWTOM HaXOARLUUMuCII non gabarit d’isolement des pantographes Lichtraumprofil fuer Dachstromabnehmer galibo de aislamiento de 10s pantografos Contour a l’extérieur duquel doivent se trouver tous les obstacles au-dessus du niveau de la toiture des véhicules et qui embrasse les profils des divers sagoma limite del pantografo pantographes en usage, compte tenu des déplacements latéraux possibles et profiel van vrije ruimte voor de stroomafnemer d’une certaine distance d’isolement. skrajnia pantografu ..... pantograph clearance gauge A contour beyond which must be placed any iïxed structure above vehicle roof level, to allow any pantograph in use to pass safely, making allowance for lateral displacement of the pantograph and for passing electrical clearances. ra6apnT TOKOUpUk?MHUKOB OYepTaHUe, 811-09-04 B KOTOpOe BIIuCbIBaeTCII IIpOMeXyTKOM u C yWTOM 6OKOBbIX TOKOIIpUeMHUK u BHe KOTOpOrO C OIIpeAeneHHbIM KOne6aHUfi pa3MeIUaEOTCR nro6oi u30JIRWOHHbIM JKCIInyaTUpyeMbIii CTaLUiOHapHbIe KOHCTpyKIWU. gabarit de ligne de contact Contour qui embrasse les divers éléments sous tension d’une ligne aérienne de contact, compte tenu des distances d’isolement statique et à l’extérieur duquel doit être située toute autre installation. electrification clearance gauge Lichtraumprofil für Oberleitung galibo de la linea de contacto sagoma limite della linea di contatto profiel van vrije ruimte voor de bovenleiding skrajnia sieci trakcyjnej ..... A contour which contains the various live parts of an overhead contact line, allowance being made for static electrical clearances, and from which a11other fixed abjects must be kept clear. ra6apwr KOHTi3KTHOüCBTU OsepTamie, B KOTOpOe 3JIeMeHTbI BO3AyIIIHOfi npoMeXyTKa CTaUuOHapHbIe 811-09-05 u BHC BIIUCbIBalOTCff Bce KOHTBKTHOti KOTOpOrO HaXOAxIIwïeCR CCTU C AOnXHbI non y’ieTOM HanpnxeHueM u3OnRIluOHHOrO pa3MeLUaTbCSl BCC ApyrUe yCTpOiiCTBa. distance d’isolement (de la ligne de contact) Distance minimale permise entre des installations tension de la ligne de contact. fixes et les parties sous electrical clearance (of contact line) The minimum distance permitted ergized at contact line voltage. between CTpOCHuIIMu paCCTO5IHue, A YaCTIIMu, and parts en- . . . .. U30JlRUUOHHblti UpOME9KyTOK(KOHTaKTHOii MuHuMaJIbHOe fïxed structures Schutzabstand (zur Fahrleitung) distancia de aislamiento (de la Iinea de contacto) distanza d’isolamento (della linea di contatto) isolatie afstand odstep izolacyjny (w sieci trakcyjnej) CeTU) AOIIyCKaeMOe HaXOARIIJUMuCI1 IIOA MeXAy HanpSIXeHUeM. CTaIWOHapHbIMu 50(811) 0 IEC SECTION Ml-10 SECTION 37 - - CATÉGORIES 811-10 - TEST CATEGORIES PASAEJI 811-10 - KATEI’OPLlkl 811-10-01 (151-04-20) D’ESSAIS IKI-IbITAHkI$i essai de réception Abnabme, Priifung Essai contractuel ayant pour objet de prouver au client que le dispositif répond à certaines conditions de sa spécitïcation. ensayo de recepciOn prova di accettazione afnamekeuring proba odbiorcza acceptansprovning acceptance test A contractual test to prove to the customer conditions of its specification. that the device meets certain npweMo-cfiaro4uoe wcnbrranue OI’OBOpeHHOe AOKa3aTb B KOHTpaKTe 3aKa3YUKY IICIIbITaHHC, COOTBCTCTBPie IIpOBOAkïMOe AaHHOrO AJI5l YCTpOIkTBa TOTO, YTO6bI YCTaHOBneHHbIM Tpe6OBaHkïffM. 811-10-02 essai en ligne Probefahrt ensayo de Iinea prova in linea proefrit proba ruchowa ; proba liniowa driftprov Essai effectué sur des véhicules moteurs circulant sur une voie ferrée. running test A test carried out on a motor vehicle running on the railway. klCllblTaHlW 3rcnnyaraueoutroe 811-10-03 kkIbITaHHC, FIpOBOAHMOe Ha pa6oraromnx na Xenesnon nopore. TRI-OBMX CAkiHWaX IIOABWKHOrO COCTâBâ, essai en plate-forme Standpriifung ensayo en plataforma prova a1 banco beproeving bij stilstand proba stacjonarna stationar provning Essai effectué sur un banc d’essai ou sur un véhicule en stationnement. stationary test A test carried out on the test-bed or on a stationary vehicle. CTeHJ(OBOCWXlblTBHWl? MCIIbITaWR, IIpOBOAHMOe IIOABWKHOrO 811-10-04 (151-04-15) Ha CTeHAe WIEi Ha HeIIOABtiEHOfi CAHHWC COCTaBâ. essai de type Typpriifung Essai effectué sur un ou plusieurs dispositifs réalisés selon une conception donnée, pour vérifier que cette conception répond à certaines spécifications. ensayo f’P.O prova d’ t’p” typebeproeving proba typu typprovning type test A test of one or more devices made to a certain design to show that the design meets certain specifïcations. runonoe ucnbrranue KOHCTpYKUHH yCTaHOB,IeHHbIM 811-10-05 (151-04-16) Ha IIpOBOAHMOe kïCIIbITaHPïe, OnpeAeneHHoM OAHOM AJIR AJIH HeCKOJlbKAX YCTpOfiCTBaX COOTBCTCTBAII IIOATBep~AeHHn Tpe6OBaHWIM. essai individuel de série Stiickprüfung Essai auquel est soumis chaque dispositif en cours ou en fin de fabrication, pour vérifier qu’il satisfait à des critères définis. ensayo individua de serie prova individuale stukproef proba wyrobu rutinprovning routine test A test to which each individual device is subjected during or after manufacture to ascertain whether it complies with certain criteria. .......... @kIIbITaHWZ, IIpOBOAHMOe Ha KZKAOM II3TOTOBJIeHBR IlJIA IIOCJIe OIIpeAeJWHHbIM Tpe6OBaHARM. HeTO, C OTAeJIbHOM UeJIbFO YCTpOliCTBe IIpOBepKH er0 B npOUeCCe er0 COOTBeTCTBkïFI 811-10-06 (151-04-17) 38 - 50(811) 0 CE1 essai (de série) sur prélèvement Essai effectué sur un certain nombre de dispositifs lot. prélevés au hasard dans un sampling test A test on a number of devices taken at random from a batch. Stichprobenprüfung ensayo por muestreo prova (di serie) a campione steekproef proba wyrywkowa sampelprovning Bbl6OpO'lHOe UCllblTaHUe 811-10-07 McnbITaHwe, IIpOBOAHMOe IlpOH3BOnbHO 113 OAHOti Ha HeCKOnbKIIX yCTpOiiCTBaX, BbI6paHHbIX IlapTEïH. essai d’investigation Essai spécial de caractère facultatif informations complémentaires. qui est effectué en vue d’obtenir des investigation test A special test of an optional character carried out in order to obtain additional information. Ermittlungsprüfung ensayo de investigation prova di tipo facoltativa onderzoeksbeproeving proba (dodatkowa) badawcza specialprovning uccneuoaareJtbcuoe ucnbrrauae CnemïanbHoe IIpOBOAHMOe c Valeur approchée, appropriée d’une grandeur, utilisée pour dénommer identifier un composant, un dispositif ou un matériel. ou IJenbIO 811-11-01 (151-04-01) MCnbITaHMe IIOJI,WSHHSl HeO6R3aTenbHOrO xapaKTepa, AOnOnHHTenbHbIXAaHHbIX. valeur nominale Nenndaten ; NenngriMe ; Nennwerte .nominal value A suitable approximate quantity value used to designate or identify a characteristic of a component, device or equipment. va’or nomina1 valore nominale nominale waarde wartosc nominalna nominellt varde HOMUHaJlbHaR BeJlNWfHa COOTBCTCTBy~~CCnpa6nHHtCHHOe 0603HaYeHkiR 811-11-02 (151-04-03) mui onpeneneam 3Ha'IeHPïeBenWiMHbI,kiCnOnb3yeMOiiAnSl neTami, ycTpokcTBa mn o60py~oBaHm. valeur assignée Valeur d’une grandeur, fixée généralement par le constructeur, pour un fonctionnement spécifié d’un composant, d’un dispositif ou d’un matériel. rated value A quantity value assigned, generahy by a manufacturer, operating condition of a component, device or equipment. for a specifïed Bemessungsdaten ; BemessungsgMe Bemessungswert valor asignado valore di targa toegekende waarde wartoSC znamionowa m&kvarde ; pacueruafl aeoWuiua 3nasenne Ha BemiwHbI, 0npeneneHHbIe ycranannnsaeMoe npeuMymecrsenn0 H3roToBHTeneM 3xcnnyaraunn 3neMerrra, ycrpoiicrsa um ycnomn 06OpyAOBaHIm. 811-11-03 (151-04-04) caractéristiques assignées régime nominal (désuet) Ensemble des valeurs assignées et des conditions de fonctionnement. rating The set of rated values and operating conditions. napamerp COBOKynHOCTb paC9eTHbIX BenIIYIIH II yCnOBAfI JKCIInyaTaUUH. Bemessung caracteristicas asignadas ; régimen nominal caratteristiche di targa toeuekende erootheden charakterys&ki znamionowe ; zbior wartosci znamionowych markdata 50(811) 0 811-11-04 IEC - 39 - caractéristiques assignées d’un véhicule électrique Bemessungsdaten eines Elektrofahrzeuges caracteristicas asignadas de un vehiculo eléctrico caratteristiche di targa di un veicolo elettrico toegekende grootheden van een elektrisch rating of an electric vehicle voertuig The rating or, where appropriate the sum of the ratings, of the machines or charakterystyki znamionowe pojazdu other apparatus which limit the performance of the vehicle in a specified elektrycznego operating condition. markdata fih elfordon Caractéristiques assignées ou, le cas échéant, somme des caractéristiques assignées des machines ou autres appareils qui limitent les performances du véhicule pour un fonctionnement spécifié. napamerp eArreaubisne#TplrsecKoro ffapakferp OrpaHHWBaIOmHepa6oTy ycnosuax 811-11-05 noneaxHor0 unu cyr4Ma napaMerpoB CAHHAUbI CocTaBa Marnnn unu npyroro nOABHX(HOr0 060pyAOBaHBa, COCTaBaB OnpeAeJIeHHbIX sxcnnyaraukm. (caractéristiques en) régime continu Ensemble des valeurs assignées auxquelles le véhicule, la machine ou l’appareil est capable de fonctionner continuellement, sans dépasser les valeurs limites d’échauffement spécifiées pour un élément quelconque de cet ensemble. continuous rating Bemessungsdaten für Dauerbetrieb caracteristicas en régimen continu0 servizio continu0 ononderbroken toegekende grootheden ; toegekend continue bedrijf charakterystyki znamionowe pracy ciqglej markdata for kontinuerlig drift The combination of rated values at which the vehicle, machine or apparatus is able to operate continuously without exceeding for any part the specified limits of temperature rise. napamerp npo~onxuïrenbuoro COBOKynHOCTb 811-11-06 npeBbImeHMff peucaMa BeJIWIHH, r4amnHa unki annapar cocTaBa, 6e3 paC9eTHbIX AonycTRMoro npl4 Moryr KOTOpbIX pa60TaTb eAHHFiI!a npoAonxHTenbHoe nOABHW(HOr0 BpeMn neperpesa. (caractéristiques en) régime de courte durée Ensemble des valeurs assignées auxquelles le véhicule, la machine ou l’appareil est capable de fonctionner pendant une courte durée spécifiée, sans dépasser les valeurs limites d’échauffement pour un élément quelconque de cet ensemble. Note. - Si la durée spécifiée unihoraire. est d’une heure, le régime est appelé régime Bemessungsdaten für Kurzzeitbetrieb caracteristicas en régimen de corta duracion servizio di durata limitata toegekend korstondig bedrijf charakterystyki znamionowe pracy krotkotnvatéj markdata for korttidsdrift short-time rating The combination of rated values at which the vehicle, machine or apparatus is able to operate for a specified short time without exceeding for any part the specified limits of temperature rise. Note. - If the specified time is one hour, the rating is called the one-hour rating. napasterp uparuoapeMeunor0 pewnhra COBOKynHOCTb cocTaBa, paC%?THbIX Mammra wm BWIA'IAH, annapaT npH MoryT KOTOpMX eAMHMIla pa60TaTb B TeYemie nOABH~HOr0 3aAawioro KOpOTKOrOnpoMe~yTKaBpeMCH~6e3npeBbImeH~~AonycT~MoroneperpeBa. ~JUf,WeY2UfNe.OAHH 811-11-07 YaC,TO Ecnu TaKOki yCTaHOBAeHHbIti pf2KHM Ha3bIBaeTCII KOpOTKlli% npOMexyTOK COCTaBAReT YaCOBbIM. (caractéristiques en) régime intermittent Bemessungsdaten für Aussetzbetrieb Ensemble des valeurs assignées auxquelles le véhicule, la machine ou l’appa- caracteristica en régimen intermitente reil est capable de fonctionner, selon un service spécifié comportant des servizio intermittente intervalles de fonctionnement en charge alternant avec des intervalles de toegekend intermitterend bedrijf repos, sans dépasser les valeurs limites d’échauffement spécifiées pour un charakterystyki znamionowe pracy przerywanej élément quelconque de cet ensemble. markdata for intermittent drift intermittent rating A combination of rated values at which the vehicle, machine or apparatus is able to operate when on a specifîed duty whith on-load intervals alternating with off-load intervals without exceeding for any part the specitïed limits of temperature rise. 811-11-07 50(811) 0 CE1 napamerp nepeMeuuor0 pexehra COBOKynHOCTb paCYeTHbIX MamnHa COCTBBB, AonycTaMoro unu neperpesa uepenoaaane 811-11-08 40 - 6onbmoti BeJIWIBH, npn KOTOpbIX eAnHUUa nOABUaHOr0 6e3 npeBbIUIeHns B 0npenenennoM pexoiMe, npenycMa-rpusaromeM uarpysxn ri xonocroro xona. annapaT MOryT pa60TaTb grandeur en régime continu Valeur d’une grandeur électrique ou mécanique (puissance, courant, vitesse, effort de traction, couple, etc.) correspondant au régime continu d’une machine ou d’un véhicule, avec roues mi-usées et plein champ ou toute autre valeur de champ spécifiée. continuous (quantity) Dauer... magnitud en régimen continuo grandezza continua ; grandezza in servizio continu0 ononderbroken grootheid ; continue grootheid wartosc wielkosci przy pracy ciqglej kontinuerlig The value of an electrical or mechanical quantity (output, current, speed, tractive effort, torque, etc.) corresponding to the continuous rating of the machine or vehicle with half-worn wheels and at full field or other specified field values. (ueJuuuma) npouonuurrenbuoro pexuMa 3na4emIe 3neKTpwIecKoii unn MexannrecKoB TOKa,CKOpOCTu,CA,IbITIIrII,KpyTaIUerO XapaKTepncTUKe MaJlIEiHbI 811-11-09 nOJIeM eAAHnUb1 wIH PeXUMC. C HanOAOBUHy npOAOAXOITeAbHOM nOJIHbIM BenwiAHbI MOMeHTa AnII ApYrAMA 3Ha=EHWIMII (M~IIIH~~TII, crsnbI H T.n.),COOTBeTCTByIOmee nOABmKHOr0 u3HOUIeHHbIMM COCTaBa B KOAeCaMII II IIOnR. grandeur en régime de courte durée Valeur d’une quantité électrique ou mécanique (puissance, courant, vitesse, effort de traction,couple,etc.)correspondantaurégime de courte durée d'une machine ou d’un véhicule, avec roues mi-usées et plein champ ou toute autre valeur de champ spécifiée. Kurzzeit... magnitud en régimen de corta duracion grandezza (in servizio) di durata limitata kortstondige grootheld wartoSCwielkosci przy pracy krotkotrwalej korttids- short-time (quantity) The value of an electrical or mechanical quantity (output, current, speed, tractive effort, torque, etc.) corresponding to the short-time rating of the .machine or vehicle with half-worn wheels and at full tïeld or other specified field value. (BWltWliHa) KpaTKOBpeMeHHOrO PeXWMa 3na4enne 3nexrpmiecxoü wIw MexaHwecKoi- BenwiAHbI (MOUHOCTII, wnbI TOKa,CImbIT~rRTM,KpyTRmerOMOMeHTaIIT.n.),COOTBeTCTByH)meenapaMeTpy KpaTKOBpeMeHHOrO HanOJIOBnHy 3HaYeHnaMn 811-11-10 peXPiMa H3HOmeHHbIMH MaIUUHbI KOJIeCaMn nnn eAnHnUb1 M nOJIHbIM nOABWKHOr0 nOJIeM COCTaBaC IIIIII APJ’I’UMU nOAs. vitesse d’équilibre gleichbleibende Geschwindigkeit Vitesse du véhicule ou du train lorsque l’effort de traction totale à l’avancement s’équilibrent. et la résistance balancing speed velocidad de equi’ibrio velocità di regime evenwichtssnelheid prgdkosc ustalona balanserad hastighet The speed of a vehicle or train at which the applied tractive effort and the total resistance to motion are equal. J’CTaHOB‘,B”W,Cfl CKOpOCTb CKOpOCTb npkinoXeHHarr 811-11-11 AB~XeH~rte~~HUU~OAB~XHOrOCOCTaBa~n~~OC3Aa,~p~KOTOpO~ cnnaTnrH II nonaoe vitesse moyenne (entre arrêts) conpoT~BneH~fonB~xeIwn0 paBHbI. Durchschnittsgescbwindigkeit zwischen Quotient de la distance entre au moins deux arrêts par le temps mis à la Aufenthalten velocidad media entre paradas parcourir, déduction faite des temps de stationnement. velocità media gemiddelde snelheid (tussen halteplaatsen) average speed between stops predkosi: techniczna (miedzy przystankami) The quotient of the distance between two or more stops by the time taken to medelhastighet mellan uppehftll caver this distance, excluding stationary time. 50(811) 0 811-11-11 -41 - ABJ’MSI UJIU IEC rexuuuecuafl (cpeunexonoaaa) cuopocrb %CTHOe OT AWICHUR nyHKTaMU Ha paCCTORHU5I BpCM5I MCXA’j IIpOXOXAeHPIR 3TOrO 6onee PâCCTORHUR, OCTaHOBOYHbIMU UCK,IEOYaR BpeMR CTOIIHOK. 811-11-12 Reisegeschwindigkeit Quotient de la distance entre au moins deux arrêts par le temps mis à la velocidad comercial velocità commerciale parcourir, y compris les temps de stationnement. reissnelheid predkoli: handlowa schedule speed tidtabellsenlig hastighet The quotient of the distance between two or more stops by the time taken to caver this distance, including stationary time. vitesse commerciale YWCTKOBafl CKOpOCTb %CTHOe OT AWICHUII IQ’HKTaMA Ha paCCTOSIHU5I BpCMx MCXAY IIPOXOXACHUR AByMS 3TOl-0 UJIU 6onee OCTaHOBOYHbIMU PaCCTOHHUR, BKAEOYaR Bp‘.ZMa CTOIIHOK. 811-11-13 vitesse maximale (d’un véhicule) Vitesse maximale que le véhicule peut supporter en service normal. Note. - Cette vitesse, propre au véhicule, est limitée par des facteurs tels que la stabilité et la résistance mécanique des organes (par exemple des moteurs de traction). Hochstgeschwindigkeit (eines Fahrzeuges) velocidad maxima (de un vehiculo) velocità massima (di un veicolo) maximale toegelaten snelheid (van een voertuig) predkosc maksymalna (pojazdu) maximihastighet maximum speed (of a vehicle) The maximum speed allowable for a vehicle running in normal service. Note. - This speed, inherent in the vehicle, is limited by factors such as the stability and mechanical strength of the parts (e.g. of the traction motors). KOHCTPJ’KUAOHHBR CKOpOCTb(enUH&lUbI IlO~Bll~HOrO COCTBBB) h’kKCUMaAbHaZ4 npa CKOpOCTb, nopbmnbnol h)JHMc?YiUfyie. - YCTOtiiYUBOCTb noju3uxnoro 811-11-14 AOIl)‘CKaCM%I AJISI eAUHIIUb1 nOABUXHOr0 COCTaBa 3xcnnyaraumi. ,&2HH%l B CKOPOCTb pa6ore cocraaa U OrpaHUYCHa MCXaHUYeCKaR (HanpnMep, rsrosbrx TBKUMU @KTOpaMU, IIpOYHOCTb YJJIOB KaK CAUHUUbI .nanrareneH). vitesse en fin de réglage 1. Dans le cas de la régulation par résistance, vitesse obtenue dans des conditions déterminées, lorsque toutes les résistances sont hors circuit. 2. Dans le cas de la régulation par variation de tension, vitesse obtenue dans des conditions déterminées, lorsque la pleine tension d’alimentation des moteurs de traction est atteinte. Geschwindigkeit beim Erreichen der vollen Spannung velocidad a1 final del reglaje velocità (raggiunta) alla fine della fase di regolazione (in awiamento) snelheid bij bereiken volle motorspanning pqdkoJC nastawcza koncowa hastighet vid h6gsta korl%ge speed at end of notching 1. With resistance control, the speed obtained under given conditions resistance 2. With transformer tions when a11 is tut-out. when full voltage control, the speed obtained traction motor supply voltage under given condi- is reached. CKOpOCTb BblXOAa Ha aBTOMaTWCCKyl0 XapaKTepHCTUKy 1. B pexoïMe peocra-rnoro AaHHbIX 2. &,U yCJIOBU5lX, pCr)‘,IUpOBaHUU ,nocrnraeMaff na 811-11-15 KOl-Aa raroabrx ynpaanesnn BbIBeAeHbI HaqmKeHWI a sanannbrx ycnoanax - 3~0 BCC IIyCKOBbIe cKopocrb, Ha TpaHC@OpMaTOpC npn ~ocrmuenmi Aoc-rnraeMas B pe3UCTOpbI. nonnoro 3T0 CKOPOCTb, nanprrxenas Aanrarenax. .. . . . Dans le cas de la régulation par hacheur, vitesse obtenue dans des conditions déterminées, est lorsque la pleine tension d’alimentation des moteurs de traction atteinte. base speed With chopper traction motor control, the speed obtained supply voltage is reached. under given conditions when full Grunddrehzahl (Geschwindigkeit) velocidad base velocità a piena tensione snelheid bij volledige uitsturing predkosl podstawowa bashastighet 811-11-15 50(811) 0 CE1 CsopocTb 6asoaafl npH 42 - HMnyJIbCHOM 3aAaHHbIX peryJIEïpOBaHlU% yCJIOBl0TX npH - AOCTWKeHPI11 3T0 CKOpOCTb, nOJIHOr0 AOCTAraeMaSI HanpSDKeHMR Ha B TIIrOBbIX ABIWaTWISX. 811-11-16 Streckenhijchstgeschwindigkeit velocidad limite (en una section de la linea) velocità limite (di tracciato) snelheidbeperking vitesse limite (sur une section de ligne) Vitesse maximale autorisée sur un parcours donné, limitée par des facteurs tels que la constitution ou l’état de la voie et de la signalisation. prqdk&~ dopuszczalna(na odcinku tom) Note. - Il peut arriver qu’une section de ligne possède plusieurs vitesses limites, chacune s’appliquant à une catégorie particulière de véhicule. hastighetsbegransning speed restriction The maximum speed authorized factors such as the construction signalling. over a particular length of track limited by or condition of the track and the type of Note. - It is possible for a section of track to have more than one speed limit, each applicable to a different category of vehicle. cltopoc~a orpaeu=reene MaKCHMaJIbHaR CKOpOCTb, OrpaHHWIBaCMaX TaKAMH pa3peLIIaeMaR @aKTOpaMH, Ha OnpeAeJIeHHOM KaK y9aCTKe KOHCTpyKUHR HJIA nyTH, COCTORHlle nyrn, a Taroue cucreMofi cnreannsaunu. I7pyiMesamie. OAHOM CKOpOCTH nOABHaHOr0 811-11-17 Ha - orpaaareaxii II TOM B xe yYacTKe nyT&i C COOTB’STCTBHII BOSMOxHbI pa3HbIMH HeCKOJIbKO KaTerOpHRMU COCTâBa. Geschwindigkeitsverhaltnis (eigentlich FeldschwachverhWris) Rapport de la vitesse maximale en service à la vitesse au régime assigné à tasa de variation de velocidad champ maximal, pour le couplage donnant la plus grande vitesse. supporto di elasticità snelheidsverhouding speed ratio wspolrczynnik predkosci The ratio of the maximum service speed to the rated speed at full field with ..... the motors grouped for maximum speed. taux de variation de vitesse KO3~<PAUUBHTCKOpOCTU OTHOIIIeHHe MaKWMaJIbHOti HOMUHanbHOM peXU4Me 06eCneWiBalolIUiM 811-11-18 3KCnJIyaTaIlHOHHOii npH nO,IHOM MaKCAMaflbHyIO nOJIe CKOPOCTH C COeAIIHCHlleM K CKOpOCTII B ABWaTeneti, CKOpOCTb. effort de traction (à la jante) Effort longitudinal exercé à la jante des roues motrices traction fonctionnant en traction. par les moteurs de tractive effort (at the wheel rim) The longitudinal motoring. cuna TR~B (na o6oue uoaeca) KaCaTeJIbHaSi B TZ4rOBOM 811-11-19 force exerted at the wheel rim by the traction motors when Zugkraft (am Radumfang) esfuerzo de traction (en la llanta) forza di trazione (ai cerchioni) trekkracht (aan de wielomtrek) sila pociagowa na obwodzie k01 dragkraft vid hjulperiferi CMJIa, pa3BHBaeMa5I Ha o6one KOJIeCa TRrOBbIMII ABllraTenSiMH peHcHMe. effort au crochet Zugkraft am Zughaken Effort mesurable au crochet d’attelage d’un véhicule moteur ; sauf indication contraire, l’effort au crochet est défini en palier et en alignement. esfuerzo en e1 gancho forza (di trazione) a1 gancio trekkracht aan de trekhaak sila na haku dragkrokskraft draw-bar pull The force measured at the draw-bar of a motor vehicle ; unless otherwise indicated the draw-bar pull is referred to level tangent track. cana TR~B CnJIa, cocTaBa ua cuenue &isMepneMaR ; ecnA Ha np,IMOM Ha npn6ope TXrOBOl-3 eAEIHIIUb1 nOABWKHOr0 0~060, TO cnna Tarn na cuenxe onpenenserca CIIenHOM He oroeopeao rOpU30HTanbHOM yVaCTKe nyTH. 50(811) 0 811-11-20 IEC - 43 - puissance d’un véhicule moteur Puissance totale développée Leistung eines Triebfahrzeuges potencia de un vehiculo motor potenza d’un veicolo motore krachtvoertuigvermogen mot pojazdu silnikowego motoraxeleffekt par les moteurs de traction sur leurs arbres. output of a motor vehicle The total output developed MOIUHOCTL nOJIHaR 811-11-21 TflrOBOi-4 at the traction motor shafts. eAI(HWUbl MOILJHOCTL, IlOABWlCHOrO PaJBHBaeMaR COCTaBa TIIrOBbIMA ABHraTeJIS4Mkl Ha BaJIaX. puissance à la jante Puissance développée sur les essieux moteurs par les moteurs compte tenu du rendement global de la transmission. de traction, Note. - C’est le produit de l’effort de traction par la vitesse de translation véhicule. du Leistung am Radumfang potencia en la Ilanta potenza ai cerchioni vermogen aan de wielomtrek mot na obwodzie k01 effekt vid hjulperiferi output at the wheel rim The output developed at the driving axles by the traction motors taking into account the overall efficiency of the transmission system. Note. vehicle. It is obtained by multiplying MOlUHOCTb Ha MOqHOCTb, o6one KOJIWB pa3BkiBaeMaSI o6mero YYeTOM TSI-OBbIMII K03@@4HeHTa 811-11-22 Ha CKOPOCTb ABPiraTeJIRMA nOJle3HOrO IIpkiweyamfe. - Ona onpenenaerca KOJIeCa the tractive effort by the speed of the eAEïHllUb1 AeiiCTBPïa Ha Kax npoa3senenue nOABIGKHOr0 BeAJ’WHX CIICTeMbI cmbI OCRX, C nCpeAa9. Tsfm Ha o6oAe COCTaBa. puissance an crochet Puissance exercée au crochet de traction du véhicule. Note. - C’est le produit de l’effort au crochet par la vitesse de translation véhicule. du Leistung am Zughaken potencia en el gancho potenza al gancio vermogen aan de trekhaak mot na haku dragkrokseffekt output at the draw-bar The output developed at the draw-bar of the vehicle. Note. - It is obtained by multiplying vehicle. MOWHOCTb Ha ClJIXlKe MOIUHOCTb, 811-11-23 the draw-bar pull by the speed of the pa3BHBaCMaSI Ha CUenKe eAHHIIUbI nOABIUKHOr0 Z7pyrMeramfe. - Oua onpenenaerca xax npou3senenne Ha CKOPOCTb COCTaBa. CAIIHAUM nOABPDKHOr0 cmbI COCTaBa. Txm Ha cuenrte puissance massique spezifische Leistung par sa potencia especifica potenza massica vermogen per gewichtseenheid ; specifiek vermogen specific output mot jednostkowa (odniesiona do masy) power-to-mass ratio specifik effekt The continuous rated traction output of a train unit divided by its gross mass in working order. Quotient de la puissance continue de traction d’un élément automoteur masse brute en ordre de marche. Y~eJlbHafl MOIIIHOCTL OTHOIlIeHHe MOUIHOCTL Ha eJ(lfHlïUJ’ MBCCbI HOMAHaJIbHOk IIPOAOJImHTeAbHOM PeXWMe TIIrOBOil K MaCCe MOILIHOCTM ~PYTTO B MOTOpBarOHHOti pa60ueM COCTOIIHIIH. CeKqlWi B 811-11-24 50(811) 0 CE1 44 - consommation spécifique d’énergie d’un véhicule thermoélectrique Consommation d’énergie ramenée à l’unité de trafic. Note. - L’énoncé d’une consommation spécifique doit comporter, pour être complet, la désignation des unités respectives d’énergie et de trafic, mais aussi, en raison des rendements successifs des organes intéressés, doit indiquer l’endroit oh cette énergie a été mesurée ou évaluée. specific energy consumption of an electric vehicle The energy consumption per traffic unit. spezifischer Energieverbrauch eines elektrischen Triebfahrzeuges consuma especifico de energia de un vehiculo termoeléctrico consuma specifico (d’energia) di un veicolo termoelettrico specifiek energieverbruik van een elektrisch krachtvoertuig zuiycie energii jednostkowe (pojazdu elektrycznego) specifik energiforbrukning Note. - The expression of a specific consumption must, in order to be complete, state the energy and traffic units used and also, owing to the various efficiencies of the parts concerned, indicate where the energy input was measured or calculated. j’flCJ,bHblit paCXO,L, 3H‘Zpl-Mrt WCKTpWeCKOii eJViHlll4bl ,tOABHîXHOr0 COCTTBBa PaCXOn 3Heprua Ha eLuumuy o6aeMa nepeBo30K. LZpmfeuafzyie. BKJIIOYaTb He BbIpaHteHHe TOJIbKO o6aeMa yAeJIbHOr0 yKa3aHkIe B IteJIaX PaCXOAa COOTBeTCTByEOuero no n COCTaBa nOABEUHOr0 npOki3BOAHTeJIbHOCTb npOn3BOKnnn n3MepeHne mm yser 3Heprnn. eABHElAb1 811-11-25 nepeBo30K, nOJIHOTb1 pacXoAa AOJIXHO 3HeprHH x pa3nWiHym yYacTKax nym me yYATbIBaTb Ha Fahrzeugeigengewicht tara (de un vehiculo) tara (d’un veicolo) tarra (van een voertuig) ; eigen massa een voertuig) masa wlasna (pojazdu) taravikt ; tomvikt tare (d’un véhicule) Masse d’un véhicule à vide. tare mass (of a vehicle) The mass of an empty vehicle. MBCCB Tapb, (eA‘,HWL,bl Macca IIOpO~Heti 811-11-26 llO~Bll~HOl-0 eAHHI14bl COCTaBa) IIOABIIXHOrO COCTaBa. masse en ordre de marche Total de la tare et des masses afférentes au personnel de conduite et aux divers éléments nécessaires en service normal (sable, agrès, outillage, carburant, huile de graissage, etc.). Gesamtgewicht (Dienstgewicht) peso en orden de marcha massa in ordine di marcia dienstmassa masa sluibowa tjanstevikt mass in working order The total of the tare and mass of driving staff and of the various items required in normal service (Sand, breakdown equipment, tools, fuel, lubricating oil, etc.). cnyîice6uaa Macca CyMMi3 MaCCbI IIpeAMeTOB 3anacnbte 811-11-27 TapbI, MaCCbI Ei MaTepZUIOB, YaCTkI o6cJryxoïsammeti HeO6XOAPïMbIX kï mcTpyMeHTbI, ropIoqee, 6ptïraAbI AJIFi HOpMaJIbHOii cMa30YHoe II pa3JIMYHbIX pa6OTbI Macno (neCOK, II T.n.). charge par essieu Achslast (Radsatzlast) Somme des efforts verticaux que les roues d’un essieu exercent à l’état de repos sur les rails, en palier, la masse du véhicule à considérer étant la masse en ordre de marche. carga par eje caraco per asse ; massa per asse asbelasting nacisk osi axellast axle load Sum of the vertical forces which an axle of a stationary order exerts on the rails on level track. vehicle in working oceaaa trarpy3na CyMMa BepTAKaJIbHbIX nOABIIxHOr0 COCTaBa, rOp1130HTaAbHOrO HaTPYSOK C y’IeTOM yraCTKa nyTEI. OT KOJIeCHOii cnyxe6Hofi napb1 HenOABWKHOk MaCCbI, Ha peJIbCb1 eAIIHEIJ.IbI npSMOr0 (van 50(811) 0 811-11-28 IEC - 45 - poids adhérent Adh&sionsgewicht (Fahrzeugreibungsgewicht) Effort vertical exercé à l’état de repos sur les rails par les essieux moteurs et accouplés, le véhicule étant en ordre de marche. peso adherente peso aderente ; massa aderente adhesiegewicht masa przyczepna statyczna adhesionsvikt adhesive weight The total vertical force exerted on the rails by the driving and coupled axles of a stationary vehicle in working order. cuenuofi nec nOJIHaff BepTuKaJIbHaa HeIIOABPDKHOti cnyxe6Hoti 811-11-29 M COCTaBa Ha CIIapeHHbIX peJIbCb1 C OCeii yYeTOM MaCCbI. OT AeJIeHua nonHyIo cnyxe6Hofi MaCCbI CAHHAUbI IIOABWKHOI-0 COCTaBa Ha no 6yaepaM. ee AJIHHY Gewicht je Meter Fahrzeugltinge zwischen charge par mètre courant entre essieux extrêmes den Endradsatzen (Achsen) Quotient de la force de la pesanteur d’un véhicule en ordre de marche par la peso por metro lineal entre ejes extremos distance horizontale entre axes de ses essieux extrêmes. carico lineico (riferito alla distanza fra gli assi estremi) ; massa lineica (riferita alla weight per metre run between outer axles distanza fra gli assi estremi) The weight of a vehicle in working order divided by the horizontal distance gewicht per meter tussen de eindassen between centres of outer axles. masa na metr odlegtlosci osi skrajnych vikt per meter mellan ytteraxlar BtX HB IIOI-OHHbIii YaCTHOe MeTp OT AeJIeHna rOpu30HTaAbHOe 811-11-31 BeAymnX IIOABnHcHOrO Gewicht je Meter Fahrzeughinge (iiber charge par mètre courant hors tampons Puffer) Quotient de la force de la pesanteur d’un véhicule en ordre de marche par sa peso por metro lineal entre topes longueur totale hors tampons. carico lineico (riferito alla lunghezza totale) ; massa lineica (riferita alla weight per metre run over buffers lunghezza totale) The weight of a vehicle in working order divided by its total length over gewicht per meter over de buffers ; buffers. minimum gewicht masa na metr dlugosci ze zderzakami BW Ha IIOTOHHbIi( MeTp II0 6ycjrepah.t vikt per meter mellan buffertar YaCTHOe 811-11-30 OT Harpy3Ka eAuHuUb1 II0 KpaliH&iM cnyxe6Hoii paCCTOaHue OCRM MaCCbI MI%A)’ eAUHAUb1 UeHTpaMEI IIOABPDKHOrO KpatiHIiX COCTaBa Ha OCeii. charge concentrée maximale par mètre Valeur la plus élevée des nombres obtenus en divisant chacune des charges par essieu d’un véhicule en ordre de marche par la distance horizontale entre axes de chaque essieu considéré et de l’essieu le plus voisin. maximum concentrated weight per metre The highest number obtained by dividing each axle load of a vehicle in working order by the horizontal distance between centres of each axle in question and the nearest axle. MLNWJfMWIbHblïi Han6onbmee OT Ka~A0l-i Ha BW Ha I,O,-OHHbIü IIOJIy’IeHHbIX OCII CAHHHUbI rOpkï30HTaAbHOe CMexHOil 811-11-32 COCp‘$~OTOWHHbIü A3 3HaueHuii, IIOABWKHOrO paCCTOaHue MeTp IIp&i AWICHFïH COCTâBa, MexAy BeJIHYIIHbI C YYeTOM UeHTpaMn HBrpy3KII cnyme6soü MâCCbI, paCCMaTpuBaeMOn II OCeii. valeur de pointe (en traction électrique) Sur les véhicules moteurs dont le système de commande fini de crans ou de positions pour le démarrage comprend et le réglage Note. la jante. Ce terme s’applique plus particulièrement au un nombre de valeur “de pointe” est celle que prend la grandeur considérée après le passage d’un cran. la vitesse, la immédiatement courant et à l’effort à peak value (in electric traction) On motor positions vehicles for starting value of the quantity Note. - This term rim. Hochstgewicht je Meter Fahrzeughinge peso maxima concentrado por metro carico iineico concentrato massimo ; massa lineica concentrata massima maximale tonmetergewicht masa skupiona maksymalna na metr maximal axellast per meter where and the control regulation concerned applies especially includes of speed, immediately to current a delïnite the term number “peak” after taking and tractive of notches applies to or the a notch. effort at the wheel obere Spitze valor de entrada (en traction valore di eléctrica) puma Piekwaarde (bij elektrische tractie) ; topwaarde (bij elektrische tractie) wartoSCszczytowa (w trakcji elektrycznej) maxlmlvarde 811-11-32 nnuoaoe 3uaueuwe (B 3neKTpUsecKofi "nUKOBOe TepMUH 50(811) 0 CE1 46 - Tme) OTHOCUTW 3HaYemïe>' Be,IUYMHbI 3HaYeHUm K HenOCpeACTBeHHOnocnenepexoAac0A~0üno3U~UUUaApyry~~aT~ro~bIx nOABU~HOr0 eAUHUuaX onpeAenemtor0 UnU nepexnto9emïeM ynpasnaebrbrx COCTaBa, 9UcnanosUWi cTyneaeii Ans nycKaU PerynUpoBaHUa YâCTHOCTU,K CUJIe CKOpOCTU. ~j,,YMeYaHEie. cUneTmU 811-11-33 - flaHHbIE"S Hao6oAe TepMUH OTHOCUTCR,B TOKa A Koneca. untere Spitze valeur de reprise .? Sur les véhicules moteurs dont le système de commande comprend un nombre va1or de.re.c”perac’on fin.i de crans ou de positions pour le démarrage et le réglage de la vitesse, la valore dr ‘rpresa valeur qu’avait la grandeur considérée immédiatement avant le passage d’un waarde voor doorschakeling watto. przednastawcza cran. varde fore uppkoppling Note. - Ce terme s’applique plus particulièrement au courant et a l’effort à la jante. value before notching On motor vehicles, where the control includes a definite number of notches or positions for starting and regulation of speed, the value of the quantity concerned immediately before taking a notch. Note. - This term applies especially to current and tractive effort at the wheel rim. 3uaueuue BenIMBHbI cryneuraroro nycua 3HaYeHUe BeJIUYUHbI HenocpeAcTBeHHo Ha ApyryIO Ha TIIrOBMX nepexnm9emïeM nepexoAoM COAHO~~ cocTaBa, no3UUUU ynpaBnseMbIx onpeAeneHHorowicnano3UI@iunUcTyneHe~An~nycKaU perynUpoBaaUn c~opocTU. h&YMCYaHYre - &lHHbIil cune -rat-u Ha o6one 811-11-34 nepen noABuxcHor0 eAUHUIlaX T’ZPMUH OTHOCUTCR, B YaCTHOCTU, K CUJIe TOKa U Koneca. Sollwert valeur de consigne Sur les véhicules moteurs où certaines grandeurs sont contrôlées automativa1or se’eccronado quement, valeur choisie et imposée à un automatisme par le conducteur ou valore di consegna ; valore assegnato ingestelde waarde par un autre automatisme. wartosc zadana ; wartosi: zaprogramowana instZllningsv5rde selected value set value On motor vehicles on which certain quantities are automatically controlled, the value chosen and set by the driver or by a different automatic system. 3auaunoe 3uaueuue Ha TIII-OBbIX KOTOpbIX CAUHUIJaX IIOABU~HOI’O peryJIUpyIOTC5l BbI6paHHOe U aBTOMaTUW?CKOti COCTaBâ, aBTOMaTUSeCKU, OIIpeAeJIeHHbIe 3T0 MaIIIUHUCTOM yCTaHOBneHHOe unu BeJIUSUHbI, c nOMOIUbE0 CUCTCMLI. SECTION 811-12 - MOTEURS SECTION DE TRACTION 811-12 - TRACTION PA3AEJI 811-12 - TIITOBHE 811-12-01 BWIUYUHbI 3HaYeHUe MOTORS ABkITATEJII4 Fahrmotor motor de traction motore di trazione tractiemotor silnik trakcyjny traktionsmotor moteur de traction Moteur électrique entraînant un ou plusieurs essieux. traction motor An electric motor driving one or more axles. 3nexrpu~ecxufi oceü. ~mïrarenb, npUBOANIWii BO BpaLUeHUe OAHY Umi HeCKOAbKO 50(811) 0 811-12-02 IEC - 47 - moteur double moteur jumelé Moteur de traction comportant dans la même carcasse. Doppelmotor motor doble motore doppio (ad alberi paralleli) dubbelmotor silnik biliniaczy dubbelmotor deux induits portés par des arbres parallèles double motor A traction motor having two armatures mounted on parallel shafts in the same frame. CABOeHHbIii AB&IraT&Ib TSIrOBbIfï ABUraTenb, napannenbabIx 811-12-03 UMeEOII(Uti sanax B OAHOM ABa u TOM nKOpH, CMOHTUpOBaHHbIX Ha wte Kopnyce. moteur tandem Moteur de traction comportant un seul arbre. dans une même carcasse deux induits calés sur tandem motor A traction motor having two armatures mounted frame. on one shaft in a common Tandemmotor motor tandem motore doppio (ad albero unico) tandemmotor silnik dwuwirnikowy tandemmotor TBHAeM-ABNI’aTeJIb TIIrOBbIii TOM ABUraTenb, Xe Bany UMeIOIAUfi B o6wew ABa RKOpII, CMOHTUpOBâHHbIX Ha OAHOM u Kopnyce. _, 811-12-04 moteur à double collecteur Moteur de traction comportant calés sur un même arbre. dans une même carcasse deux collecteurs double commutator motor A traction motor having two commutators same frame. ~BJ’XKOJlJfeKTOpHbIfi TFIiOBMti ~AH~M 811-12-05 ABfN’aTCJIb ABUraTenb, u TOM Te mounted on the same shaft in the Doppelkommutatormotor motor de doble colector motore a doppio collettore motor met dubbele commutator silnik dwukomutatorowy motor med tva kommutatorer UMeHJWUk Bany B OAHOM ABa A TOM KOnneKTOpa, CMOHTupOBaHHbIX Ha wte Kopnyce. moteur fermé Moteur sans communication délibérée entre l’air extérieur et l’air intérieur, à l’exception des organes prévus pour la purge et l’équilibrage des pressions atmosphériques et ne comportant pas d’équipement pour le refroidissement interne. geschlossener Motor motor blindado motore chiuso gesloten motor silnik zamknigty helkapslad motor totally-enclosed motor A motor with no deliberate connection between the outside and inside air except for draining and breathing and not fitted with equipment for interna1 cooling. ABWaTCJIb ABUraTenb, MexAy TlfIIa KOHCTpyKLWiR HapyH(HbIM qacreii, AaBneHUII, BHyTpeHHeii 811-12-06 38KpbITOrO KOTOpbIC U KOTOpOrO BHyTpeHHUM CBR3aHbI U KOTOpbIü He C UCKnIOYaeT B03AyXOM OCyIIIeHUeM 06OpyAOBaH B03MOxHOCTb 3a coo6rueHurr uCKnH)‘ICHUCM BO3AyXa HeO6XOAUMbIMU U er0 yCTpOüCTBaMU AnII BeHTUnRUuU. moteur ventilé Moteur refroidi par de l’air prélevé à l’extérieur du moteur. ventilated motor A motor cooled by means of air introduced BeHTHJIlïpyeMblti ABUraTenb, TeX BbIpaBHUBaHueM from outside the motor. ,L(BUK-îTc?Jlb OXnaX(AaeMbIfi B03AyXOM, IIOAaBaeMbIM USBHe. beliifteter Motor motor ventilado motore ventilato geventileerde motor silnik przewietrzany ventilerad motor 811-12-07 48 - 50(811) 0 CE1 moteur fermé ventilé geschlossener beliifteter Motor (z. B. Mantelkühlung) motor blindado ventilado motore chiuso con ventilazione a mante110 uitwendig geventileerde motor silnik zamkniqty przewiewny ventilerad helkapslad motor Moteur construit de telle sorte que l’air de ventilation qui le traverse n’entre en contact ni avec les enroulements, ni avec le collecteur ou les bagues. ventilated totally-enclosed motor A motor SOconstructed that cooling air which passes through it does not pass over the windings, commutator or slip rings. BeHTWTupyeMbIii ABUraTeJIb38K,,bITOrO ABPIraTeJIb, KOHCTpyKuYISJ KOTOpOrO Hero OxnaXflaromero BoJnyxa, IUIH KOHTaKTHbIMH 811-12-08 TWna I’IpeAycMaTpHBaeT npoxoxAeHHe Yepe3 C 06MOTKaMa,KonJIeKTopoM He ConpHKaCarrCb KOJIbLIaMH. moteur autoventilé eigenbeliifteter Motor Moteur ventilé comportant un ventilateur lui-même son refroidissement. calé sur son arbre pour assurer motor autoventilado motore autoventilato zelfventilerende motor silnik samoprzewiewny sjiilwentilerad motor self-ventilated motor A ventilated motor with a fan on its shaft to provide its own cooling. ABllraTenb c CaMOBeHTHJlBuAe~ BeHTPIJlHpyeMbIti ABATaTeJIb, YCTaHOBJIeHHbIM 811-12-09 Ha er0 06OpyAOBaHHbIii BeHTWSITOpOM, II 06ecneWiBaEouWM er0 CaMOBeHTAXRWUO. BaJIy moteur à ventilation forcée Moteur ventilé dont la ventilation empruntée à son arbre. est fournie par une force motrice non force-ventilated motor A ventilated independent motor for which the cooling air is supplied of its own shaft. ABU,-aTk?Jlb C IlpUHJ’AUT‘SbHOù BeHTPinPIpyeMbIti CIUIOBOti 811-12-10 ABWaTenb, yCTaHOBKM, by a power source BCHTUJIHUHeii B KOTOpMti He 3aBEWIIIIeti OXJIalKAaIOJJ& OT BaJIa B03AyX IIOAaeTCir 01 ABHI-aTen% moteur à ventilation mixte Moteur comportant à la fois une ventilation Motor mit Eigen- und Fremdbeliiftung motor de ventilaci6n mixta motore a ventilazione mista motor met gecombineerde ventilatie silnik o przewietrzaniu mieszanym sjalv- och separatventilerad motor forcée et une autoventilation. motor with combined ventilation A motor fîtted with both forced and self-ventilation. flB,WaT‘?Jlb ABEïraTeJIb, CO CM‘WIaHHOti fremdbelüfteter Motor motor de ventilation forzada motore a ventilazione forzata motor met geforceerde ventilatie silnik o przewietrzaniu wymuszonym separatventilerad motor B‘3HTWUWWd 06OpyAOBaHHbIü KaK IIpHHyAHTenbHOii BeHTHJIZWHeii, TaK A CaMOBeHTIUlRUAeti. 811-12-11 ventilation axiale Ventilation dans laquelle l’air entre dans le moteur par une extrémité et passe longitudinalement à travers le moteur avant d’être évacué à l’autre extrémité. axial ventilation Ventilation in which the cooling air enters the motor at one end and passes longitudinally through the motor before being discharged at the other end. OCeBilll Bt?HTWlRUUfl BeHT&imuPin, KoHIJa Axial-Belüftung .I ventf’acfon axia! ventdaz’one ass’ale axiale ventilatie ; langsventilatie przewiew wzdhiny axiell kylning npn ABHraTen,, ~0~0p0ti A “pOXOAPIT 0xna~Aamwiti B03nyx ‘Iepe3 ABEII-aTeJIb, BeCb nocTynaeT npexAe C OAHOrO 9eM BbIiiTII yepes npyroii KOHW. 811-12-12 ventilation radiale Ventilation dans laquelle l’air de refroidissement rieur du moteur. Radial-Belüftung circule radialement radial ventilation Ventilation in which the cooling air inside the motor flows radially. à l’inté- venti’acion radia’ ventilazione radiale radiale ventilatie przewiew promieniowy radie11 kylning 50(811) 0 811-12-12 IEC paAaaabHan BeHTuJlfluAfl BeHTPïnSI~WI,IIpH paAHaJlbHOM 811-12-13 49 - ~0~0p0ti 0xnaxAarowGi B03AYX BABMraTeneABIIX(eTcR B HalIpaBneHlWL ReihenschluBmotor moteur série Moteur à excitation assurée l’enroulement d’induit. par un enroulement connecté en série avec series motor motor serie motore (ad eccitazione) in serie seriemotor silnik szeregowy seriemotor A motor with excitation armature winding. ABHraTenb, provided by a winding connected BO36yHcAaeMbIü 06MOTKOti, COeAUHeHHOir in series with the IIOCneAoBaTenbHo c 5IKOpeM. 811-12-14 moteur à excitation en dérivation moteur shunt Moteur à excitation assurée par un enroulement l’enroulement d’induit. connecté en parallèle avec A motor with excitation provided by a winding connected armature winding. napannenbeoro ABEiraTenb, 06MOTKOfi 811-12-15 shuntmotor silnik bocznikowy shuntmotor shunt motor AeuraTeab NebenschluOmotor motor shunt motore ad eccitazione derivata 06MOTKa in parallel with the Bo36yWfleHufl B036Y)f(AeHMR KOTOpOrO COeAMHeHa IIapaJInenbHO C RKOpII. moteur à excitation indépendante fremderregter Motor moteur à excitation séparée motor de excitacitm independiente motore ad eccitazione separata motor met onafhankelijke bekrachtiging Moteur dont l’excitation est alimentée par une source séparée. silnik obcowzbudny separatmagnetiserad separately excited motor A motor with excitation provided by an independent motor source. AnaraTenb He3anuCuMoro Bo36yXCAeHAR ABEiraTenb, 06MOTKa BO36yKAeHEiSI KOTOpOrO IIHTaeTCII OT He3aBUCHMOrO IICTOYHAKa. 811-12-16 Verbundmotor (DoppelschluBmotor) moteur compound Moteur a excitation en série et à excitation en dérivation additifs ou soustractifs. (ou séparée) à flux et l’excitation en excitation, Note. - When series excitation predominates and is opposed excitation, the motor is called a “differential shunt motor”. the two fields by the shunt AnuraTenb CMemaHHOrO BO36yXAeHna (COrJIaCHOrOBJIWBCTpeqHOrO) He3aBACUMOrO) HanpaBneHbI cornacHo - z$XfMeYaIfyie BCTpeYHO nocneAoaaTenbHor0 B036y~AeHAR Ecna wIa npeO6naAaHHeM npM 3~0~ if napannenbHoro(wn4 MAC 06~oToK MOryT 6bITb BcTpeYHo. nocneAoBaTenbHoe HaIIpaBJIeHHbIM Ha3blBaeTCII ; BO36y~AeHHe napannenbHbIh4 "ABwaTeneM nocneAoBaTenbHoro npeO6naAaeT BO36ymAeHUeM, BCTpe9HO-CMeIIIaHHOrO BO36yxneHkW”. sflnik szeregowo-bocznikowy kompoundmagnetiserad compound motor (cumulative or differential) ~B~raTenb,~MeIo~Gï06~0~~~ motore ad eccitazione composta compoundmotor Note. - Lorsque l’excitation en série est prépondérante dérivation soustractive, on parle de “moteur antishunt”. Motor with both series and shunt (or separate) assisting or opposing each other. motor compound HaA ABHraTenb BO36y)KAeHliH C motor SO(811) 0 CE1 811-12-17 kompensierter moteur compensé Moteur muni d’enroulements de compensation de la réaction d’induit montés sur l’inducteur. compensated motor A motor equipped with compensating armature reaction. tïeld windings to diminish the effect of Motor motor comfrensado motore compensato motor met compensatiewikkelingen gecompenseerde motor silnik skompensowany hompenserad motor KOMlK?HClipOBtWlBbli-i JlBUI’aTeJlb ~B&WaT‘Sb, CHa6XWIHbIfi ,&iCTBHR 811-12-18 (41 l-03-03) PeaKIWki KOMIICHCaUHOHHbIMH 06MOTKaMM AJI5l yMC?HbIIIeHPis RKOp% Gleichstrommotor motor de corriente continua motore a corrente continua gelijkstroommotor silnik prqdu stakgo likstrijmsmotor moteur à courant continu Moteur destiné a être alimenté en courant continu. direct current motor A motor for operation by direct current. ABUt-aTt?JlbllOCTOflHHO~O TON flBHraTC!nb, 811-12-19 IIpeAHa3HWIeHHbIii AJIR pa6OTbI Ha IIOCTOIIHHOM TOK‘A Einphasenwechselstrommotor motor monofasico motore monofase eenfasemotor ; wisselstroommotor silnik jednofazowy enfasmotor moteur monophasé Moteur destiné à être alimenté en courant alternatif monophasé. single-phase motor A motor for operation by single-phase alternating current. ABKWaTeab OAHO#a3HOrOnepCMeHHOr0 TOKa ~BWaTCJIb, IIpeAHa3HWIeHHbIYi Ha ,UJIff pa6OTbI OAHO@Zl3HOM IIepeMeHHOM TOKB. 811-12-20 Mischstrommotor motor de corriente ondulada motore a corrente ondulata motor voor pulserende stroom silnik pradu wyprostowanego ..... moteur à courant ondulé Moteur destiné à être alimenté en courant redressé. undulating current motor A motor for operation by rectifïed current. ABHlXTeJlb llJ’JlbCWpyw>LIVXO TOKB flBP%-iTenb, 811-12-21 IIpCAHa3HWICHHbIii ,lWI pa6OTbI Ha BbIIIpnMJICHHOM TOKe. moteur à courant pulsé Moteur destiné à être alimenté exemple à partir d’un hacheur. en courant pseudo-continu, obtenu par pulsed current motor A motor for operation by pseudo d.c. supplied Stromstellermotor (Chopper-Motor) motor de corriente pulsatoria motore a corrente pseudo-continua motor voor pulserende stroom silnik pqdu pulsujacego motor fi% pulserande strom e.g. by a chopper. nB&ll-aTtXb UMllyJlbCHOl-0TOKB &(BWaTeJIb, IIpeAHa3HPICHHbIü IlOJlyYaeMOM,HanpHMCp, 811-12-22 AJIR pa6OTbI OT AMIIyJIbCHOrO Ha IIyJIbCkipyIOLUeM TOKe, npeO6pa30BaTeJISL Dreiphasenwechselstrommotor motor trifasico motore trifase driefasenmotor ; draaistroommotor silnik trojfazowy trefasmotor moteur triphasé Moteur destiné à être alimenté en courant triphasé. three-phase motor A motor for operation Anurareab ~BtiraTCJIb, TOKe. rpex*a3uoro by three-phase nepesteuuoro IIpeAHa3HPICHHbIii alternating current. roua AJI5I pa6OTbI Ha TpCX&3HOM IICPCMCHHOM ; 50(811) 0 811-12-23 -5l- IEC Vielphasenwechselstrommotor motor polifasico motore polifase meerfasenmotor silnik wielofazowy flerfasfmotor moteur polyphasé Moteur destiné à être alimenté en courant polyphasé. polyphase motor A motor for operation Aeerarenb by polyphase Muorotha3uoro ~BHraTeJIb, alternating uepeMeuuor0 IIpeAHa3HaYCHHbIfi AJIX current. Toua pa6OTbI Ha MHOTO@3HOM IICpeMeHHOM TOKe. 811-12-24 moteur synchrone Synchronmotor Moteur à courant alternatif dont la vitesse est en rapport fréquence de son courant d’alimentation. synchronous constant avec la motor motor sincrono motore sincrono synchroonmotor silnik synchroniczny synkronmotor An alternating current motor in which the speed of the motor is in a tïxed ratio with the frequency of the current supplied. CAHXPOHHbIfi ABMI-aTL3lb ncpeMeHHOr0 TOKa, YaCTOTa BpameHuR KOTOpOr0 HaXOAHTCn B OnpeAcneHHOn 3aBnCnMOCTn OT YICTOTM TOKa, nMTZUOIIIeT0 ABHraTWb. fiBI$raTenb 811-12-25 moteur asynchrone Asynchronmotor Moteur motor asincrono à courant alternatif dont la vitesse n’est pas en rapport constant avec la fréquence de son courant d’alimentation. asynchronous motor motore asincrono assynchroonmotor silnik asynchroniczny asynkronmotor An alternating current motor in which the speed of the motor is not in a tïxed ratio with the frequency of the current supplied. aCUHXpOHHblüABWZlTeJlb flBnraTenb nepeMeHHor0 B OIIpC~WIeHEIO~ 811-12-26 TOKL, YaCTOTa BpameHHa KOTOpOrO He HaxOAnTcfl OT YaCTOTbI TOKâ, IIHTaIOIUerO ABuraTenb. 3BBIICIIMOCTII moteur à pleine tension Moteur réalisé pour Vollspannungsmotor fonctionner à la tension d’alimentation nominale du circuit de traction. full voltage motor motor a Nena tension motore a piena tensione motor voor volle spanning silnik na pefue napigcie ..... A motor designed to work at the nominal supply voltage of the traction circuit. Aenraresb uonuoro ABWaTWIb, IIpC.DHa3HWIeHHbIii HaIIpffxCHW 811-12-27 nanpflxteuefl B CNIOBOii LUISI pa6OTbI 3JIeKTpHWZKOii IIpEi HOMUHUIbHOM IlkïTaIOLUeM IWIIH. moteur à demi-tension Halbspannungsmotor Moteur réalisé pour fonctionner comme l’un d’une paire de moteurs constamment couplés en série, pour la tension d’alimentation nominale du motor a semit.ension motore a meta tenslone circuit de traction. half-voltage motor A motor designed series supplied uenrarenb permanently in ua 1/2 uanpuxeunn ABaraTCJIb, IIpeAHa3HSICHHbIii COCAUHeHHbIX CIUIOBOii to work as one of two motors connected at the nominal voltage of the traction circuit. ABHraTeeilCii, 3JI‘ZKTpWI’ZCKOii IWIH. AlE2 pa6OTbI B rpynIIC AByx nOcJtcAonaTeJ=Ho nnTaIOmuXC5r HOMAHaJIbHbIM HanpRxeHHCM motor voor halve spanning silnik na poI napiecia ..... 811-12-28 52 - 50(811) 0 CE1 moteur à tiers-tension Moteur réalisé pour fonctionner comme l’un d’un trio de moteurs constam- ment couplés en série, pour la tension d’alimentation nominale du circuit de traction. third-voltage motor A motor designed series supplied to work as one of three motors connected permanently in Drittelspannungsmotor motor a tercio de tension motore (alimentato) ad un terzo della tensione motor voor eenderde spanning silnik na jednq trzeciq napiecia ..... at the nominal voltage of the traction circuit. ABtlI’aTeJTbHa 113 HanpfImeHnB ABHI-aTWIb,IIpCAHa3HaYCHHbIti COeAkfHeHHbIX CYrnOBOü 811-12-29 AnS7pa6OTbIBrpynneTpeXIIOCneAOBaTenbHO IIIITaKUIJHXCII ABWaTeneti, 3JIeKTpWIeCKOii HOMHHanbHbIM HaIIpffXCHAeM UeIIEï. moteur à image-série Moteur à courant ondulé ou pulsé, à excitation séparée, dont le réglage du courant d’excitation permet l’obtention d’une caractéristique de couple semblable à celle d’un moteur série. simulated series motor An undulating or pulsed current motor with separate excitation, the fïeld current of which is controlled to give a torque characteristic resembling that Motor mit simulierter Reihenschluflcharakteristik motor serie simulado motore a immagine serie gesimuleerde seriemotor silnik symulowany szeregowy ..... (Kennlinien) of a series motor. ABliraTeJib C BO36j’îtcAeHW?M ABPfraTCJIb Il0 IIynbCPipyfOLIJerO BO36y?KACHkïCM, pCrynkïpOBaHHe XapaKTepHCTHKe llOCJle,UOBaTeJlbHO~O PïMIIynbCHOrO TOKP ABMTaTtYIR TOKa BO36yxAeHm spamatomero XapaKTepHCTHKj’ nonywïTb TWly HJIH C He3aBUCMMbIM KOTOpOrO n03BonReT aHanorwmym MOMeHTa, C IIOCnC~OBaTenbHbIM SECTION 811-13 - GRANDEURS B036yX~eHAfl BO36yXAeHPiCM. CARACTÉRISTIQUES DES MOTEURS SECTION 811-13 - TRACTION MOTOR CHARACTERISTIC PA3AEJI 811-13 - XAPAKTEPHCTHYECKHE 811-13-01 caractéristiques d’un moteur fournie par un moteur sous différentes conditions spécifiées. motor characteristic A statement of the speed, current, torque (or tractive effort) and power output of a motor operating under various specified VALUES BEJIMYkIHbI TIII-OBbIX ABHI-ATEJIEI;I Relevé de la vitesse, du courant, du couple (ou de l’effort de traction) et de la puissance DE TRACTION Motorcharakteristik (Motorkennlinie) caracteristicas de un motor caratteristiche di un motore motorkarakteristieken charakterystyka silnika motorkarakteristik conditions. napanrerpbt ~fuirare~n AaHHbI.2 MOUIHOCTII CKOpOCTH, ,WTaHOBJICHHbIX 811-13-02 TOKa, BpaIllaIOLIJCI’O npenna3ua9enuoro ABmaTenn, MOMCHTa Ans4 (PinI pa60TbI CHJIbI B TSI-H) I4 pa3nIwabIx ,‘CnOBIIRX. vitesse (d’un véhicule) Vitesse de translation Geschwindigkeit velocidad (de un vehiculo) velocità (di un veicolo) snelheid (van een voertuig) predkosi: (pojazdu) hastighet du véhicule. speed (of a vehicfe) The linear speed of the vehicle. CKOpOCTb(eAllHliUbl IIOABM~HOI-0 COCTaBa) &H&Ha~ 811-13-03 CKOpOCTb CAUHHIlbI vitesse (d’une machine IIOABIIXHOTO tournante) Vitesse de rotation de la machine. speed (of a rotating The rotational machine) speed of the machine. COCTaBa. Motordrehzahl velocidad (de una maquina rotativa) velocità di rotazione (di una macchina rotante) rotatiesnelheid ; toerental prqdkosc maszyny wirujqcej rotationsvarvtal 50(811) 0 811-13-03 811-13-04 IEC uac-rora upaureuufl (npamauuuer”tcfl MauBHbI) YrnOBaS MallIIIHbI. CKOpOCTb 53 - vitesse d’emballement survitesse Vitesse Schleuderdrehzahl velocidad de embalamiento de rotation maximale à laquelle sont essayés, en plate-forme, moteurs de traction et les machines tournantes électrique, pour vérifier leur tenue mécanique. overspeed les entrant dans l’équipement ve’ocità massima di prova overtoerental prqdkosf obrotowa rusningsvarvtal nadmierna (of a rotating electric machine) The maximum rotational speed to which traction motors and rotating machines forming part of the electrical equipment are subjected on the test bed to check their mechanical pa3rouuafl cwopocrb (spamaromekcrr Haa6onbmaz YaCTOTa nanrarenel BpaIIleHMn, 811-13-05 06OpyAOBaHHe, 3neKTpwecKoii AOIIyCKaeMaR ri npyrux TsroBbIx JneKTpwIecKoe strength. MaIIIAHbI) IIpH CTeHAOBbIX spamaromnxca AJIS IIpOBepKPi HCIlbITaHHSIX Matmut, BX~A~~IWX IIX MeXaHWIeCKOti B OpOYHOCTM. couple moteur motor(isches) Couple exercé sur son arbre, par un moteur traction. motoring de traction fonctionnant en torque The torque exerted on its shaft by a traction motor when motoring. Drehmoment par motor coppia (motrice) motorkoppel moment silnika motormoment BpalllalOLlWé MOMCHTTflTOBOrOABtlraTWfl MOMeHT, pa3BHBaeMbIk 811-13-06 couple de démarrage ABMraTeAeM correspondant starting torque (of a traction motor) nycuosou B Bany IIpki au courant moyen pendant la période corresponding apamaromau Bpamatomnti roxa Ha er0 pa6oTe B (d’un moteur de traction) Couple The motor torque period. 811-13-07 TRI-OBMM ‘EXUMe. TRTOBOM MOMeHT to the mean MoMenr (rzronoro ABMI-aTenff, de démarrage. current during the starting Motor-Anfahrdrehmoment par de arranque (de un motor de traction) coppia d’awiamento aanzetkoppel moment rozruchowy startmoment nsnrarens) COOTBCTCTByIOIUHii CpCAHeMy 3HaYeHIiIO nepuon sanycza. couple de pointe Couple rage. Motor-Spitzendrehmoment correspondant à la pointe de courant pendant la période de démar- peak torque The motor torque period. corresponding to the peak current during the starting par de pUma coppia di punta piekkoppel moment szczytowy maximimoment MaKCElMaJlbHbltiBpalUalOlUl8i-iMOMt?HT BpamaromuU 3Ha’ieHlilO 811-13-08 TOKa MOMeHT TIITOBOTO B IlCptiOA couple de freinage ABHI-aTenR, COOTBeTCTByfOIIWb IIEïKOBOMy JQ’CKa. (d’un moteur de traction) Couple exercé sur son arbre freinage électrodynamique. par un moteur de traction fonctionnant en braking torque (of a traction motor) The torque exerted on its shaft by a traction electrodynamic braking. TOPMOSHOfi MOMBHT(TRrOBOTO Bpamaromnii pa6oTe MOMeHT, B pCXPKMe motor when operating in ABMI-aTeJISI) pa3BABaeMbIb 3AeKTpOAUHaMWIeCKOTO TIITOBbIM ABEïraTeneM TOpMOXeHHR. Ha Bany IIpH Motor-Bremsmoment par de frenado (de un motor de traction) coppia frenante (d’un motore di trazione) remkoppel moment hamujqcy bromsmoment 811-13-09 puissance 54 - 50(811) 0 CE1 maximale Maximum gri%te Leistung de la puissance n’importe que les moteurs quelle condition à la fin de la période maximum sont capables de fournir sous de travail normal, à tension assignée, notamment de démarrage. output potencia maxfma potenza masslma maximale vermogen mot maksymalna maximal uteffekt The maximum output the motors are able to produce under any condition of normal operation at rated voltage, typically that at the end of the starting period. MaKCAMBJlbHaflMOIUHOCTL MaKCMMaJIbHaSI MOJ.LIHOCTb,KOTOpyK) MOryTpa3BkiBaTbTIIrOBbIeABMraTenH ByCnOBIIRXHOpManbHOii3KC~nyaTaUU~~p~yCTaHOBneHHOMHOMIIHanbHOM HaIIpSxeHEIYi 811-13-10 IIpeYrMyLIJeCTBeHHO courant de démarrage Valeur moyenne démarrage. starting B KOHIJe IIyCKOBOrO IIepUOAa. (d’un moteur de traction) du courant absorbé par le moteur pendant la période de (d’un motore di trazione) The mean value of the current taken by the motor during the starting period. CpeAHee traction) corrente d’awiamento current (of a traction of a motor) nycuonoti Motor-Anfahrstrom corriente de arranque (de un motor de aanzetstroom prqd rozrucho,vy startstrom ~o~(T~roBoro 3HaqeHHe AsmaTem) ToKa, nOTpe6nfIeMOrO TmoBbIM Asm-aTeneM B nepaon nycKa. 811-13-11 courant de pointe (d’un moteur de traction) Valeur maximale instantanée du courant absorbé pendant la période de démarrage. par un moteur de traction peak current (of a traction motor) The maximum instantaneous during the starting period. value MaKCUMSlbHUfi TOK (TmOBOrO Asurarenz) MaKCHManbHOe 3HaYeHlle AsnrareneM 811-13-12 MrHOBeHHOe re9euue B nycxoeoro of current taken by a traction TOKa, IIOTpe6nffeMOrO motor TIIrOBbIM les moteurs ou l’appareillage doivent normale- ment fonctionner, correspondant à la tension d’alimentation la plus haute en n’importe quel point du réseau de traction, à vide, en tenant compte des effets du freinage à récupération. tensfon maxima tens’one mass’ma max’ma’e spann’ng napiecie maksymalne maximisptinning voltage The specified corresponding under maximal startstrom Hijchstspannung spécifiée à laquelle maximum traction) corrente di punta (d’un motore di trazione) piekstroomprqd szczytowy (silnika trakcyjnego) nepaona. tension maximale Tension Motor-Spitzenstrom corriente de punta (de un motor de voltage at which motors or apparatus must operate normally, to the highest supply voltage at any point in the traction system no-load conditions, taking into account the effects of regenerative braking. MZ3KCUMB.iTbHO‘Z HaUpnweHUe YCTaHOBJIeHHOe3HaYeHHe @yHKuAOHUpOBaTb HaH6OnbILIeMy rnroaoii HaIIpSDKeHWl,IIpU ABlWaTenH IIEïTaKwJeMy ceru a ycno~mx HnH HanpffxeHmo xonocTor0 KOTOpOMAOnW(Hb1 aIIIIapaTb1 II B nm6oii xona unu KOTOpOe TOYKe HOpMaJIbHO COOTBeTCTByeT JneKTpWIWKOii c yYeroM pezyneparaeuoro TOpMOmeHHS?. 811-13-13 tension minimale Tension spécifiée traction, à laquelle minimum Mindestspannung correspondant si la tension les moteurs ou l’appareillage la plus basse du réseau de doivent fonctionner. voltage The specitïed voltage corresponding to the lowest traction system voltage at which motors or apparatus must work. tension minima tensione minima minimale spanning napiecie minimalne minimispanning 50(811) 0 811-13-13 IEC MnnnMaabnoe HanpnmeHne YCTaHOBJIeHHOe 3HaYeHlle HanpSDKeHHSI, 55 - COOTBCTCTByfOIWe HaPiMeHbLUeMy Hanp~~eH~H,3~eKTp~~eCKO~TRrOBO~CeTB,np~KOTOpOMAO~~HbIpa60TaTb neararenn 811-13-14 H annaparbr. Gleichrichterspannung tension ondulée Valeur moyenne d’une tension d’un courant alternatif ayant toujours le même signe. undulating monophasé voltage The mean value of the voltage of a rectifïed single-phase having always the same sign. uyabcepyromee alternating current Tension ondulée dont la composante alternative prend une valeur telle qu’elle entraîne l’annulation périodique de la tension. pulsed voltage An undulating voltage, the alternating component that the voltage is periodically reduced to zero. of which has a value such cocrasnnrometi rianps~eriue, tension de transformation y zoroporo 3uaYeuHe pulserande spanniag nepeMennoii (dans une machine à collecteur à courant alternatif Force électromotrice produite dans les enroulements variations périodiques du flux de l’inducteur. transformer e.m.f. (in an alternating or undulating d’un induit par les or pulsed current commu- tator motor) The electromotive force produced in the armature by the periodic variation of the flux arising from the field system. TpaHC#OpMaTOpHaH WteKTpOABHXymafl CIiaa nepeMeHHoro,nynbcHpyIouero %eKTpOABWi(y~aSl nepaoAa~ecKoro mni CAJIa, CO3AaBaeMaS H3MCHCHIIII (B KOJIJIeKTOpHOM mmynbcHor0 B MarHIITHOrO 06MOTKe nOTOKa (in a commutator FIKOpR B CACTeMe nanpnuteHun motore a collettore) transformatorische spanning napiecie transformacji (w silniku komutatorowym) transformator-emk B pe3yJIbTaTC BO36yXAeHHR. MeîHAJ’ IlJlaCTuHaMu (B mittlere Lamellenspannung tension media entre segmentos maquina differenza (en una de colector) di potenziale media tra lamelle (di una macchina machine) The voltage between adjacent brush boxes divided by the corresponding number of commutator separators not situated under the brushes. 3nauenHe colector de corriente alterna o modulada 0 pulsatoria) forza elettromotrice trasformatorica (d’un ABkiraTenC Quotient de la tension entre les balais (ou rangées de balais) les plus proches par le nombre correspondant d’entre-lames non situés sous les balais. mean voltage between segments transformatorische EMK tension de transformacion (en un motor de TOKa) tension moyenne entre lames (dans une machine 51collecteur) cpeuHee (pulsierende nepHoAHrecxr4 yh4enbmaercz ~0 uynff. ou ondulé ou pulsé) 811-13-17 Stromstellerspannung Spannung) tension pulsatoria tensione pulsante pulserende spannig napigcie pulsujace uanpnnteHee fIynbcapyromee 811-13-16 tensione ondulata gelijkspanning met rimpel napiecie tetniqce vagsptinning OAHO@a3HOrO tension pulsée nmnyabcaoe (Mischspannung) .I tension Ondulada uanpfuxeuue 3rraYnene nanpnxteuHn BbInpRMneHHOrO Cpennee nepeMeuuor0 roxa, nMeromer0 acerna onnn 3uax. 811-13-15 redressé a collettore) gemiddelde lamelspanning napiecie miedzydziafkowe medellamellsp~nning Srednie KOJIJIeKTOpHOii MaJnMHe) Hanpsxteune MeXAy COOTBeTCTByIOIIIee 811-13-18 COCeAHIIMII YMCJIO IIIeTKOAepXaTeJUIMPi, npoananorc MemnaMenbHoil paCnOJIOXCHHbIX nOA tension maximale entre lames (dans une machine à collecteur) nenemoe na u30namnï, He WeTKaMII. Tension maximale entre deux lames adjacentes de collecteur pour toutes les conditions se présentant en service normal. maximum voltage between segments (in a commutator machine) The maximum voltage between two adjacent commutator conditions found in normal service. segments under any maximale Lamellenspannung tension maxima entre segmentos maquina (en una de colector) differenza di potenziale massima tra lamelle (di una macchina a collettore) maximale lamelspanning napiecie migdzydziatkowe maksymalne maximal lamellspanning 811-13-18 MaKCnMa.3bHOe HanpfliKeBHe 56 - 50(811) 0 CE1 Me3icBy nBacrBnaMH (a KOnneKTOpHOM ABmaTene) MaKCHManbHOe HaIIpSJXeHW.? nnacTaHam B nm6bIx MeZAy AByMS yCnOBPiax, COCeAHIIMH KOnneKTOpHbIMH C03AaEOLLtAXC~ HOpManbHOü wH 3KcnnyaTaum. 811-13-19 plein champ Pour un moteur série, condition selon laquelle le flux des pôles principaux est constitué par le courant normal d’excitation (c’est-à-dire le courant d’induit) circulant à travers tous les enroulements des pôles principaux. full field volle Erregung camp0 pleno pieno camp0 vol veld wzbudzenie pehte fullt fait In a series motor, the circuit condition in which the main pole flux is formed by the normal excitation current (i.e. armature current) flowing through a11the turns of the main field winding. lIOJ3HOeuOJleB036y2BBeHWR PexnM 811-13-20 pa6OTbI ABm-aTenrr IIOTOK rnaBHbIX IIOJIlOCOB TOKOM $TKOpa), nocnefloBaTenbHor0 C03AaCTCII IIpOXOA~LIIHM II0 B036yXAeHA%, HOpManbHbIM BCeM BEITKaM TOKOM 06MOTKEf npH KOTOpOM (T.e. B036yTAeHAR rnaBHbIX IIOJIIOCOB. champ réduit Feldschwachung campo débil Pour un moteur série, condition selon laquelle le flux des pôles principaux est campo indebolito ; indebolimento zwak veld réduit par des prises donnant un nombre réduit d’enroulements des pôles principaux, ou par réduction du courant normal d’excitation, par exemple par wzbudzenie osfabione shuntat fZlt dérivation de ce courant dans une résistance. shuntage (déconseillé) weak field In a series motor, the circuit condition in which the main pole flux is reduced by tapping to a reduced number of main field coi1 turns or by reducing the field coi1 current e.g. by a shunt resistor. oCBa6JIeHHOe noae BO36yXîBeHHB PeXUM pa6OTbI nOTOK BKnIOYCHHbIX TOKa pe3ncTopa, nocne~oBaTenbHoro IIOJIIOCOB BHTKOB yMeHbIUCHHS 811-13-21 ABEiraTeJIR TJIaBHbIX KaTyIIIKH 3a BO36yXneHEUl BO36yXAeHFïR, LLIyHTHpyKWCrO B036yXAeHMR, yMeHbIUaeTC2 HaIIpHMep, 06MOTKy CseT I-JIaBHOrO KOTOpOM wcna IIOJIEOCa IUIII lIOCpeACTBOM B036yXAeHMR IIpH YMeHbIIIeHHR 3a CSeT COIIpOTPfBJIeHWl rJIaBHbIX IIOJIIOCOB. champ maximal Champ correspondant d’excitation. maximum au flux maximal produit pour le courant maximal field The condition in which the machine maximum designed field current. lïeld windings are supplied with the maximale Erregung camp0 maxima eccitazione massima maximaal veld wzbudzenie maksymalne maximifalt MaucnMaBbHoe noae PexAM, npn HaH6OnbLWiM 811-13-22 KOTOPOM o~MOTKA YCTaHOBneHHbIM TOKOM B036yXAeHHR ABHraTeJIeir nIITaK)TCR BO36yXAeHua. champ minimal Champ correspondant d’excitation. minimum au flux minimal produit par le courant minimal field The condition in which the machine minimum designed field current. lïeld windings are supplied with the MHHHMaBbHOenOJIe PexnM, npri MHHAManbHbIM ~0~0p0M 06MOTKH YCTaHOBneHHbIM Bo36yXneHHn TOKOM flsnraTenefi BO36yXAeHua. nnTaH)TCII minimale Erregung camp0 minimo eccitazione minima minimaal veld wzbudzenie minimalne minimifalt di campo 50(811) 0 811-13-23 IEC - 57 - champ renforcé Disposition Feldverstarkung dans augmenté, laquelle le courant d’excitation par une source indépendante, d’un moteur à une valeur supérieure courant induit, en général pour réduire la période série est à celle du de démarrage. forced field campo reforzado eccitazione rinforzata versterkt veld wzbudzenie wzmocnione forcerat fait An arrangement in which the field current of a series motor is augmented from an independent source to a value greater than the current in the armature, usually to shorten the starting period. ycnneeBoe none Bo36yxcflenm PemlM pa6OTb1, He3aBHCHMOTO B036)0KAeHWI EïCTOSHMKa A0 6onbmero ABHI-aTeJIS4 BO36yxAeHHa yBf2IHYPiBaeTC5l 3a 3HaYeHIIR, YeM CYeT IlkiTaHHsI TOK RKOpR, OT 06bIYHO C coKpameHYiff nep5ïona nycsa. uenbm 811-13-24 TOK KOTOPOM nPa IIOCJIeAOBaT’.%IbHOrO (taux d’)affaiblissement de champ Feldschwachgrad Dans les moteurs série, rapport de la diminution principaux l’induit. au nombre maximal d’ampère-tours (field) weakening des ampère-tours des pôles pour un même courant dans ratio As applied to series motors, the ratio of the reduction in ampere-turns in the main field winding to the maximum ampere-turns for the same current in the armature, CTeneHb ocna6Aeuun &NïMeHPïTWIbHO 811-13-25 ABIWaTeJISM KOJIWIeCTBa aMIIep-BHTKEi 06MOTKH aMIIep-BHTKOB l’Ipti IIOCJI’.?AOBaTWIbHOI’O aMIEp-BHTKOB, I-JIaBHbIX OAHOM II TOM Ha IIOJIlOCOB, xe TOKe B036yxAeHUR KOTOpOe shu”t”i”gsgrad K - YMeHbIIIeHbI MaKCHMaJIbHOMy WCJIY IIKOPII. (taux de) champ résiduel taux d’excitation Dans les moteurs série, rapport des ampère-tours des pôles principaux restant, après l’affaiblissement du champ au nombre maximal d’ampère-tours, pour un même courant dans l’induit. Note. - ; tasso d’indebolimento (del campo) veldverzwakkinggraad ; veldverzwakkingsverhouding wspticzynnik osfabienia wzbudzenia ao36yXaenufl K OTHOIUeHUe (porcentaje de) shuntado (del campo) g rado d’indebolimento La somme du taux d’affaiblissement de champ et du taux de champ (effektiver) Erregergrad (porcentaje de) campo residual grado d’eccitazione ; tasso d’eccitazione veldverhouding wspticzynnik wzbudzenia (resztkowego) magnetiseringsgrad résiduel est égale à l’unité. (effective) field ratio As applied to series motors, the ratio of the main field ampere-turns remaining after field weakening to the maximum ampere-turns for the same current in the armature. Note. - The sum of the field weakening ratio and the effective field ratio is equal to unity. CTeneab ao36yXAeann Ko3<PQnqnenT nonn ao36yXAeanfl npHMeHPiTeJIbH0 K OTHOIIIeHlle aMIIep-BHTKOB IIOCJIe IIpU %iCJIa ocna6neaas OAHOM l7pm4eramfe. - 811-13-26 IIOCJIeAOBaTeJIbHOl-0 06MOTKH BO36yKAeHtiR, Ii TOM B036YEAeHAR ABHraTeJIRM wte TOKe CJ’MMa PaBHa T,IaBHbIX BO36yxAeHHs IIOJIIOCOB, K MaKCMMaJIbHOMj’ YEïCJIy - OCTalOIl(AXCH aMnep-BHTKOB B RKOpe. CTeIIeHki oma6neHm BO36yxAeHm II cTeneHH eA&iHUue. taux de souplesse Rapport (Feldschwtich) de la vitesse à champ minimal à la vitesse à champ maximal, pour le courant assigné à plein champ. flexibility ratio The ratio of the speed at minimum fïeld to the speed at maximum field at rated full fîeld current. K03@@AUACBT lll6KOCTU IlOJlfl OTHOLIIeHMe MaKCHManbHOM CKOPOCTM IIOJIe npPi AJISI TOKa MAHPlMaJIbHOM HOMFIHa.JIbHOTO IIOJIe PexUMa K IIpH CKOPOCTEI IIOJIHOM nPA nOJIe. flexibilidad Drehzahlverhiiltnis de la tract%” coefficiente d’elasticità regelbereik wspolczynnik elastycznohci shuntomrade (obrotowej) 811-13-27 50(811) 0 CE1 58 Haupt(pol)fluB flux principal Flux produit par les pôles principaux d’une machine, distinct de celui des autres pôles, par exemple des pôles de commutation. main flux flujo principal flusso principale hoofdpoolflux strumieh gf6wny huvudflode The flux produced by the main poles of a machine as distinct from other poles, e.g. commutating poles. ~OTOK, CO3AaBaeMblM 811-13-28 TnaBHbIM HanpnMep, II~JWJCOB, nonw2aMu A06aBoYHbIx MaIIIHHbI B 0Tnwwie (K~MM~TII~~K)WIX) OT ApyrHx nOJII0coB. densité linéique (électrique) 1. Dans le cas d’une machine, nombre moyen d’ampères-conducteurs de l’enroulement d’induit par unité de longueur de la périphérie de l’entrefer. 2. Dans le cas d’un enroulement teurs de cet enroulement réparti, nombre par unité de longueur moyen d’ampères-conduc- de la périphérie de l’entrefer. Strombelag carga eléctrica ; densidad lineal densità lineare (di corrente) stroombelegging gestoic ohwodowa prqdu str6mbelüggning electric loading 1. Of a machine, the average ampere-conductors unit length of the air-gap of the primary winding 2. Of a distributed winding, the average ampere-conductors unit length of the air-gap periphery. 3fielcTparecltafl 1. B cnyrae 06MOTKH SIKOps 2. B (neHelaaa) MaInWHbI BO3AyIIIHOrO 811-13-29 CpeAHee Yucno AJIHHbI 3TOii aMnep-IIpOBOAHHKOB OKpyXHOCTII pacnpenenarenbaoii cnyqae of the winding per aarpy3Ka - Ha eAPIHHUy aMIIep-IIpOBOAHHKOB per periphery. 06MOTKn 06MOTKH Ha OepBHYHof BOSAyUIHOTO - eAHHHQy 3a3Opa. cpenaee AAHHbI YUCIIO OKpyXHOCTA 3a3Opa. vitesse périphérique Vitesse tangentielle, en un point de la surface périphérique, rotation, exprimée en distance par unité de temps. peripheral d’un corps en speed The speed of movement of a point on the surface of a body rotating about its axis expressed as a distance per unit of time. Umfangsgeschwindigkeit velocidad periférica velocità periferica omtreksneldheid predko% obwodowa periferihastighet OKPYXHaRCKOpOCTb CKOpOCTb CBOeii 811-13-30 ABPDKKeHIIR TOYKII OCPI, BbIpaXaeMan Ha IIOBepXHOCTl4 OTHOUIeHABM Tena, Bpauamuerocx paCCTOIIHHR K ‘ZAIIHllUe BOKpyr BpeMeHM. Grenziibertemperatur limite d’échauffement Echauffement maximal autorisé aux essais pour une machine ayant une isolation d’une classe donnée. temperature rise limit The maximum temperature particular rise allowed in rating tests of a machine having a I . ‘lm1te de cale”tam’ento temperatura masslma temperatuurverhogingsgrens nagrzanie graniczne maximalt tillaten temperaturstegring class of insulation. npenen aarpeaa MaKCEiMaJIbHbIii HarpeB, AOnyCKaeMbIii HOMAHanbHbIX IlOATBepXAeHUR IIpH 3HaYeHH6 MCIIbITaHWJX Ans MaUIBHbI KOHKpeTHOI’O AJIR Knacca I43OJIRwIu. 811-13-31 température Limite Grenztemperatur limite donnée comme température maximale en service, pour une classe donnée d’isolation. limiting temperature The recommended insulation. permitted maximum temperature in service for a class of temperatura r . ‘lm’te temperatura ammissibile maximale toegestane temperatuur temperatura dopuszczalna granstemperatur 50(811) 0 811-13-31 IEC npefleflbaafl TeMnepaTypa PeKOMeHAyeMafl AOnyCTuMaSi 3xcnnyaraunu 811-13-32 59 - température nnH MaKCUManbHaR KoHKpeTHoro Knacca TeMIIepaTypa B yCnOBuSIX u3onxunu. ambiante Température, Umgebungstemperatur déterminée dans des conditions prescrites, de l’air entourant complètement un moteur ou un appareil (par exemple pour un moteur totalement clos, c’est la température de l’air extérieur au moteur). ambient air temperature temperatura ambiente temperatura ambiente omgevingstemperatuur temperatura otoczenia omgivningstemperatur The temperature, determined under prescribed conditions, of the air surrounding the complete motor or apparatus (e.g. for a totally enclosed motor, it is the temperature of the air outside the motor). TeMnepaTypa orcpyirtatomeii cpenbl OnpenenneMan npu 3aAaHHbIX YCJIOBUSIX TeMIIepaTypa BOJAyXa, oxpy~atomero Becb nnurarenb unu annapar (HanpnMep, nnff ABuraTens 3axpbrroro Tuna -3~0 rebmeparypa nosnyxa ceapyxa nnurarena). 811-13-33 classe d’isolation Isolierstoffklasse Repère dans une nomenclature appliquée à un matériau d’isolation utilisé dans les machines ou appareils électriques et spécifiant la nature des “ase de aislamiento c’asse d’iso’amento matériaux Note. - et la limite de température Des isolants recommandée. de classes inférieures peuvent être utilisés pour les isolatieklasse klasa izolacji isolationsklass éléments qui ne sont pas soumis aux températures les plus élevées, sans pour autant abaisser la classification du système isolant comme un tout. class of insulation A standard classification applied to an insulating material for use in electrical apparatus and machines and specifying the nature of the material and a recommended limiting temperature. Note. - Lower class materials may be used in parts not subject to the highest temperatures without lowering the classification of the insulating system as a whole. Knacc u30n~gnn xnaccu#ixauns, CTaHAapTHaR npnMenneMaa K u30JIRlWïOHHbIM MarepnanaM, ncnonb3yeMbIM B 3nexrpnrecKnx annaparax onpenennmmaa xapart-rep Marepuana u peKoMeHnyeMyIo TeMnepaTypy. I7pMi1eyamfe. 811-13-34 II Mamnnax, u npenenbayw -h4aTe.pUanbI6onee~u3KoroKnacca~0a~0ucnonb30BaTb~ ‘KICTIIX, HenOABepraK)~UXC~B03Ae~CTBUH3CaMbIXBbICOKUXTeMnepaTyp,He c~kïxas npu 3~0~ Knacca cucTeMb1 usonffquu B qenoh4. auto-excitation Selbsterregung En freinage électrique, amorçage naturel par le flux rémanent de l’excitation d’un moteur fonctionnant comme génératrice série. autoexcitacion self-excitation The natural establishment of excitation from residual magnetism when using a traction motor as a series generator autoeccitazione zelfbekrachtiging samowzbudzenie sjalvmagnetisering in electric braking. CaMOBO36yîKACHUC B pexoibre ABuraTens 3nexrpmiecxoro BO36yxAeHue 811-13-35 Toph4o~enurr C ucnonb30BaHueh4 B Ka'lecTBereaepaTopanocnenoBaTenbaoro B pe3ynbTaTe OCTaTOSHOrO B036yEAeHUx TwoBoro - 3~0 MarHeTu3Ma. préexcitation Vorerregung En freinage électrique, amorçage de l’excitation d’un moteur fonctionnant comme génératrice par une source extérieure (par exemple une batterie), lorsque l’excitation ne peut pas être obtenue par le flux rémanent ou que le Rreexcitacion Rreeccitazione temps d’établissement est trop long. pre-excitation In electric braking when using a traction motor as a generator, the establishment of excitation from an external source, e.g. a battery, where residual magnetism long. is unable to initiate proper excitation or the response time is too voorbekrachtiging dowzbudzenie ; wzbudzenie f<v%ckningsmagnetisering wstgpne 811-13-35 60 - 50(811) 0 CE1 npe~BO36yx~eHue B peWIMe 3JIeKTpUW3CKOrO TOpMO)KeHUU C UCnOJIb30BaHUeM TRrOBOrO 3T0 BO36y?KBeHUe OT BHemHerO B KaUecTBe reaepaTopa UCTOUHUKa, HanpUMep, aKKyMyJIIITOpa, KOrAa MarHUTHOe nOJIe OCTaTOYHOrO AmraTenx MarHeTU3Ma He B COCTOUHUUBbI3BaTb Tpe6yeMOrO BO36y~AeHUa UBU BpeMa HeO6XOnUMOrO CaMOB036yWIeHUR CJIUIIIKOMBeJIUKO. 811-13-36 commutation Dans funkenfreie Kommutierung conmutacitm negra commutazione nera zwarte band commutatie komutacja ciemna svart kommutering noire une machine si collecteur, commutation où il n’y a pas d’étincelles visibles entre les balais et le collecteur. black commutation On a commutator between machine, commutation where there is no visible sparking any brushes and the commutator. TeMHafl [6eJblCKpOBafl] KOMMJ’TauuR KOMMyTauUB KOJIJIeKTOpHOtiMamUHbI, He COnpOBO~AaIomaRCII UCKpeHUeM MexBy IIIeTKaMU A KOJIJICKTOpOM. 811-13-37 essai de bande noire Essai de commutation ayant pour objet de déterminer les limites de l’étendue de la variation de l’intensité du champ de commutation, entre lesquelles la commutation spécifiées. black-band est pratiquement sans étincelles, une plage de charges test A commutation commutating test to determine OupeneaeHae which of variation the commutation of determinare i limiti della commutazione) hepaling van de zwarte band prbba komutacji ciemnej gnistgransprovning is practically range of loads. o6AacTu TeMHOti[6e3bICKpOBOkÏ1 KOMMJ’TauRu KoMMyTauUoHHbIe U3MeHCHUti the limits of the range field strength between sparkless for a specified no UCIIbITaHUII HZNIPSI~CHHOCTU 0npeneneHmo KOMM)‘TUPYEOIWI-0 npenenoa IIOJIR, [TeMHaU] UMeeT MeCTO npaKTUUeCKU 6e3bICKpOBax 3aUaHHOM BuanasoHe HarpySOK. 811-13-38 pour Schwarz-Band-Versuch ensayo de banda negra prova di commutazione nera (per MCEAY ïmanasoaa KOTOPbIMU KOMMyTauUa IIpU coup de feu au collecteur flash (déconseillé) Court-circuit par amorçage d’arc entre balais ou porte-balais, au niveau du collecteur d’une machine électrique ou entre un des éléments précédents et la masse. Rundfeuer/Uberschlag contorneamiento colpo di fuoco al collettore rondvuur przeskok (na komutatorze) ; iskrzenie (na komutatorze) rundslag flashover A short-circuit caused by arcing between surface of the commutator brushes or brush-holders at the of an electrical machine or from any of these parts to the frame. KPYrOBOtiOrOHb KOpOTKOe UJIU 3aMbIKElHUe, MexAy BbI3BaHHOe AYTOBMMU IIIeTKOBep%aTeJIaMU 3JIeKTpUYeCKOjIMaIIIUHbI UJIU OT SECTION 811-14 - CONSTITUANTS mo6ol PaJpnAaMU Me9AJ’ LWTKaMU U nOBCpXHOCTbI0 KonneKTopa II3 STUX UaCTeU Ha KOpnyC. ESSENTIELS DES MACHINES TOURNANTES SECTION 811-14 - PRINCIPAL PARTS OF ROTATING ELECTRICAL PA3AEJI 811-14 - OCHOBHbIE 811-14-01 (411-13-01) Stander Partie d’une machine tournante qui comprend avec les enroulements les circuits magnétiques fixes associés. stator The portion MACHINES AETAJIH BPAWAIOIIJHXCII WIEKTPWIECKHX stator of a rotating machine parts with their associated windings. which includes the stationary magnetic ÉLECTRIQUES ztataz stator stator ; stojan stator MAIBHH * 50(811) 0 811-14-01 (411-13-01) IEC -61 CTaTOp %CTb MaIIIUHbI, COACpXalLW4 COOTBeTCTBYH3JWiMU 811-14-02 - HeIIOABUXHbIe YaCTU MBTHUTHOfi UCIIU C 06MOTKaMU. carcasse Gehtiuse Structure supportant électrique tournante. les pôles et les enroulements fixes d’une machine frame A structure supporting machine. the poles and fïxed windings of a rotating electrical carcasa carcassa statorhuis korpus ; obudowa stomme CTBHWHB KOHCTPYKIZUB, O~MOTKH 811-14-03 carcasse B pacnonararorc53 ~0~0p0ti BpaWiIOI@iC5I 3JIeKT&WiWKOii nonrocbt M nenonnmxnbte MaILIUHbI. massive Carcasse Massivgehause monobloc électrique coulée, forgée ou soudée en éléments formant continuité et magnétique. solid frame A one-piece casting or forging, or a fabricated ally and magnetically continuous frame. assembly, forming an electric- carcasa maciza carcassa massiccia massief statorhuis korpus lity massiv stomme aepas%eMHafl craauaa &YIbHOnUTOfi, KOBLlHbIii COCTaBn~EOLLWïii 3JIeKTpUWCKOti 811-14-04 carcasse UJIU CO6paHHbIti HCpa3lSMHyKl U3 U MWHUTHOil OTAWIbHbIX o6nanaromyro CTaHUHY, ‘iaCT&i YJCJI, HCIIpCpbIBHOii IIPOBOAUMOCTbIO. feuilletée geblechtes Carcasse composée de tôles assemblées en éléments magnétique, mais isolées électriquement entre elles. laminated formant continuité frame A frame whose parts are made up of laminations giving magnetic continuity Gehause carcasa laminada carcassa laminata gelamineerd statorhuis korpus pakietowany laminerad stator but insulated electrically from each other. IIMXTOBaHHaflCTaHlSHa CTaHUHa, CO6paHHaSi MWHUTHYK) 113 o6ecnesusaromnx JIUCTOB, IIpOBOAUMOCTb, HO 3JEKTpUWcKU HeIIpfZpbIBHyFO U30JIUPOBaHHbIX Apyr OT npyra. 811-14-05 tôle (de stator ou de rotor) (Sttinder oder Laufer) Tôle, généralement recouverte de matière isolante, utilisée dans la construction des éléments de circuits magnétiques feuilletés du stator ou du rotor d’une machine électrique. chapa tde estator o de rotor) (stator or rotor) lamination A sheet generally coated with an insulating material, used in the construction lamiera (di statore o di rotore) ; lamierino (di statore o di rotore) (stator- of rotor)blikpakket blacha stojana lub wirnika laminering of parts of the magnetic circuit of the laminated stator or rotor of an electrical machine. suer cral-opa (poTopa) nUCT, KâK UCIIOJlb3yCMbIii POTOpa 811-14-06 npannno, IIOKPbITbIï4 AJIH U3TOTOBJICHUR (CTaTOpa) 3JICKTpU’iCCKOfi Marepuanoki, U30JIRJJUOHHbIM %lCTCfi MWHUTHOjl LIenU IIIUXTOBaHHOTO MalIIUHbI. pôle principal Elément de circuit magnétique fournissant Hauptpol polo principal polo principale hoofdpool biegun glo,ny huvudpol le flux principal. main pole The part of the magnetic circuit which provides the main flux. rJlaBHblfi IIOJIIOC YYâCTOK MSLTHUTHOfi JJeIIU, CO3JWOWUM l-JlaBHbIfi MaTHUTHb1i-i IIOTOK. Blechung 811-14-07 50(811) 0 CE1 62 - Wendeool polo auxiliar polo ausiliario ; polo di commutazione hulppool hiegun pomocniczy ; biegun komutacyjny kommuteringspol nôle auxiliaire 1 Elément de circuit magnétique interpole commutating fournissant le flux de commutation. pole The part of the magnetic circuit which provides AO6aBO'lHblti YYacrox the commutating flux. IlOJllOC Mai-HnTnoh nenn, co3natomuti KOMMyrnpymmnn MarHuTnbtn IIOTOK. 811-14-08 (411-13-02) Laufer rotor rotore rotor wirnik rotor rotor Partie tournante d’une machine. rotor The rotating portion of a machine. PoroP Bpamatomascs 811-14-09 (411-13-03) YaCTb WIeKTpW‘eCKOii MaIIIAHbI. induit Anker Partie d’une machine à collecteur ou d’une machine synchrone, dans laquelle est induite une force électromotrice et qui conduit le courant de charge. it’:IFut armature (USA) anker twornik armatur That portion of a commutator or synchronous machine in which a voltage is generated and which carries the load current. RKOPb YaCTb Ko,I,IeKTopHOii WICKTpOABAH(Y,JJaR 811-14-10 (411-13-04) HJIW CIIHXpOHHOii CFïJta H KOTOpafl HeCeT MaIIIMHbI, TOK B KOTOpOii c03AaeTcfl HarpY3KH. Anker armadura armatura ..... Rotor portant un enroulement Note. - relié à un collecteur. Le terme anglais (UK) français “armature” a un sens plus restreint que le armature anker wirnik komutatorowy ankare “induit”. (UK) A rotor which carries a winding Note. - connected to a commutator. The French term “induit” has a broader sense than the English (UK) “armature”. POT~~, Ha KOTOPOM flj,iYMeWHe. - pacnonoXeHa flpl+MeHHTeAbHO O6MOTKa,IIpHCOeAHHeHHaaKKOJIJIeKTOpy. K BpaIUaIOWekCH MaIIIHHe (PpaHUj'3CKMfi ~MeeT6oneennxpoKoe3HaseH~e,~eM “induit” B 3HaYeHUII "IIKOpb" B Benutco6pnTaHun. aHrn5ïticKG -repMriH “armature”, HCIIO,Ib3,'eMbIti TepMEIH 811-14-11 (411-13-05) Erregerfeld inducteur Partie d’une machine à courant continu ou d’une machine synchrone qui produit le flux d’excitation. field system That portion of a d.c. or synchronous machine which produces the excitation flUX. YaCTb C03AaeT MaIIIkIHbI IIOTOK IIOCTOSIHHOrO BO36yHcAeHIW TOKa AJIA CHHXpOHHOs MaIIIMHbI, KOTOpaS inductor induttore magneetgestel (stilstaand) (poolwiel) (draaiend) magnesnica ; wzbudnica magnetsystem ; poolrad 50(811) 0 811-14-12 - IEC 63 - entrefer (d’une machine tournante) Distance dans l’air séparant l’inducteur de l’induit, ou le stator du rotor d’une machine électrique tournante. air gap (of a rotating machine) Luftsoalt entrehierro (de una maquina giratoria) traferro luchtspleet szczelhra powietrzna (maszyny wirujqcej) luftgap The air space separating the field system and armature or the stator and rotor of a rotating electrical machine. BO3~YUIHbIl-i 3il3Op BOJAyUIHOe POTOP 811-14-13 (411-13-16) (B,,aLU2UOI,&%CR npOCTpaHCTB0, BpaIIWOI&iC5l MWIIIHbI) pa3AeLWIEOLUeC WICKTpWWKOii AHAYKTOP Ii SIKOpb IlJlA CTaTOp Ii MaUIAHbI. Laufernabe cuerpo ; estrella lanterna rotorster piasta wirnika ; korpus wirnika croisillon lanterne du rotor Assemblage supportant le noyau ou les pôles du rotor sur l’arbre. spider A structure supporting ,&TaJIb MaIIIMHbI, UJIII IIOJIlOCa 811-14-14 (411-10-07) the tore or poles of a rotor on the shaft. UpCAHa3Ha9CHHaS4 POTOpa AJIS XWCTKOTO COCAkïHCHFin CCpAC’iHPïKa C BWIOM. Nut encoche Evidement pratiqué dans une pièce métallique d’un enroulement. pour y loger les conducteurs slot The recess in a metal tore in which the conductors of a winding are laid. ranura cava gleuf ; groef ilobek spar na3 Yrny6nemïe yK,IaAKYi 811-14-15 B naxere Merannurecxoro IIPOBOAHHKOB cepnesnuxa, npenycMorpennoe nnrr 06MOTKII. collecteur Kommutator Ensemble d’organes conducteurs isolés les uns des autres et de leurs supports, sur lequel sont maintenus les balais destinés à permettre la commutation de courant entre un enroulement mobile et une partie fixe d’un circuit par colector contact glissant. collettore commutator komutator kommutator commutator An assembly of conducting members insulated from one another and from their supports, against which the brushes are maintained commutation of current between a moving winding and used to enable and the stationary part of a circuit by sliding contact. IConJlerTop COBOKYIIHOCTb IIXtCTIIH, MeXAy 811-14-16 (411-11-12) U30,IHpOBaHHbIX II0 KOTOPMM IIOABPDKHOi Apyr CKOJIb3IIT 06MOTKOfï OT ApyI-a TOKOCbeMHbIC II OT KO,,IIyCa IUeTKH A HeIIOABWKHOü IIPOBOASIIUHX II KOMMYTUPYIOT YtiCTbH3 TOK IlenA. lame de collecteur Kommutatorlamelle Elément conducteur delga de colector d’un collecteur qui est raccordé de deux sections consécutives commutator commutator à l’extrémité commune d’un enroulement. segment bar A conducting member of a commutator, which is connected end of two consecutive sections of a winding. uoflfletcropttafl naacruea JtaMeJlb (HCAOIIyCTHMbIü TOKOnpOBOAmIWl KOHUOM ABYX to the common TQMIIH) AeTElJIb KOJIJICKTOpa, IIOCJEAOBaTWIbHbIX CeKllkïii KOTOPW 06MOTKH. COt?A&ïHeHa C 06LUIIM lamella del collettore commutatorlamel dziallra komutatora kommutatorlamell ; lama del collettore 50(811) 0 CE1 811-14-17 (411-11-15) Kommutatorlamellenisolation entredelgas lamella isolante lamelisolatie izolacja miedzydzialkowa kommutatormellanl~gg entre-lames Isolation entre les lames de collecteur. commutator commutator segment insulation separator The insulation between commutator segments. MexcKnaMenbttafln30m4ufl pacnonaraeMaa Il3onsrrm, KOJIJIeKTOpHblMH COCeAHMMII MeXAY IIJIacTHHaMu. 811-14-18 Kommutatorfahne radiale (de collecteur) Elément conducteur de deux sections commune Note. - destiné à raccorder une lame de collecteur à l’extrémité Si l’air de ventilation du rotor passe en totalité ou en partie entre ces connexions, elles sont dites commutator riser A conducting segment to the common end sections of a winding. Note. - If the rotor cooling air passes wholly connections they are termed ventilated. uonneuropubtl or in part between these nerymou TOKOIIlJOBOASImaZ4 IIJIaCTHHy jqzyczek homutatora lamellhals ventilées. element connecting a commutator of two consecutive YaCTb C06mIIM flpHMt?YaHHe.- 811-14-19 radia1 (de colector) bandierina (di una lamella) commutatorveer d’un enroulement. consécutives KOJIJIeKTOpHOfi KOHuOMAB,'X &mi BOSAYX IIO,IHOCTbEO EIJIkl YaCTHSHO Ha3blBaIOTCII BeHTEUIHpyeMbIMIL IIJIaCTIIHbI, COeAHHIIKWaR IIOCJIeAOBaTeJIbHbIX AJIR MeXUIy CeKIWti OXJIaWIeHWI AaHHbIMEI 3TY 06MOTKM. IIPOXOAUT POTOpa TO COeAHHeHURMA, OHkI Bürste balai Pièce conductrice, généralement fixe, qui est destinée à assurer le contact électrique avec un collecteur ou une bague. brush escobilla spazzola borstel szczotka elborste A conducting part, generally stationary, which provides electrical contact with a commutator or slip-ring. merua TOKOItpOBOASILIWl AeTaJIb, o6ecnesnsammaa IIpe&IM)'meCTBeHHO HeIIOABHxHaSI, 3JIeKTlWIeCKIIdKOHTaKTCKOJIJIeKTOPOMHJIIIKOHTaKTHbIM KOJIbIIOM. 811-14-20 Biirstenhalter porte-balais Organe servant à maintenir un balai ou plusieurs balais, définie par rapport à un collecteur ou une bague applique une force donnée à ce balai ou ces balais. dans une position porta-escobillas et qui habituellement portaspazzole borstelhouder szczotkotrzymacz borsthallare brush holder A structure which maintains a brush or several brushes in a definite position relative to a commutator or slip-ring and usually applies a given force on the brush or brushes. meruonepxarenb KOHCTPYKUII~, KOTOpaR OnpeJJeJIeHHOM IIOJIO~eHIW KO,Ibua PI 06eCIWIHBaeTCFi IIOAAelNKKaBaeT OTHOCHTeJIbHO HeO6XO~BMyIO OAH)' AJIII HeCKOJIbKO KOJIJIeKTOpa CIUIY Ha~aTAII. IlJIM IWTOK KOHTBKTHOI'O B 50(811) 0 811-14-21 IEC couronne porte-balais Pour les machines Biirstentragerring électriques qui en sont munies, couronne mécanique corona portaescobillas supportant les porte-balais. Peut être de type tournant pour permettre l’accessibilité aux balais et pour régler la zone neutre. brush ring arc0 portaspazzole borstelkrans jarzmo szczotkowe borstdon ; obsada In electrical machines SO lïtted, a ring mechanically supporting the brush holders, sometimes rotatable to give access to the brushes and to regulate the neutral zone. rpasepca tuertcoAepxarenfl MeXaHuueCKOe KOJIbuO M meTKOAepH(aTeJIA YCTPOtiCTBO AJI54 BOSMO~HOCTEI 811-14-22 3,IeKTpWIeCKOu KOHCTP).‘KUWl o6ecne~erius peryJIupOBaHu$I MaIIIuHbI, KOTOpOrO 6onee Ha MOxeT yAO6HOrO KOTOpOM uMeTb KpeIIaTCR nOBOpOTHOe AOCTJ’lEl K IJJeTKaM II 30HbI. HeiiTpanbHOü bague (collectrice) Schleifring Bague conductrice sur laquelle sont maintenus les balais destinés a permettre le passage du courant d’une partie mobile à une partie fixe d’un circuit par contact glissant. ani11o colector ane11o slip ring collecter ring A conducting ring against which the brushes are maintained sleepring pierlcien slizgowy slapring and used to enable current to flow from a moving to a stationary part of a circuit by sliding contact. KOHTBKTHOB KOJlbl40 TOKOIIpOBOA5IIIJW KOJIbnO, KOTOpOe npemia3uaSeno KOHTBKTâ MeHcAy II0 KOTOpOMy AJIs CKOJIb3IIT CO3AaHW-I BpEGIWOI&iiCSi TOKOCbeMHbIe IIIeTKu II CKOJtb3amerO 3JIeKTpAYecKOrO II HeIIOABWKHOti YaCTbKl 3JEKT&WïYeCKOti uenu. 811-14-23 flasque Gehtiuseschild Pièce massive ou ajourée, fixée à la carcasse du stator, servant à protéger les enroulements. l’i’dy end shield A solid or skeletal structure attached to a stator frame and which serves to protect the 811-14-24 (lager-)schild osLona lindningskapa windings. MJIII KapKacnaa MaCCuBHaa CJIyxamae protector A,Ia 3amuTbI ~O~c~pyKnua, npuKpennaeMa2 K CTaHuHe u 06MOTOK. palier flasque Lagerschild Flasque dans lequel est monté un palier et pouvant être évidé pour permettre le passage de l’air de ventilation. palier s”porre bearing shield An end shield in which a bearing passage of cooling air. is fitted and having spaces to allow the scudo supporto lagerschild osfona loiyska przewiewna lagerskold llO~UlllllHHKOBbliiIIIHT J.&ïT, B OTBepCTuR 811-14-25 KOTOpbIu BMOHTMpOBaH nOAIIIMnHuK AJUI IIpOXOHcACHHZd OXJIa~AtUOLUWO A B KOTOpOM IIMfSOTCR BOJAyXa. bras de suspension Motoraufhangearm S’applique soit au bras de maintien des paliers de moteur, s’ils sont séparés des flasques, soit aux éléments mécaniques liant le stator aux fixations sur brazo de suspension braccio di sospensione l’essieu (paliers) suspension A term ou sur le bogie ou la caisse. bracket applied either to arms which carry the motor bearings if these are separate from the end shield, or to the mechanical parts linking the stator to fixing points onthe suspension bearings,bogie frame or body. ophangarm wspornik wieszakowy upphiingningskonsol szczotek 811-14-25 66 - 50(811) 0 CE1 KpoHmTeÏBl no/.rBecKH TepMHH, OTHOCHmHiiCH na60 K KpOHIIITeHHaM, HeCymHM BBHraTenH, t?CJIII OHH OTAWIeHbI COeAHHRIOmHM CTaHHHy OT CTaTOpa Ll.WTâ, C nOAIIIIHIHHKH 111160K MeXaHWiWKUM TOYKaMH Kpt%IJIeHEGI YaCTRM, Ht3 OCeBbIX noJuIInnHaKax, paMe TeJIeXKH HJIH Ky3OBe. 811-14-26 palier d’essieu (pour moteur suspendu par le nez) Palier par l’intermédiaire duquel un moteur de traction repose d’un côté sur l’essieu, alors que de l’autre côté, il est suspendu au châssis de bogie au moyen de bras de suspension ou d’un appendice de sa carcasse appelé “nez”. motor suspension bearing (for nose-suspended motor) A traction motor bearing mounted on the axle and supporting one side of the traction motor, the other side being supported from the bogie frame by a bracket (nose) on the motor frame. MoTopHo-oceeol l-lOImnHIHHK noBmanKaK TRI-OBOrO (.IWI ,BBaraTenn c onopeo-oceeol AHBraTeJlR, yCTaHaBJIHBaeMbIü Tatzlagerung cojinete de motor de suspension (para motor suspendido por la nariz) cuscinetto d’asse (d’un motore sospeso a naso) steunlager loiysko osiowe (silnika zawieszonego za nos) tasslager noasecrcoir) Ha OCH H nonnep~HBaIomHi OAHY CTOPOHY TBroBoro ABHraTenH, npyran cTopoHa KOTOpOrO npU 3TOM OnHpaeTCff Ha paMy IIOCpeACTBOM KpOHIIITeHHa nOBBeCKH AJIH HOCHKa ABHraTeJIff. 811-14-27 boîte à bornes Anschlutlkasten Boîte, généralement couverte, montée directement sur une machine ou séparément, qui assure le raccordement de celle-ci avec les câbles d’alimentation. caja de bornes connettore motor connection terminal box box (Klemmenkasten) aansluitkast skrzynka zaciskowa uttagslada A box, usually covered, mounted on the machine or separately and containing terminals which make the connections between the machine and the supply tables. KopO6Ka BblBOAOB KopoGKa, 06bIYHO 3aKpbITWI, YCTaHOBJIeHHaH Ha MâUIEiHB IIJIM OTAWIbHO U COAep~aIIWl BbIBOAbI AJISI IIpESCO’2AkïH’ZHëHHbIX K JJI‘2KTpWieCKOfSUeIIEi 06MOTOK MaUI&iHbI. 811-14-28 (411-07-11) enroulement porté par l’induit d’une machine. Note. - Le terme anglais (UK) français “induit”. armature Note. - “armature” a un sens plus restreint que le awolgimento ; devanado de lndotto ankenvikkeling uzwojenie twornika armaturlindning winding A winding narrower Ankerwicklung arrollamiento de inducido inducido d’induit Enroulement on the armature of a machine. When applied to a rotating machine the UK term “armature” meaning has a than the French “induit”. 06MOTKa nKopn 06MOTKa, pElCIIO~O~KeHI%iH Ha RKOpC MaUIBHbI. @JH,‘vf,?Y,Wife.- npHMeH&iTWIbHO K BpaLI&UO~HMC~ MâUIHHâM ZiHWIkIiiCKMii HCIIOJIb3yCMbIii B BenuKO6puTaHuu (IIKOpb), UMWT TBpMHH “armature”, 6onee ysroe 3HaHeHHe, HeM @paHny3CKHti “induit” (IIKOpb). 811-14-29 enroulement enroulement de champ d’excitation Enroulement ayant pour seul objet de produire pal de la machine. le champ magnétique princi- field winding An excitation winding whose sole purpose magnetic field of the machine. is the production 06MOTKa B036yXBeHIiB 06MOTKa, CO3AaIOmaK rJIaBHOe MWHUTHO’Z IIOJI’ZMaIIIUHbI, of the main Feldwicklung (Erregerwicklung) arrollamiento de campo ; arrollamiento dé excitacion awolgimento di campo ; awolgimento di eccitazione veldwikkeling uzwojenie wzbudzenia magaetiseringsllndnlng 50(811) 0 811-14-30 (411-07-18) IEC enroulement 67 - de compensation Enroulement parcouru proportionnel, magnétique par le courant de charge ou par un courant qui lui est et disposé de façon à combattre la distorsion due au courant de charge qui parcourt compensating du champ les autres enroulements. winding Kompensationswicklung arrollamiento de compensacibn awolgimento compensatore compensatiewikkeling uzwojenie kompensacyjne kompenseringslindning A winding that carries the load current, or a current proportional thereto, and is SO disposed as to oppose distortion of the magnetic field by the load current circulating in other windings. KOMlWHCalJAOHHBR 06MOTKa 06MOTKa, H’ZCyIIWl HaTPYJKR,H TOK HWPYJKII paCIIOnOxteHHa5I UCKXKCHAEO IlJIA TaKIIM TOK, IIpOIIOpLWOHWIbHbIti 06pa3oM,ST06bI TOKY npOTHBOAeYiCTBOBaTb MarHEITHOrOnOJISInpI'InpOXO~~eH~I'ITOKaHarpy3KIIn0~pyrIIM 06MOTKaM. 811-14-31 (411-07-19) enroulement enroulement de commutation de pôle auxiliaire Dans une machine à collecteur, enroulement d’excitation parcouru par le courant de charge ou par un courant qui lui est proportionnel, et disposé de façon à faciliter l’inversion du courant dans les bobines en commutation. commutating winding interpole winding An excitation winding which, in a machine having a commutator, load current or a current proportional thereto, and is SO disposed the reversa1 of current in the coils undergoing Wendepolwicklung arrollamiento de conmutacion ; arrollamiento de polo auxiliar awolgimento dei poli ausiliari ; awolgimento di commutazione hulppoolwikkeling uzwojenie komutacyjne ; uzwojenie bieguna pomocniczego kommuteringslindning carries the as to assist commutation. A06aBO=IHblX IIOJIIOCOB KOMMJ’TUPJWIU~R 06MOTKB 06MoTKa 06MOTKa TOK B036JkAeHH~, HaTPY3KII WIA pacnonomeaaTaxnM TOKa 811-14-32 B C’ZKUARX enroulement KOTOpaa TOK, B MaIIIMHe, o6pasoM, YT06bI O~MOTKII ESMeIOmeti IIpOIIOpUHOHWIbHbIii IIKOPR, TOK,’ 06ecnewTb HBXOLVILLWXCII KOJIJIeKTOp, HWPJ’JKH, M3MeHewe B IIpOIWXC II HCCCT KOTOpaSl HanpaBneHan KOMMYTaUHA. de lancement Enroulement spécial servant au démarrage d’un moteur ayant un couple insuffisant à vitesse nulle ou d’une génératrice fonctionnant en moteur. starting winding Anlaufwicklung arrollamiento de lanzamiento awolgimento d’awiamento aanloopwikkeling uzwojenie rozrnchowe startlindning A special winding helping to start a motor having insufficient standstill torque or to start a generator acting as a motor. nyCKoBafl 06MOTKa Cnemïanbnaa 06MOTKa,wnonbsyeMaS4 IIyCKOBOti HeAOCTaTOYHbIii B pexuMe MOMCHT nna 3anycKa ASIn 3anyCKa naIwaTenfl,I4MeIomero pa6o’raromero reHepaTOpa, ABHraTenn. SECTION 811-15 - ENTRAÎNEMENT DE L’ESSIEU SECTION 811-15 - AXLE DRIVE PA3AEJI 811-15 - OCEBOfi 811-15-01 moteur à suspension IIPMBOA par le nez Moteur porté d’une part par des paliers sur l’essieu et d’autre part, par un appendice appelé “nez” sur le châssis du bogie ou du véhicule. axle-hung motor nose-suspended motor A motor supported on one side by bearings on the driving axle and on the other side by a bracket called a “nose” on its frame connecting it to the frame of the bogie or vehicle. Tatzlagermotor motor con suspension por la nariz motore sospeso a naso motor in tramophanging silnik zawieszony (za nos) tasslagerupphiingd motor 811-15-01 50(811) 0 CE1 ~BlWaTCJlb C OllOjWO-OCCBOii llO~BCCK0k-i flB&U’aTeJIb, OIIkI,,aEO~HiiCH IIO~IIIHIIHIIKOB, a KPOHJIIT&IOM 811-15-02 68 - Ha OCTOBC moteur entièrement Moteur C OAHOii C ApyrOii CTOPOHbI CTOPOHbI - Ha BCAJ’IIIYEO PaMy OCb IIOCpeACTBOM TCJIWKKII CI’ICIUIUIbHbIM AB&II-aTCJIfI. Gestellmotor motor enteramente suspendido élastique et motore interamente sospeso motor met flexibele aandrijving silnik zamocowany sztywno na ramie styvt monterad motor suspendu fixé rigidement au châssis du véhicule l’effort de traction a un ou plusieurs déformable. frame-mounted Ha ou du bogie et transmettant essieux, par un dispositif motor A motor fixed rigidly to the vehicle or bogie frame, driving one or more axles through a flexible drive. AswraTeJTb c onopHo-paMHok ~BEiTWIb, XCCTKO IIpHBOASI~lSfI I’li6KOI’O 811-15-03 B LJBPi)ICeHIle OAH,’ Ha PaMC HJIH HCCKOJIbKO Ky3OBa FIJIEi BCAy~kïX OCefI TeJIe)KKEi A IIOCpeACTBOM IIpFïB0Ai-i. moteur à suspension Moteur no,qBecAoir 3aKpUUIeHHbIii suspendu bogie-mounted am Drehgestell befestigter Motor motor con suspension en el bogie motore sospeso su1 carre110 motor in het draaistel silnik zamocowany na wbzku boggimonterad motor dans le bogie au châssis du bogie. motor A motor carried on the bogie frame. ABuraTesb c nonBecuofi fiBHI’aTl?JIb, 811-15-04 moteur à suspension Moteur ua panre Tenezcuu IIOABCIIICHHbIii suspendu Ha PaMe TeJIe)f(KII. dans le châssis Unterflurmotor motor con suspension en el cbasis motore sospeso sulla cassa motor in wagenbak silnik zamocowany w nadwoziu ramverksmonterad motor au châssis de caisse. underframe-mounted motor A motor carried on the vehicle frame. ABnraTenb c uoneecuoü ABkfraTCJIb, 811-15-05 na paMe uysoea IIOABCLIICHHbIfi Ha PEiMe KyJOBa (WWiHkïIIbI IIOABWKHOTO COCTaBB). Langsmotor motor longitudinal motore longitudinale langsmotor silnik zamontowany wzdhinie longitudinellt monterad motor moteur longitudinal Moteur dont l’axe est parallele longitudinally mounted à celui de la voie. motor A motor whose axis is parallel to that of the track. ,,,,OAOJIbHOyCTaHaBJlUBïlCMblü ABEII-aTWlb flBkIï-FlTCJIb, 811-15-06 OCb KOTOpOrO transmission Dispositif IIapUIW2IbHa HNIpaBJIeHIUO élastique ou ensemble des organes transmettant la puissance et essieux, tout en permettant certains déplacements flexible ABkIxteHHSl. relatifs. drive A device or equipment transmitting the output between whilst allowing for some relative displacement. ru6uuti entre moteurs motors and axles, npuBoA YCTPO~TBO HJIH COBOKynHOCTb rusnra-renefi Ha ocn, nepeMemenna. MeXaHM3MOB, o6ecneVnsan IIepe,&UOIlWX 803MO)I(HOCTb UX MOIUHOCTL OTHOCHTeflbHOTO 01 gefederter Antrieb (elastisch) transmision elistica trasmissione elastica flexibele aandrijving przekladnia elastyczna flexibel kraftoverftiring 50(811) 0 811-15-07 IEC transmission 69 - unilatérale Transmission, dans laquelle chaque moteur transmet la puissance par une seule extrémité de son arbre. unilateral transmission A transmission in which the output of each motor is transmitted from one end einseitiger Antrieb transmision unilateral trasmissione unilaterale asymmetrische aandrijving przekladnia jednostronna enkelsidig kraftoverforing of its shaft. O~HOCTOPOHHUïi KpkïBOA ~PHFJOA, caoero 811-15-08 B KOTOPOM KaxAbIti ABUraTenb IIepeAaeT MOIUHOCTb C OAHOTO KOHUI sana. transmission bilatérale zweiseitiger Transmission, dans laquelle chaque moteur transmet la puissance par les deux extrémités de son arbre. bilateral transmission A transmission in which the output of each motor is transmitted from both Antrieb transmision bi’atera’ trasmissione bilaterale symmetrische aandrijving przekxadnia obustronna dubbelsidig kraftoverftiring ends of its shaft. ~BJ’XCTOp0HHKi-i IIPIIBOA B ~WHB~A, KOTOPOM KonnaMn caoero 811-15-09 KWAbIii IIepeAaeT ABHIZTWIb MOIUHOCTb ABJ’MR sana. Einzelradsatzantrieb transmision individual transmission individuelle commande individuelle (des essieux) Transmission, dans laquelle chaque moteur n’entraîne individual les essieux moteurs sont indépendants et où qu’un seul essieu. drive A transmission in which the driving axles are independent comando singo’o tdegli assi) individuele aandrijving nappd indywidualny individueli kraftoverforing and in which each motor drives one axle only. KH~MBtlAyaJlbHblfiIIPMBOA npHBOA, B IIPHBOAHT 811-15-10 KOTOPOM ABEDKKymHe BO BpalIFSH&IC transmission TOJIbKO OCH OAHY He3aBkICMMbI A KLDKAbIti ABPIï-aT’=Ib OCb. multiple Transmission Mebrradsatzantrieb entre un ou plusieurs moteurs accouplés et un groupe d’essieux. coupled axle drive A transmission arrangement group of axles. rpynnoaou ~PHBOA, spamenne 811-15-11 in which one or more motors are coupled to a trasmissione ad assi accoppiati gekoppelde asaandrijving wad twwwy gemensam kraftoverforiag IIPEIBOA B KOTOPOM rpynny transmission OAHH HJIH HCCKOJIbKO ABEïraTeJICk IIpEïBOAnT BO oceii. par bielles Transmission Stangenantrieb multiple dont le mécanisme comporte des bielles articulées et des manetons. rod drive A coupled transmision m”We axle drive arrangement using side rods and cranks. transmision par bielas trasmissione a bielle stangaandrijving napcd korbowykoppelstàng&verfGring “K,~HHO-KpHBOIKHnHbifiIIPKBOA rp,WIOBOi 811-15-12 transmission IIPHBOA, COCTORIlWii 113 IJIaTYHHO-KP%iBOIIIEIIIHO~O MCXaHA3Ma. monomoteur Einmotorenantrieb Transmission, dans laquelle un seul moteur entraîne deux ou plusieurs essieux d’un même bogie. monomotor drive A transmission arrangement the same bogie. in which one motor drives two or more axles on . .I transm’s’on monomotor carre110 monomotore monomotor naped jednosilnikowy monomotordrift 811-15-12 50(811) 0 CE1 MOHOMOTOPHbIi-4 IlptlBOA npIIBOA, OAHOI? 811-15-13 70 - B KOTOPOM OAIIH ABIII-aTeJIb npEIBOAHT B AetiCTBPIe ABe Ii 6onee OCII M TOEi ,Ke TeJIeXCKU. transmission à arbre creux Transmission comportant, autour de l’essieu, un arbre creux solidaire du moteur et relié aux roues motrices par un système élastique et déformable. qui11 drive A drive comprising a hollow shaft round the axle, supported by the motor and connected to the driving wheels by a flexible system. Hoblwellenantrieb transmision por eje bueco trasmissione ad asse cava holle-asaandrijving napcd warem drqionym hàlaxel IIPUBOAC IlOJlblMBBJIOM ~~ISB~A, B KOTOPOM HenOABHxHO KOJIeCaM 811-15-14 ocb KonecHoH YCTaHOBJIeHHOrO npoxoAaT BHYT~II nonoro II npACOeAPiHReMOT0 Bana, K BeAyLWIM rn6xoti CIICTeMbI. C nOMOWbE0 transmission napbI Ha ABIWaTeJIe par moteur à arbre creux Transmission, l’intermédiaire dans laquelle l’induit du moteur attaque l’engrenage par d’un arbre coaxial à l’arbre creux de l’induit et relié à celui-ci par un systeme élastique et déformable. hollow shaft motor drive Ankerhohlwellenantrieb (Motor) transmision por motor de eje hueco trasmissione ad albero cava holle-motorasaandrijving naped silnikiem o wale drqionym rotorbàlaxel A drive in which the motor rotor is coupled to the gearing by means of a shaft coaxial with the hollow rotor shaft and connected to it by a flexible system. IIPKBOAOT ABtll-aTWlR C IlOJlblMBBJIOM ~IPHBOA, BaJIOM, B K0~0p0h4 COeAAHeHHbIM 811-15-15 transmission nsnrarenn POT~~ KOaKCHaJIbHbIM n0 ra6xoii C HIIM coennnen OTHOIIIeHAEO K c sy6naron nOnOM,’ BaAy nepenareti pOTOpa M CIICTeMOti. à ressorts Transmission comportant des ressorts disposés soit dans la roue de l’essieu, soit dans les engrenages de la transmission. spring drive A flexible drive through Springs mounted either in the driving wheels or in the Federantrieb transmision por resortes trasmissione a molle flexibele aandrijving met stalen veren napgd elastyczny spreiynowy flexibel drivanordning med fjtidrar gearing. npyzuruubru h6KPïfi (ynpyruiij npHBOA, B ~~BOA KOTOpOM xonecax, ~11460B sy6ra’rok 811-15-16 transmission à éléments Transmission IIpYWIHbl YCTaHOBAeHbI na60 B BeAyLUHX nepenane. de caoutchouc à ressorts dont les éléments élastiques et déformables sont en caoutchouc. rubber spring drive A spring drive in which the flexible elements are made of rubber. Gummifederantrieb transmision por elementos de caucho trasmissione ad elementi di gomma ..... napqd elastyczny o wkladkach gumowych flexibel drivanordning med gummielement ,,,,HBOJ, C pe3E#HOBblMEl 3JlCMeHTaMU Ynpyr’kïii npPIBOA, B KOTOpOM 3JIaCTMSHbIe ra6xne 3JIeMeHTbI CAeJIaHbI 113 pe3RHbI. 811-15-17 transmission à cardans Transmission dont le systeme déformable dispositifs équivalents. cardan-shaft est constitué par des cardans ou des drive A drive in which the flexible elements are universal joints or similar devices. KapAaHHblii IIPKBOJJ np&ïBOA, IIIapHHpbI B KOTOpOM (KapAaHbI) ra6aae WIeMeHTbI IIJIM nOAO6HbIe npeACTaBARfOT YCTpOtiCTBa. ~060~2YHHBepCanbHbIe Kardanantrieb transmision cardan trasmissione cardanica cardanaandrijving naped przegubowy drivanordning med kardanaxel 50(811) 0 811-15-18 IEC -7ltransmission transmission à anneau dansant à anneau flottant Transmission comportant une pièce intermédiaire flottante, en forme d’an- neau, reliée par des biellettes, d’une part à l’arbre creux, d’autre part à l’essieu. floating ring drive A transmission comprising a free-moving links to both qui11 and axle. intermediate ring connected Antrieb mit scbwebendem Ring transmision por anillo flotante trasmissione ad anello danzante zwevende-ringaandrijving napqd o pierscieniu rucbowym drivanordning med Rinkkoppling by n,,HBOJ, C WlaBZUO”,WM KOJILUOM npaBOA, B KOTOPOM COeAAHeH 811-15-19 IIPOMeXyTOYHbIfi IIJIaBaIO~Eiii C IIOJIbIM II OCbIO. IIOBOAKBMII entraînement BaJIOM WICMCHT B @OpMe KOJIbUa Direktantrieb direct Systéme dans lequel le moteur entraîne l’essieu directement, c’est-à-dire engrenage intermédiaire. sans gearless drive direct drive arrastre directo comando diretto directe aandrijving nappd bezposredni direktoverforing A system in which the motor drives the axle directly, without intermediate gearing. 6e3pCAyKTOpHblti IlpllBOA HCllOCpe~CTBCHHblfi IlpliBOA CPiCTeMa, B KOTOpOii 811-15-20 engrenage ABPiraTeJIb IIpHBOAHT BO BPaLLIeHMe OCb a He uepes 3y6raTyto nepenauy. HeIIOCpCACTBeHHO, rigide Engrenage ne comportant pas de dispositif starres Getriebe engranaje rigido ingranaggi rigidi onafgeveerde tandwieloverbrenging przektadnia zqbata sztywna stum vaxel d’élasticité. solid gearing Gearing without resilient components. utecruafl zy6uaraa uepenaua 3y69a-raff nepenaqa 811-15-21 engrenage 6e3 ynpyrax 3neh4enrou. élastique federndes Engrenage dont l’une des roues constituantes comporte une élasticité tangentielle entre son noyau et l’anneau. resilient gearing A system of gears in which one of the wheels is provided tangential direction between hub and ring. auacrnuuan 3y69ararr sy6uarafl 811-15-22 engrenage Engrenage with resilience in a xoneco 0~~0 MeXAy CTYIIUIWÜ KOTOPOÜ II 3y6YaTbIM 06JIaAaeT ranrennnanbrioti BeHIlOM. unilatéral einseitiges dont les organes sont disposés à une seule extrémité des arbres des moteurs. unilateral gearing A system of gears in which the components are located at one end of the motor shafts. OAHOCTOPOHHRR sy6uarafl 3y6naraa ABPïraTeJIn. IIepeAaqa, ingranaggi elastici elastische tandwieloverbrenging przekladnia zqbata elastyczna fjiidrande vaxel uepeAaua nepenana, 3JIaCTUYHOCTbKJ Getriebe engranaje e1astico nepeflaua 3JIeMeHTbI KOTOPOÜ PaCIIOJIOXeHbI C OAHOrO KOHUa BaJIa Getriebe engranaje unilateral ingranaggi unilaterali eenzijdige tandwieloverbrenging przekIadnia zqbata jednostronna enkelsidig vtixel 811-15-23 engrenage 72 - 50(811) 0 CE1 bilatéral Engrenage zweiseitiges dont les organes sont disposés aux deux extrémités des arbres des moteurs. bilateral gearing A system of gears in which the components are located at both ends of the Getriebe engranaje bi’atera’ ingranaggi bilaterali tweezijdige tandwieloverbrenging przektadnia zebata obustronna dubbelsidig viixel motor shafts. ,QB~XCTO~OHHRR ay6uaran Sy6naras nepenaqa, nepeaara 3neMeHTbI KOTOPO~~ pacnonowteabr cA~yx K~HUOB Bana ABm-aTena. 811-15-24 engrenage à simple réduction Engrenage einfach iibersetztes réalisant le rapport de la vitesse de l’induit a celle de l’essieu, en un seul étage de réduction. single-reduction gearing Gearing fixing the speed oAuocvyneuuarafl sy6uarafl ratio between motor and axle in one stage of Getriebe engranaje simp’e reduccion ingranaggi a semplice riduzione enkele tandwieloverbrenging przekradnia zgbata jednostopniowa enstegsviixel reduction. 3y6qaran 811-15-25 nepenaua, B nepeaaua KOTOpOti nepf2AaW BpaIIIeHWI engrenage à double réduction CKOpOCTb K OCII CHLITaeTCII OAHOti BpalU2HWl ABHraTeJIH FIpEi CTyIleHbIO. doppelt iibersetztes Engrenage réalisant le rapport de la vitesse de l’induit à celle de l’essieu, en deux étages de réduction. double-reduction Gearing gearing tïxing the speed ratio between motor and axle in two stages of Getriebe engranaje doble reduccion ingranaggi a doppia riduzione dubbele tandwieloverbrenging przekladnia zebata dwustopniowa tvastegsviixel reduction. Aeyxcryneuuaraa Sy6qaran -IIepeAaYe 811-15-26 zy6raran nepenana, BpaUeHWl engrenage B nepeaaua KOTOpOs CKOpOCTb K OCII CHEiW(aeTCH AByMR BpaWeHHS ABHraTeJIFI IIpE? CTyIIeHXMH. à vis sans fin Train d’engrenages comportant Schneckengetriebe engranaje con tornillo sin fin ingranaggi a vite senza fine wormvieloverbrenging przekxadnia Slimakowa smickviixel une vis sans fin sur l’arbre moteur. worm gear A gear train incorporating uepsnuuan nepeaaua Sy6naraa nepenaua, Ha a worm on the motor shaft. Ban ABaraTenn KOTOPO~~ HacaxeHo repBwiHoe KOJIeCO. 811-15-27 engrenage Engrenage à roue intermédiaire à simple réduction comportant intermediate-wbeel Single reduction une roue dentée intermédiaire. gearing gearing whith an intermediate gear wheel. Zwischenradgetriebe engranaje con rueda ingranaggi con ruota tandwieloverbrenging przekladnia zebata z mellanhjulsviixel intermedia dentata intermedia met tussenwiel kofem posredniczacym llepC~a=la C ~,,OM‘SKYTO~HblM 3y6YaTbIM KOJlCCOM OAHOCTyneH9aTa5l3y6qaTaa 811-15-28 engrenage IIepeAa9aCOAHHM IIpOMeXyTOYHbIM KOJIBCOM. à pont Engrenage qui est réalisé à couple conique ou à transmission par vis réversible sans fin et où les axes menant et mené sont dans deux plans orthogonaux. rigbt-angled drive Gearing where the driving and driven shafts are in two planes at right angles, either as a pair of bevel gears or a reversible worm drive. Winkelgetriebe engranaje de puente ingranaggi conici haakse overbrenging przekladnia zebata prostopadla vinkelviixel 50(811) 0 811-15-28 IEC npnMoyronbuan 3y69araa 811-15-29 73 - nepeaaua nepenaqa, B ~0~0p0f1 B AByX IIepneHAHKyJIHpHbIX B BHAe AByX BeAymHir II IlpliBOAHbIe IIJIOCKOCTIIX KOHHSeCKHX meCTepeH II KOTOpaR lUIA BaJIbI MOTeT peBepCEïBHOYi pacnonoxeabI 6bITb BbInOJIHeHa YepBFIHOii nepeAa’iI4. carter d’engrenage Getriebeschutzkasten Capot de protection mécanique servant de réservoir d’huile de graissage aux engrenages. gear case A protective casing providing ~oxyx sy6uaroii KOxyX AJISI MeXaHWeCKOti CMa3KII 811-15-30 a reset-voir of oil or grease for the gearing. 3amllTb1, CJIyxaLLWiti MaCJIRHbIM pe3epByapOM AJIx nepeAa%i. combinée pour crémaillère et adhérence Transmission comportant deux trains d’engrenages solidaires qui assurent deux vitesses appropriées aux roues à crémaillère et aux roues à adhérence sur les rails. combined rack and adbesion drive in which two linked gear trains are provided, Transmission scatola ingranaggi tandwielkast skrzynia przekladniowa vtixelkàpa nepeflauu 3y6qaToR transmission carter de engranaje giving appropriate speeds for the pinion engaged with the rack and for the wheels driving on the rails. kombinierter Zabnrad- und Haftreibungsantrieb transmision combinada por cremallera y adberencia trasmissione ad aderenza e cremagliera gecombineerde tandrad- en adhesie-aandrijving przekladnia do napedu zebatki i kg vaxel for kuggstàngs- och adhesionsdrift KOM6RHAPOBBHHbIïl ,,,,,,BOA AJIHKpeMaJlbepbI N CUCIIJICHRR np&IBOA, COAepwtaIQHYi o6ecnewIBaIomae ABe ABe BbIIIOnHeHHbIe COOTBeTCTByEOmHe xpeïvranbepe ki no penbcaïvr co cuenneanebr 811-15-31 3aOAH0 3y6’IaTbIe CKOpOCTEi AJI5l nepeAaW, ABEIlKKeHIISl n0 xonec. hauteur libre sous carter jeu sous carter Distance minimale entre le carter et le gabarit pour la valeur d’usure maximale des roues. clearance The underneatb minimum maximum distance acceptable tcanpeuc no uo~yxy h’fPiHI4MaJIbHOe IIepeAaW tbe gear case between the gear case and the gauge Bodenfreiheit altura libre bajo carter franco minimo (della scatola ingranaggi) vrije ruimte onder de tandwielkast przeswit pod skrzynia przekladniowa kàpa-ralsavstànd line with wear of the wheels. zy6uaroé paCCTOSHPIe Ii ypOBHBM rOJIOBOK nepenauu n0 BepTHKaAI4 peJIbC IlpkI MexAy MaKCUManbHO KOxCyXOM AOnyCTHMOM 3y6raToii Ei3HOCe xonec. 811-15-32 entraxe Zentrale Distance entre deux axes parallèles, généralement traction et celui de l’essieu qu’il entraîne. entre celui du moteur de gear centre distance The distance between two parallel shafts carrying gears, generally between the traction motor shaft and the axle it drives. ivreztoceaoe paccronuae Pacc-roaune 06bIYH0 MexAy BO spameaae. MeHcny ABYMSI napannenbnbtMu BaJIOM TSIrOBOrO ABHraTWla BanaMn 3y69aTbIX Ii OCbEO, KOT0pyK.J Konec, OH IIpPIBOAIJT entreeje interasse ; centrale asafstand odleglosf osi watow viixels centrumavstànd 811-15-33 50(811) 0 CE1 74 - masse non suspendue Masse de ceux des éléments de l’entraînement engrenages, l’essieu moteurs et dont de l’essieu (roues, de traction, etc.) qui sont supportés les déplacements essieux, directement ne sont pas indépendants par de ceux des éléments en contact avec les rails. unsprung unabgefederte Masse masa no suspendida massa rigida ~a~vene~r~s~r~~~na oavjadrad massa mass The mass of those parts of the running gear (wheels, axles, gearing, traction motors, etc.) which are supported directly by the axle and are unable to rise and fa11 independently of the parts in contact with the rail. uenonpeccopeuuan Macca Macca AeTanefi ABMraTenM XOAOBO~~ Yacm (KOnCCa, oc~,3y6YaTa~ IIepeAaYa,THroBbIe PIT.~.),KOTOpbIeOIIllpaH)TCRHe~OCpeACTBeHHOHaOCb~ IIOAHIIMaTbCR II OIIyCKaTbCS-4 He3aBIICMMO HeMOryT OT AeTaneti,COnpHKaCamIwIXCff C penbcoM. SECTION 811-16 - MOTEURS DE TRACTION SECTION 811-16 - LINEAR TRACTION PA3AEJI 811-16 - JIHHEnHbIE 811-16-01 moteur (de traction) TWOBbIE LINÉAIRES MOTORS ABFH’ATEJIH linéaire Moteur de traction développé sur un plan dont un seul élément, l’inducteur ou l’induit, est porté par le véhicule, l’autre élément étant fixé sur la voie. linear (traction) motor A traction motor developed on to one plane, only one element of the motor, the fïeld or armature, being carried on the vehicle, the other being fixed to the Linear-Fahrmotor motor (de traction) lineal motore (di trazione) lineare lineaire (tractie)motor silnik liniowy linjar (traktions)motor track. JIHHeüHbIüABIKaTedlb ABPiraTenb, pa3BepHyTbIti (ki~~yKT0p kimd npyrol3aKpenneH 811-16-02 B OAHOil Ha IIJIOCKOCTII, pacnonoXes RKopb) OJWIH 3JIeMeHT KOTOpOrO na eJnnmne no~BimHOr0 COCTaBa, Synchron-Linearmotor motor lineal sincrono motore lineare sincrono lineaire syncbroonmotor silnik liniowy syncbroniczny linjiir synkromotor moteur linéaire synchrone Moteur linéaire dont le fonctionnement linear synchronous a nyTu. est de type synchrone. motor A linear motor whose operation is synchronous. JIWIeüHbIii CIWIXpOHHblü ABWaTeJIb k%HeIiHbIii 811-16-03 ABAraTenb, pa6o-raromub II0 IIpHHUHIIy CHHXpOHHOrO. Asynchron-Linearmotor motor lineal asincrono motore lineare asincrono lineaire inductiemotor ; lineaire assynchrooonmotor silnik liniowy asynchroniczny linjar asynkronmotor moteur linéaire asynchrone Moteur linéaire dont le fonctionnement linear induction est de type asynchrone. motor A linear motor whose operation is asynchronous. JI,,HeüHbIii BCEIHXpOHHblfi ABHraTeJlb .,kHetiHbIii 811-16-04 inducteur ~BPiraTenb,pa6oTaEOIWïti IlO IIpHHUHny aCHHXpOHHOr0. Feldmagnet (Erregerfeld) inductor (de un motor de traction induttore (d’un motore lineare) magneetgestel wzbudnik ; induktor f<system (d’un moteur de traction linéaire) Partie bobinée du moteur assurant le flux d’excitation. field system (of a linear traction motor) The wound part of the motor providing MHAYKTO~ (naHeüHor0 YaCTb nOTOKa. ABBraTenR C TnroBoro 06MOTKOii, the excitation flux. ,qBrnraTenrr) o6ecneWmaromas C03AaHIIe MarHPïTHOrO lineal) 50(811) 0 811-16-05 - IEC inducteur einseitiger simple Inducteur d’un moteur de traction linéaire, à une seule face devant l’induit. single-sided field system A linear traction armature. OJ”lOCTOpOHHUü HHAyKTOp motor inducteur field system with only one face, adjacent to the TIIrOBOrO IIpEIJICraeT ABHraTenS, J’ KOTOpOrO TOJIbKO e”kelsldlgt faltsystem zweiseitiger l’induit field system A linear traction motor field system with two faces surrounding which itself comprises IIHAYKT~~ induttore semplice enkel magneetgestel wzbudnik jednostronny OAHa double ABYCTOPOHliHii (Erregerfeld) K RKOpEO. Inducteur d’un moteur de traction linéaire, à deux faces entourant constitué par une lame dans l’entrefer des deux inducteurs. double-sided Feldmagnet ind”ctor sim”1e UHAJ’KTOP ,IHHeiiHOrO IIOBepXHOCTb 811-16-06 75 - the armature, Feldmagnet (Erregerfeld) ind”ctor doble induttore doppio dnbbel magneetgestel wzbudnik obustronny dubbelsidigt fiiltsystem a sheet in the air gap between the two tïeld elements. UHAJ’lCTOp naHeiiHoro MeTaJIJIWIeCKOrO TRroBoro JIHCTa ABMraTenR, paCIIOnO%?H IIKOPb C BOSAYLUHMM KOTOpOrO 3a30POM B MWAy BHAe ABYMII CepAeYHHKaMH. 811-16-07 Anker (Linearmotor) inducido (de un motor de traction lineal) indotto (d’un motore lineare) anker (van een lineaire tractiemotor) twornik (silnika liniowego) armatur induit (d’un moteur de traction linéaire) Elément sur lequel s’exerce l’effort de poussée du moteur linéaire. armature (of a linear traction motor) A member which receives the thrust of the linear motor. RKOPb (JWHeéHO,-0 Ha ,qeTanb, TflrOBOrO KOTOP,W ,QB,WaTeJIfl) BOSAetiCTBYFOT MeXaHWIeCKMe CIIJIbI JIHHeiiHOrO ABHraTens. 811-16-08 Reaktionsschiene rail de reaccion ; rail inducido rotaia di reazione inductierail szyna reakcyjna ; bieinik reaktionsrals rail de réaction rail induit Induit massif constitué par un rail. reaction rail A solid armature consisting of a rail. 811-16-09 p&3KTliBHblfi PeJlbC MaCCPiBHbIii IIKOPb, COCTO5IIIUiii 113 MeTaJIJIBYeCKOrO PeJIbCa. poussée (d’un moteur de traction linéaire) Effort de traction ou de freinage l’inducteur et l’induit. produit par la réaction motrice entre thrust (of a linear traction motor) The tractive or braking force provided by the interaction between motor lïeld Schub empuje (de un motor de traction forza di trazione o di frenatura overbrengingskracht ciag (silnika liniowego) kraft (hos linjiir motor) lineal) and armature. CklJla TRI-U (JlrtHetiHO~O Trrrosarr HJIII B3aUMOAeiiCTBkïA 811-16-10 THTOBOrO TOpMO3Haa PUiAyKTOpa CAJIa, ABIil-ZlT&lfl) o6paayromarrca IIpPi WIeKTPOMarHUTHOM A 5IKOpSI. effort vertical Effort vertical d’attraction produit Vertikalschub ou de répulsion, entre un inducteur et un induit, par réaction électrodynamique. vertical force The vertical attractive or repulsive force between lïeld and armature produced by electrodynamic reaction. esf”erzo vertica1 forza verticale verticale kracht sila pionowa (odpychania vertikal kraft lub przycipgania) 811-16-10 76 - 50(811) 0 CE1 BepTHlC%lbHaH BepTPiKaJIbHaH CWIa MexAy 3JIeKTpOMarHATHbIM co3AaBaeMas RKOpeM, II OTTaJIKHBaIOIIW PImI npHTmmamuaa MHAyKTOpOM B3ailMOAetiCTBPïeM. 811-16-11 vitesse synchrone (d’un moteur de traction linéaire) vitesse de synchronisme Vitesse pour laquelle il n’existe pas de mouvement magnétique en déplacement et l’induit. synchronous relatif entre le champ speed (of a linear traction motor) The speed at which tractiemotor) there is no relative movement between the travelling magnetic tïeld and the armature. CaHXpOHHall CKOpOCTb(JllUleÏiHOrO CKOpOCTb, np~ 6eryu&iM 811-16-12 KOTOpOfi TflrOBOrO OTCyTCTByeT Synchrongeschwindigkeit velocidad sincrona (de motor de traction lineal) ; velocidad de sincronismo velocità sincrona (d’un motore di trazione lineare) synchrone snelheid (van een lineaire prqdkosf. synchroniczna synkron hastighet ABlWaTeJlH) OTHOCIITenbHOe IIepeMeueHAe MexAy IIOJIeM II RKOpeM. MarHATHbIM effet de bord Dans un induit massif, développé, limitant l’efficacité de la largeur coefficient de réduction. effet des courants de retour entre pôles totale utilisable et donnant lieu à un edge effect Randeffekt efecto de borde effetto laterale randstrooieffect zjawisko brzegowe kanteffekt The effects in a solid armature due to the edge return currents between poles, limiting the useful width of the armature and reducing the output. upaenofr stjnbeur fiB,IeHkIx MexAy IIKOpR 811-16-13 B MaCCIIBHOM AByMR SKOpe, IIOJIIOCaMII, H yMeHbIIIaIOT BbI3BaHHble KOTOpMe TIIrOBbIe BHXpeBbIMEi OrpaHWIElBaIOT 06paTHbIMA nOJIe3HyEO TOKaMH IIIIIpIIHy yCIUIU% effet d’extrémité Effet électrodynamique aux extrémités de l’inducteur d’un moteur de traction linéaire fonctionnant à vitesse élevée, qui réduit les performances de ce moteur. end effect Electrodynamic operating effect at the ends of the tïeld system of a linear traction motor at high speed, reducing the performance KOHUeBOfi of the motor. 3@&2KT %IeKTpOAAHaMHYeCK&Ie RBSIeHtIR pa6o’raromero ABmaTeJIn, 3KCIIJIyaTaWOHHbIe 811-16-14 Ha KOHIJaX C HHAyKTOpa BbICOKOti XapaKTepWTkiKH JIHHefiHOrO CKOpOCTbIO, TIIrOBOrO yXyAIIIaIOIIWe ABHraTeJIR. traînée magnétique Effet de ralentissement dû aux courants de Foucault, dans un moteur linéaire ou dans une suspension ou sustentation de type électrodynamique. magnetic drag The retarding effect caused by eddy currents in a linear motor or in a magnetic levitation system. MZWHIITHO‘? CO,,pOTHBJICHHe TopMosnrrlee B&IXpeBbIMPI noneeca. Endeffekt efecto de extremidad effetto d’estremità eindstrooieffect zjawisko kralcowe randeffekt yCHJIYie, TOKaMII ABWWHNH) IIpOTHBOAeiiCTByI’=Wee B JIHHeiiHOM ABHraTene ABIGKeHliIO, UJIA B CHCTeMe BbI3BaHHOe MarHATHOrO magnetischer Schweif (Schleppe) galga magnética resistenza magnetica magnetische vertraging przeciwciqg magnetyczny virvelstrtimsbromsning 50(811) 0 811-16-15 IEC glissement 77 - (d’un moteur de traction linéaire asynchrone) Quotient de la différence entre la vitesse de synchronisme par la vitesse de synchronisme, et la vitesse réelle, exprimé par une proportion ou un pourcen- tage. slip (of a linear traction asynchronous The difference sed as a proportion or percentage CKOJlb2lCeHlle (JlMHefiHOl-0 h3HOCTb MeXAy BbIpaXKeHHiW 811-16-16 motor) between the synchronous TRrOBOTO CMHXPOHHOfi B BHAB OTHOIlIeHM5l speed and the actual speed, expres- of the synchronous aCElHXpOHHOr0 II speed. ABEN-aTCJlll) @GlKTWieCKOti ILWI B npOUeHTaX CKOPOCTblO, K CWHXpOHHOfk 06bIYHO CKOPOCTII. moteur linéaire à réluctance Moteur linéaire synchrone qui démarre comme un moteur à induction, mais qui grâce à des réluctances fortement différenciées dans ses circuits magnétiques, crée un champ glissant qui lui permet d’atteindre la vitesse synchrone et de s’y accrocher. linear reluctance Schlupf deslizamiento (de un motor de tracciun lineal asincrono) scorrimento (d’un motore di trazione lineare asincrono) slip (van een lineaire asynchrone tractiemotor) poslizg efterslapning Reluktanz-Linearmotor motor lineal con reluctancia motore lineare a riluttanza lineaire re’uctantiemotor silnik liniowy reluktancyjny linjiir reluktansmotor motor A linear synchronous motor which starts from rest as an induction motor but, owing to widely differing reluctance in parts of its magnetic circuits, creates a travelling field which enables it to lock on to synchronous ,,,,H‘?fiHblir CAHXP0HHbU-i 3aII)‘CKaCTCR 6naronaps KOTOPbIïi ABAXeHHR 811-16-17 pea#THBHblii .hH&iHbIii ABtlraTeJlb ABtit’aTWIb, pa3JIkiYHOMJ’ KOTOpbIii 113 COIIpOT~BJICHkUO Gerymee MBTHHTHOe C03AFleT A0 CliHXP0HHbli-i speed. nOJE, COCTORHAII IIOKOII B MBrHIITHbIX cnoco6aoe AOBeCTH UCIIRX II CKOPOCTb CUHXPOHHOÜ. entrefer (d’un moteur de traction linéaire) Distance entre les faces de l’inducteur et de l’induit ou entre les deux faces d’un inducteur double. air gap (of a linear traction motor) Distance from the face of the field iron to the face of the armature between the two faces in a double sided field system. B03AYUIHbli% PaccTonHHe 3a3Op (JlliHe8HOl-0 OT IlOBepXHOCTH IlOBepXHOCTEi RKOp5I mn4 AByXCTOpOHHeM HHAJ’KTOpe. TRI-OBOlxene3a M’=AJ’ iron or AHMI-ZlTeJlfl) PiHAyKTOpa CepAViHUKaMU A0 h4eTannmecKoti HHAyKTOpa B Luftspalt (eines Linearmotor) entrehierro (de un motor de tracciun lineal) traferro (d’un motore di trazione lineare) luchtspleet (van een lineaire tractiemotor) szczelina (silnika trakcyjnego liniowego) luftgap - 50(811) 0 CE1 78 - SECTION 811-17 - VÉHICULES THERMOÉLECTRIQUES SECTION 811-17 - THERMO-ELECTRIC PA3AEJl811-17 - TEI’IJI03JIEKTPHYECKM~ VEHICLES l-IO~BHXHO~ COCTAB (TEIIJIOB03bI) Note: Des définitions précises concernant les puissances des moteurs thermiques et des véhicules thermoélectriques sont données par les fiches de I’UIC et les normes de I’ISO. Les définitions 17-01 à 17-05, qui suivent, s’inspirent des principes fixés dans ces documents. Note : Precise definitions covering a11aspects of the statement of the power of prime-movers and thermo-electric vehicles are given in UIC leaflets and ISO standards and the following definitions 17-01 to 17-05 reflect the principles contained in these documents. l7pmweiramfe: B acnexroa(PoptvrynnpoaKn ToYHbIeonpeAeneHuaBcex ny6nnKaqasx MCXJI I4CO. II CTaIIAapTax npIIBeAeHHble nrenn03neKTpWiecKoro MomHoCTunepBWIHblXABaraTeneti HIDKe n.n.17-01-17-05 B onpeneneeaa OTpaxaIoT npIIHIIunbI, code COcTaBaAaHbI conepxamueca B AaHHbIXAOKyMeHTaX. 811-17-01 puissance nominale d’un véhicule thermoélectrique Puissance maximale disponible sur les arbres des moteurs de traction, mais ne dépassant pas la somme des puissances susceptibles d’être transmises sur les arbres des moteurs, au régime continu soit des génératrices principales, soit des moteurs de traction. nominal power of a thermo-electric vehicle The maximum power available at the shafts of the traction motors, but not exceeding the sum of the traction motor outputs at their shafts at the continuous rating of either the main generators HOMAHiUbHaR MO”,HOCTb Nennleistung eines thermo-elektrischen Fahrzeuges potencia nominal de un vehiculo termoeléctrico potenza nominale d’un veicolo termoelettrico nominaal vermogen van een thermo-elektrisch voertuig mot nominalna (pojazdu) nominell effekt or the traction motors. TenJlO3Jlt?KTp~‘WCKOI-O llOABAXHO~O COCTBBB MaKC~ManbHanMOmHOCTb,uepeAaBaeMaRHaBanbIT~rOBbIXAB~raTeneii,HO IIe CYMM~ npesbImaIomaa none3HbIx MomHocTeti Ha Banax TnroBbIx AsuraTene~~npoAon~~TenbHo~pe~Kw~enu6ornaBHbIxreHepaTopoa,n~6o TaroBbIx 811-17-02 ABuraTenek puissance utile en service (d’un moteur à combustion Puissance, mesurée interne) à l’arbre du moteur à combustion interne, qu’il fournit pour la propulsion du véhicule et pour l’entraînement des auxiliaires non indispensables au fonctionnement du moteur, y compris les ventilateurs de refroidissement, mais ne comprenant pas la puissance nécessaire à l’entraînement des auxiliaires indispensables, par exemple la pompe d’alimentation, la pompe à eau, la pompe à l’huile, le compresseur de suralimentation, etc. useful service output net brake power (of an interna’ combustion nutzbare Betriebsleistung an der Welle einer Verbrennungskraftmaschine potencia Util en servicio (de un motor de combustion interna) potenza disponibile (d’un motore a combustione interna) nuttig dienstvermogen mot uiytkowa (silnika) anv%ndbar uteffekt engine) The power measured at the engine driving shaft for propelling the vehicle and driving the auxiliary machines not essential for the running of the engine, including cooling fans but not including the power for driving essential auxiliaries, e.g. fuel, oil and water pumps, pressure charger, etc. nOJIC3HaH MOlUHOCTb ,IOJW3Hafl TOPM03HaR MOIIIHOCTb, CrOpaHWI) MO”,HOCTb ush4epaeMaa Ana IIpIIBeAeHIIn BCIIOMOraTenbHbIX CaMoro B 3KCIWyaTal,UU MLIIIIIH, AsmaTena, BKnIoYeHa B TOM MOmHOCTb, Ha BOARHMX 811-17-03 He w4cne HaCOCOB,KOMIIpeCCOpOB (d’utilisation) BHyTpCHHeTO Bany CocTaaa Ann HeO6XOAAMbIMA 0xnaxAaIouwx IIpEIBeAeHIIa B II pa6oTbI GOAa BeHTIInaTOpOB. Ans He AeiiCTBkIe pa6orbr ABIIraTena(BHyTpeHHerOcropaHua) HanpnMep, HaAAyBa TOIInIIBHbIX, MaCnflHbIX II Ii T.A. en service (d’un moteur à combustion service output (of an interna’ combustion The maximum (ImyTpeHHero IIOABA~HOrO Puissance utile maximale qu’un moteur peut développer tenu des conditions particulières d'emploi, par exemple rieure, pression atmosphérique, cycles de charge, etc. maximum CI-OpaHHfl) Asm-aTena eAAHAIIb1 RBJIRIOIWIXCR Tpe6yIomaacn yCTpOtiCTB, puissance maximale BeAyIIIeM B AeiiCTBIIe Heo6xoAIIMbIxAnnHOpManbHO~ BCIIOMOraTenbHbIX (ABHraTeafl température exté- engine) useful output which an engine cari develop into account the particular conditions of operation atmospheric pressure, load cycle, etc. interne) en service, compte in service taking e.g. ambient temperature, maximale Betriebsleistung an der Welle einer Verbrennungskraftmaschine potencia maxima (de utilizacion) en servicio (de un motor de combustion interna) potenza massima disponibile (d’un motore a combustione interna) maximaal dienstvermogen mot maksymalna eksploatacyjna (silnika) maximal “teffekt 50(811) 0 811-17-03 IEC MaKCRMaJlbHafl nose3Hafl BHyTpeHHerO CrOpaHHH) 79 - MOmHOCTb B (ABHraTenH 3wcnJryaTauuu h’faKCnMaJIbHaa nOJIe3Has MOmHOCTb, KOTOpyIO MOaeT pa3BnTb ABIIraTenb npn 3KcnnyaTaunn c ySeToM HanpnMep, TeMnepaTypbI pexnMa HarpysKa Ii T.A. 811-17-04 puissance nominale onpeneneaeblx oapy~alomero internationale ycnosuü sKcnnyaTauw, BOsAyXa, aTMocl$epHoro (d’un moteur à combustion AaBneHIIR, interne) Puissance utile qu’un moteur est capable de développer dans des conditions atmosphériques normales (moteurs à suralimentation exceptés) et dans les conditions des essais de type, pour un cycle de charge spécifié. international rated output standard power (of an interna1 combustion engine) The useful output an engine is capable of developing on a specified duty cycle, corrected (pressure-charged engines excepted). to standard in type-test conditions atmospheric conditions internationale Bemessungsleistung einer Verbrennungskraftmaschine potencia nominal international (de un motor de combustion interna) potenza nominale internazionale (d’un motore a combustione interna) nominaal vermogen mot maksymalna standardowa miedzynarodowa (silnika) lnternatlonell markeffekt MeircAyHapOuHafl HOMHHaJIbHaH MOmHOCTb CTaHAapTHafl MOmHOCTb(ABHraTeJIfl BHyTpeHHerOCrOpaHHfl) lloneîaaa MOmHOCTb, KOTOpyIO cnoco6ea pa3BIITb ABIWaTWIb B YCTaHOBJIeHHOM pa6oveM pe2GIMe B yCJIOBEWIX TIUIOBbIX IJCnbITaHdI, npIIBeAeHHbIX K CTaHAapTHbIM aTMOC@epHbIM yCJIOBWM (3a ACK,IIOYeHkIeM nBnraTeneM c HaAAyBOM). 811-17-05 puissance continue (d’un moteur à combustion Puissance qu’un moteur peut développer interne) continuellement dans des conditions déterminées. continuous continuous power (of an interna’ combustion engine) output (of an interna’ combustion engine) The power conditions. which an engine is able to deliver continuously under stated Dauerleistung einer Verbrennungskraftmaschine potencia continua (de un motor de combustion interna) potenza continua (d& motore a combustione interna) continu vermogen mot clagla (silnlka) kontinuerlig effekt npOAOJlîrtHTeJlbHaaMOmHOCTb(ABHraTeJifl BHyTpeHHerO CrOpaHHa) MOIIIHOCTb, KOTOpyIO MOxeT pa3BEIBaTb ABIIraTCnb B TeYeHMe npOAOJINITeJIbHOr0 BpeMeHEI B 3aAaHHbIXyCnOBIIsX. 811-17-06 puissance de surcharge (d’un moteur à combustion Puissance qu’un moteur fonctionnant interne) de façon satisfaisante peut développer dans des conditions déterminées, immédiatement après avoir fonctionné en régime continu, exprimée en pourcent de la puissance continue pour une durée déterminée, overload overload The par exemple Il0 % pendant une heure. power (of an interna’ combustion engine) output (of an interna’ combustion engine) power conditions which an engine immediately a percentage one hour. neperpy30ruaH is able to deliver after working of the continuous verbrandingsmotor) satisfactorily at the continuous stated MOIIIHOCTH B TeYeHlle OnpeAeneHHoro saca. overlasteffekt (silnika) power, expressed as 110 % for B 3aAaHHbIX npOAOnxATeAbHOti BpeMeHH, 06bIYHO 110% B TeYeHAe de traction (d’un véhicule thermoélectrique) Puissance absorbée uniquement par les moteurs de traction et l’excitation de la génératrice principale ou de l’alternateur principal. traction mot przeciqieniowa MomHocTb (ABHraTeJur BuyTpeHHero cropaerrn) yCJIOBEE4XHenOCpeACTBeHHO nOCJIe pa6OTbI B pexHMe puissance under power for a stated period, typically MOIIIHOCTb,KOTOpyIO MO)KeT HOpManbHO pa3BIIBaTbABIIraTeAb 811-17-07 Uberlastleistung einer Verbrennungskraftmaschine potencia de sobrecarga (de un motor de combustion interna) sovraccarico (di potenza) (d’un motore a combustione interna) vermogen bij overbelasting (van een output (of a thermo-electric vehicle) The output absorbed only by the traction motors and the exciter for the main generator or alternator. Traktionsleistung eines thermo-elektrischen Fahrzeugs potencia de traction (de un vehiculo termoeléctrico) potenza di trazione (d’un veicolo termoelettrico) tractlevermogen (van een verbrandingsmotor) mot trakcyjna traktionseffekt (pojazdu) 811-17-07 TRI-OBIIfl MOWHOCTb MOmHOCTb, L[IIR (TC~JTO3JK?KTpH’WXO~O HeO6XO~nMas a036yxKnenna AJIR nHTaH"R rnaaHbIx 80 - 50(811) 0 CE1 ~OABHXHO~O TarOBbIX renepaTopoB COCTaBa) ABHraTeJIeti nocToanuor0 II yCTpOnCTB umi nepeMeHHor0 TOKa. 811-17-08 puissance de dimensionnement Produit de la tension maximale par le courant unihoraire d’une génératrice principale, bien que ces valeurs puissent ne pas être fournies simultanément. dimensional output The product of the maximum voltage and the hourly rated current of a main generator, notwithstanding the fact that it may be impossible to obtain these values simultaneously. YCJlOBHafl THIIOBBR Ycnomoe Dimensionierungsleistung potencia de dimensionamiento potenza di dimensionamento dimensionaal vermogen ; ontwerpvermogen mot projektowa teoretyczna typeffekt MOUlHOCTb npou3eenenne MaKCRManbHOrO HanpnxeHna Ha TEK YacoBoro pexc~MarnaaaororeHepaTopa,Hee3~parrHa~o,~ToTaKoenanpflxeH~e~~0~ I-eHepaTOn 811-17-09 He MOTeTAaTb régulation automatique Ensemble régler OAHOBpeMeHHO. de puissance des dispositifs le fonctionnement principale d’un (thermique) véhicule du moteur à combustion ou del'alternateur,detelle organes de commande, interne reste à peu la près thermoélectrique, façon puissance interne que constante, dans par une et de pourune fournie le gamme employés pour la génératrice position donnée moteur à donnée de des combustion charges du automatische Lastregelung regulacion automatica de potencia (térmica) regolazione automatica della potenza automatische belastingregelapparatuur regulacja mocy automatyczna automatisk belastningsregulator train, de vitesses et de déclivités. automatic load regulation equipment Equipment controlling the operation of the interna1 combustion engine and main generator or alternator of a thermo-electric vehicle SO that for a given setting of the driving approximately aBTOMilTHW?CKOC COBOKynHOCTb nenrarenn the a range pt?Q’JlHpOBaHHC power of supplied train HBTPYSKH by loads, the speeds engine and remains gradients. 060pj’AOBaHHH np"MeHaeMbIX ,JW5I peryJInpOBaHna pa6OTbI anyrpemrero ToKa 'iTO6bI npn nBnraTeneM cropaann 14 rnaaHor0 reaepaTopa nocToflHHor0 lim eAmm*bI renno3nekrpnrecxoro nonanxororo cocraaa c 3anaHHoM MomHocTb pa3nnsHbIx 811-17-10 over yCTpOI?CTB, nepeMeHnor0 TeM, controller, constant nonoxeHnn 0cTaBanacb KonTponnepa npn6JIn3nTeIIbHO noTpe6naeMaa nocToaHHoti npe Harpy3Kax,c~opoc~ax,yKnoHax. affaiblissement de champ automatique Dispositif assurant automatiquement et progressivement la diminution du champ des moteurs de traction, de façon à permettre l’utilisation de toute la puissance disponible du moteur à combustion interne jusqu’à des vitesses de marche élevées. automatic automatische Feldregelung debilitamiento de campo automatico indebolimento automatico di campo automatische veldverzwakking oslabienie wzbudzenia automatyczne automatisk faltfursvagning field-weakening A system which automatically and progressively weakens the traction motor fields to increase the vehicle speed up to which full engine power cari be used. anroMaruuecuoe CncTeMa, B OCymeCTBJIaeTCs nOABn)KHOrO cnoco6es 811-17-11 rendement ocna6aeuue ~0~0p0ZI nonu ocna6nemie aBTOMaTAYeCKA COCTaBa HCnOJIb30BaTb AO TaKOti nOJIHyI0 de la transmission BO36yXAeHIU-I H nOCTeneHH0 BeJIHYIIHbI, MOIIIHOCTb AIIff npn TaroabIx nOBbIILIeHnR KOTOpOti ABnraTeneti CKOpOcTA JIOKOMOTIIB ABnraTeneii. (d’un véhicule thermoélectrique) Rapport de la puissance à la jante à la puissance de traction du ou des moteurs à combustion transmission interne. efficiency (of a thermo-electric vehicle) The ratio of the output at the wheel rim to the traction output of the interna1 combustion engine(s). Wirkungsgrad der Kraftiibertragung eines thermoelektrischen Fahrzeuges rendimiento de transmision (de un vehiculo termoeléctrico) rendimento della trasmissione (d’un veicolo termoelettrico) rendement van de aandrijving sprawnosc przekladni (pojazdu) transmssionsverkningsgrad 50(811) 0 811-17-11 - IEC K03@,,Hk,H‘?HT AeiiCTBHfl (TenuO3JIeuTpuueCuOrO llOJle3HOrO nOuBHWHOr0 COCTBBB) OTHOI"eHHe MOIIlHOCTu BHyTpeHHerO 811-17-12 Ha o6oAe KOneCa K TRrOBOti MOIIIHOCTU ABuraTenR CrOpaHu% consommation spécifique d’un véhicule thermoélectrique Consommation de combustible ramenée à l’unité de trafic, dont l’énoncé doit comporter, pour être complet, la désignation des unités respectives d’énergie et de trafic qui ont été retenues. specific fuel consumption The fuel consumption of a thermo-electric vehicle per traffîc unit which must, in order to be complete, state the fuel and traftïc units used. J’AeJ,bHblfi Pacxon spezifischer Kraftstoffverbrauch eines thermoelektrischen Fahrzeuges consuma especifico de un vehiculo termoeléctrico consuma specifico d’un veicolo termoelettrico specifiek brandstofverbruik (van een thermo-elektrisch voertuig) zuiycie paliwa jednostkowe specifik brGrslef6rbrukning (pojazdu) TOnJTHBaTeuJIO3JTeuTpHueCuOrOnOABHXtHOr0 COcTana PWXOA TonnuBa Ha ucnonb3yeMoro o6aeMa eAHHWY TOnnuBa u eAHHU& B nepeno30k KOTOpbIX c yKa3aHueM H3MepneTCR o6aeM nepeBo30K. 811-17-13 vitesse de ralenti minimale Vitesse minimale spécifiée par le constructeur, à laquelle le moteur à combustion interne peut tourner à vide. minimum idling speed The minimum speed specified by the manufacturer an interna1 combustion engine to run unloaded. MHHHMBJlbHafl CKOPOCTb h'ïuH"ManbHaSI MOXeT 811-17-14 at which it is possible for XOJIOCTOTO XOAa CKOpOCTb, pa6OTaTb YCTaHaBnUBaeMaSI ABUraTWIb BHyTpeHHerO U3rOTOBuTeneM, CrOpaHUSl6ex C KOTOpOii Harpy3KU. vitesse de ralenti d’utilisation Vitesse minimale réglé, lorsqu’il à vide, pour laquelle le moteur à combustion interne est est installé sur le véhicule. idling speed The minimum unloaded speed to which adjusted when installed in a vehicle. CKOpOCTb XOIOCTOTO MUHuManbHaff ABUraTenb 811-17-15 an interna1 combustion engine is XOJIOCTOrO CrOpaHUSl XOAa, Ha IIOCne ~o~opym er0 Ha eAuH"W COCTaBa. Ziinddrehzahl Vitesse minimale, à laquelle il faut amener le moteur à combustion interne pour obtenir son allumage, dans les conditions de température et de pression les plus défavorables rencontrées en service et avec le combustible normalement utilisé. firing speed The minimum speed at which an interna1 combustion engine must run to enable it to fire under the most unfavourable conditions of temperature and pressure likely to be encountered MuHUManbHaR CKOpOCTb, CrOpaHuSI B Hau6onee KOTOpbIe Aakirarena in service and with the fuel normally used. 3aîlEHl-aH”fl BHyTpeHHerO CMeCu tomgàngsvarvtal 0TperynkipoeaH yCTaHOBKu vitesse d’allumage CKOpOCTb Leerlaufdrehzahl velocidad de ralenti de utilizacion velocità di rotazione minima nullasttoerental prqdkosi: minimalna eksploatacyjna (silnika) XOAZl CKOpOCTb BHyTpeHHerO IIOABHXHOrO kleinste Leerlanfdrehzahl velocidad de ralenti minima minimo (della velocità di rotazione) minimale nullasttoerental predkosé minimalna nominalna (silnika) Kigsta tomg&ngsvarvtal MOryT C Anit KOTOpOti AOCTuXKeHUR He6narOrIpuRTHbIX UMeTb TonnuBe. MeCTO IIpU AOnXeH pa6OTaTb ABuraTenb CaMOBOCFInaMeHeHHR ycnosuax TeMnepaTypbI JKCIIJIyaTaLVU U npu rOpIW% HAaBneHuSI, 06bIYHOM AnSI ve’ocfdad p” encendido ve!n.cita dr accenstone mmlmaa’ ontsteektoerenta’ predkosf zapfonowa Grdningsvarvtal 50(811) 0 CE1 811-17-16 vitesse de pointe Vitesse maximale à laquelle un moteur A combustion cours d’un essai de plate-forme, overspeed interne est soumis, au dans des conditions (of an interna1 combustion spécifiées. engine) The maximum speed to which an interna1 combustion the test-bed, under specified conditions. CKOPOCTb IlpeAeJlbHaH MaKCHMaJIbHaH CrOpaHWI 811-17-17 (ABHraTeJIR CKOpOCTb, IIpH C CTeHAOBbIX BHYTpeHHerO KOTOpOti voertuig) predkose szczytowa CrOpaHHa) pa60TaeT IICIIbITaHU%X engine is subjected on Hochstdrehzahl der Verbrennungskraftmaschine velocidad de punta velocità massima di prova overtoerental (van een thermo-elektrisch ABHraTeAb B 3aAaHHbIX BHYTpeHHerO yCJIOBWIX. assignée ; vitesse nominale (déconseillé) velocidad asignada Vitesse de rotation à laquelle un moteur à combustion développer sa puissance nominale internationale. interne est capable de engine develops its speed The rotational speed at which an interna1 combustion international rated output. ; velocidad (desaconsejado) nominale toerental znamionowa markvarvtal HOMUHBJlbHafl CKOpOCTb BpameHW, pa3BISBaeT npI4 KOTOpOfi HOMHHaJIbHyH, ABHraTeAb MOmHOCTb, BHyTpeHHerO CrOpaHEiSI IIpHHRTyIO B KaYeCTBe MeXiAyHapOAHOü. 811-17-18 couple de décollage Couple minimal interne, pour Losbrechdrehmoment qu’il est nécessaire d’exercer sur un moteur à combustion par lui faire franchir lentement la première compression, dans les de température les plus défavorables rencontrées en service. conditions breakaway torque de reposicion coppia di spunto startkoppel moment uruchamiajqcy startmoment The minimum torque which must be applied to an interna1 combustion engine to enable it to turn slowly over the first compression stroke under the most unfavourable IlyCKOBOü conditions KPYTflllIKÏi MHHPIMaJIbHbIfi ABIWaTeAlo BpameHYra KpyTamHfI er0 encountered in service. MOMeHT MOMeHT. BHJ’TpeHHerO TeMIIepaTypbI, 811-17-19 of temperature IIepByIO KOTOpbIe CrOpaHWI, KOMIIpeCCmO MOI’J’T KOTOpbIfi YTO6bI HeO6XOAHMO IIpeOAOJIeTb B CaMbIX HMeTb M&CTO IIpHJIONSTb IIpPI He6JlarOnpH%THbIX IIpH K MeAJIeHHOM yC,IOBHaX JKCIIJIyaTau5iH. couple d’allumage Couple Ziinddrehmoment moyen nécessaire pour maintenir un moteur à combustion sa vitesse minimale interne à d’allumage. torque The average minimum torque firing K~YTRU@ 811-17-20 an interna1 combustion engine at its 3awKraKKn KpYTIImUti MkIHUMaJIbHOfi to maintain HeO6XOAEiMbIfI MOMeHT, CKOpOCTH 3aWUaHUa ABIWaTeJIR noAAepwtaHun nna BHyTpeHHerO Cr0paHI.m. lancement Anlassen Opération consistant à porter un moteur à combustion d’allumage. Le terme particulier. Note. - ne doit pas “démarrage” interne à sa vitesse Note. - dans ce sens uruchomienie uppstart of bringing The term ~:~C~omiento aanslaan être employé starting up The operation coppia ontsteekkoppel zaplonowy speed. MoMeKT CpeAHHfi required par de encendido “starting” an interna1 must combustion engine up to not be used in this particular firing speed. sense. nominal - 50(811) 0 IEC 811-17-20 83 - sanycu ffpOneCC .BOBeBeHBB CKOpOCTA BpameHBs BBuraTeBR BHyTpeHHerO CrOpaHu5-t no CKO~OCTII 3axkiraHua. TepMuH “starting” PiCl’IOJIb30BZlTbCIIB 3TOM CIIiW@WiCCKOM - CMbICJIe. npm4erawfe. 811-17-21 coupleur AH~JII&CKU~I (3anycK) ue Bonxea magnétique Embrayage progressif, pour l’entraînement magnetic magnetic électromagnétique, des auxiliaires utilisé soit pour le lancement, d’un moteur a combustion soit interne. coupling transmission A variable auxiliaries magnetic coupling, used either for starting of an interna1 combustion engine. up or for driving Magnetkupplung acoplador magnético frizione magnetica magnetiscbe koppeling sprzgglo magnetyczne magnetisk koppling the MarHnTHaa My@Ta MarnnTnaa nepenara PerynupyeMas MarHRTHaR BHyTpeHHWO 811-17-22 transmission Système My@Ta, npuMeH5IeMaa npu 3anycKe AJm BCIIOMOTaTWIbHbIX yC~p0tiCT~ mwïraTena BeRcTBne B CrOpaHWf. npuBeBeHuu électrique de transmission, à combustion interne pour convertir en puissance la puissance électrique mécanique d’un moteur de traction. electric transmission A transmission system in which the mechanical output of a prime converted to electric traction power to provide the drive. 3neuTpurecuafl mover is elektrische Ubertragung transmision eléctrica trasmissione elettrica mecbanisch-elektrische vermogensomzetting przekladnia elektryczna elektrisk transmission nepenaua B ~0~0p0B MexaHuBecKan MonmocTb nepBnrHor0 CmTeMa nepena9, BBIWaTeJIa npeo6pa3yeTcB B JJIeKTpWieCKyBJ A.JIaCO3naHHX TRI-OBOrO yCMJIW4. 811-17-23 vitesse d’emballement d’un groupe électrogène Vitesse maximale atteinte par le groupe, en cas de disparition de la pleine charge de la génératrice et de non-fonctionnement du régulateur de vitesse. runaway speed The maximum speed attained by the engine/generator full load of the generator if the speed regulator set after removal of the does not function. Durchgangsdrehzahl velocidad de embalamiento de un grupo electrogeno velocità (di rotazione) di fuga onbelast maximaal toerental zonder regeling prqdkosi: rozbiegowa maximivarvtal nOBbImeHHafl YaCTOTa BpameHufl MatmiManbHaa mopomb, nocmraeMa5i m3araTeneM mki reHepa-ropHofi ycTaHoBKoii nocne CHRTIIR nonsoti HarpysKa reHepaTopa, ecBu He @YHKUkiOHMPYCT perymmop CKOPO~TM. SECTION 811-18 - GÉNÉRATRICES DES VÉHICULES SECTION 811-18 - GENERATORS PA3AEJI 811-18 - TEHEPATOPbI 811-18-01 génératrice principale Génératrice FOR THERMO-ELECTRIC HA TElIJI03JIEKTPHYECICOM les moteurs par un moteur à combustion interne de traction. (d.c.) main generator A direct supplying current generator, the traction driven by the interna1 combustion engine and motors. I'JlaBHblii reHepaTOp nOCTOflHHOr0TOKa &HCpaTOp IIOCTOIIHHOTO TOKâ, tIpHBOAEïMbIü B AefïC~BW BHYTPCHHCTO CrOpaHWI, KOTOpbIil lIATaCT TRTOBbIC nBHl-LlTCJIM. VEHICLES IIOABHXHOM (de courant continu) de courant continu entraînée et alimentant THERMOÉLECTRIQUES ABEïraTeJlCM COCTABE Hauptgenerator (Gleichstrom) generador principal (de corriente continua) ; generatriz (en desuso) generatore principale (a corrente continua) (gelijkstroom)hoofdgenerator pqdnica glowna likstr6ms huvudgenerator 811-18-02 alternateur 50(811) 0 CE1 principal Génératrice interne 84 - de Hauptgenerator courant et alimentant alternatif les moteurs entraînée par un moteur li combustion alternador de traction. main alternator An alternating current and supplying the traction rnaeebrü generator, driven engine alternatore principale hoofdwisselstroomgenerator pradnica gGwna pradu przemiennego vtixelstroms huvudgenerator motors. reHepaTop nepeMeHBor0 ToBa reaeparop nepeMenuor0 roxa, BHyTpeHHerO CrOpaHEUI,KOTOpbIfi 811-18-03 (41 l-02-07) by the interna1 combustion (Wechselstrom) principa’ génératrice IlpHBOAAMbIii B AetiCTBHe ABHraTeneM IIATaeT TIIrOBbIe ABPiraTen&i. Asynchrongenerator generador asincrono generatore asincrono asynchrone Machine asynchrone fonctionnant en alternateur. asynchrone generator asynchronous generator induction generator An induction machine working as an alternating current pradnica asynchroniczna asynkrongenerator generator. aCBHXp0HHbu-i reHepaTop HHnyBuBoHBbtii reeeparop ACUHXpOHHaR Mannnia, TOKa. 811-18-04 pa6orammaa B pextaïvfe reaepa-ropa nepeMeunor0 génératrice auxiliaire Hilfsgenerator Alternateur ou génératrice de courant continu alimentant les services auxiliaires électriques d’un train, y compris le chauffage et la climatisation. generador auxiliar generatore ausiliario boordnetgenerator pradnica train power supply generator auxiliary supply generator An alternating or direct current generator services on a train, including the heating reeeparop supplying the electrically and air-conditioning. nepeMeHHor0 IIJIM IIOCTORHHOrO 3HeprMIoAnrr co6cTBeHHbIx HyxA noesAa,B KOHAHUkïOHHpOBaHH54BOJAyXa. génératrice Alternateur chauffage operated IlHTaHBfl .QJlflCO6CTBeHHblX HyBW nOe3Aa reHepaTOp 811-18-05 pomocnicza hjiilpkraftgenerator TOKa, TOM wicne BbIpa6aTbIBaIOIIWïti Anx 0TonneHkis IlnH Heizgenerator de chauffage ou génératrice électrique de courant continu alimentant uniquement le d’un train. de ca’efaccion generatore di riscaldamento generator voor venvarming pradnica ogrzewcza heating generator An alternating generador or direct current generator supplying only the electric heating tagvarmegenerator on a train. OTOuBTeJTbHblBreHepaTOp reHepaTOp IIOCTORHHOrO lUIl IIepeMeHHOrO TOKa, IIpeAHa3HaqeHHbIti AJW IIATaHCIR TOJIbKO WIeKTpWIeCKOii CIICTeMbI OTOnJIeHMR IIOeJAa. 811-18-06 (411-02-10) excitatrice Erregermascbine Génératrice fournissant tout ou partie de la puissance d’une génératrice ou d’un alternateur principal. nécessaire à l’excitation required for the excitation BO36yAUTeBb IIOAaIOUJUü BCIO UJlII reaeparop, B036yxAeHMff rnaBHor0 reHepaTopa reaeparopa nepeMennor0 roxa. YaCTb 3Heprliki, nocTosHHor0 eccitatrice opwekker wzbudnica ; pqdnica exciter A generator which supplies all or part of the power of the main generator or alternator. excitatriz HeO6XOAAMOü ToKa anu A.JIH rnaBHor0 matare prqdow wzbudzenia 50(811) 0 IEC 811-18-07 excitatrice 85 am Wellenende angebaute Erregermaschine excitatriz en extremo del eje eccitatrice coassiale asgekoppelde opwekker wzbudnica wspolosiowa axelmonterad matare en bout d’arbre Excitatrice montée sur l’arbre de la machine électrique dont elle fournit l’excitation. shaft-end mounted An exciter mounted the excitation. exciter on the shaft of the electrical machine for which it supplies BO36yAnTeJlb C )‘CTallOBKOü Ha KOHW BaJIa Bo36yuuTenb, YCTaHOBACHHbl~ Ha BWIY 3JIeKTpUWCKOti MkSIIUHbI, KOTOPYIO OH BO36ylKAaeT. 811-18-08 excitatrice à entraînement Excitatrice alimentant indépendant. independently An exciter indépendant la génératrice principale, entraînée par fremdangetriebene Erregermaschine excitatriz con accionamiento independiente eccitatrice (ad azionamento) indipendente onafhankelijk aangedreven opwekker wzbudnica o napedzie niezaleinym separatdriven matare un moteur driven exciter for the main generator, driven by a separate engine. BO36yAlïTeJlb C He3aBUCliMblM llpUBOAOM Bo36y~~Tenb AeikTBUe TJIaBHOTO resepa-ropa IIOCTORHHOTO TOKa, IIpUBOAUMbIti SECTION 811-19 - CONVERTISSEURS PRINCIPAUX SECTION 811-19 - MAIN AND AUXILIARY PASAEJI 811-19 - TJIABHbIiZ kl BCIIOMOTATEJIbHbIE 811-19-01 B OTAWIbHbIM ABUraTeJIeM. ET AUXILIAIRES CONVERTORS IIPEOEPA30BATEJIH convertisseur Ensemble, statique ou tournant, assurant la conversion d’un courant que en un courant de nature, de tension ou de fréquence différentes. électri- convertor A set of equipment, to another static or rotating, type different to convert in nature, voltage one type of electric and/or current Umformer convertidor convertitore omzetter przeksztaltnik omformare frequency. npeo6pa30aareab COBOKYIlHOCTb CTaTAYeCKUX UJIU BpaIIWOIL,UXCSl YCTPOtiCTB AJIR npeO6pa30BaHU5I OAHOTO POAa 3JICKTpWIeCKOrO TOKa B ApyrOii, C ApyrUM HanpmxeHueM u/unn racToTok 811-19-02 convertisseur principal Convertisseur fournissant la puissance Hauptumformer convertidor principal convertitore principale tractieomzetter przeksztaltnik glowny traktionsomformare de traction. main convertor A convertor providing traction power. rJlaBHblà llpeO6pa3OBaTWb fIpeo6pa30saTenb, 811-19-03 convertisseur o6ecnerusammuii Tsroeyro MomHocTb. auxiliaire Convertisseur fournissant la puissance nécessaire aux services auxiliaires, par exemple: éclairage, charge de batterie, climatisation, circuits de commande, etc. auxiliary convertor A convertor providing power for auxiliary services charging, air conditioning, control circuits, etc. e.g. lighting, battery BCllOMO~aTeJIbHblü llpeO6pa30BSlTfJJIb npeO6paJOBaTeAb, o6ecneWmatomaii MOIUHOCTb AJIR BCIIOMOTaTWIbHbIX Hyxozr, HanpHMep, Ann ocaemeHus, 3apSAKU aKK,‘M,‘JIRTOPMbIX 6aTapeti, KOHAULIUOHePOB, IWIU yIIpaBACHUff U T.n. Hilfsumformer convertidor auxiliar convertitore ausiliario hulpomzetter przeksztaltnik pomocniczy hjtilpkraftomformare 811-19-04 convertisseur rotierender Umformer convertidor giratorio convertitore rotante roterende omzetter przeksztaltnik wirujqcy roterande omformare tournant Convertisseur rotating 50(811) 0 CE1 86 - comportant seulement des machines électriques tournantes. convertor A convertor consisting apamatomnficfl only of rotating electrical machines. npeo6pa30aarenb llpeo6pa30BaTenb, coc~oa~wiii TonbKo 113 Bpamaromaxca 3neKTpuUecKUx MamUH. 811-19-05 convertisseur convertisseur statischer Umformer convertidor electronico ; convertidor estatico convertitore elettronico statische omzetter przeksztaxtnik statyczny statisk omriktare électronique statique Convertisseur des circuits n’ayant aucune partie en mouvement et utilisant notamment à semi-conducteurs. electronic convertor static convertor A convertor having no moving parts and notably using semi-conductor rectifiers. 3nercrponnbié npeo6pa30aarerb crararecrnii npeo6pa30nareab flpeO6pa3OBaTeJIb, B KOTOPOM OTCYTCTBYEOT nOABUU(HbIe YaCTU UCnOJIb3yIOTCR TJIaBHbIM o6pa3oM IIOJIyIIpOBOAHUKOBbIC npM6opbI. 811-19-06 convertisseur U Phasenumformer de phase Convertisseur assurant la conversion d’un courant alternatif d’un nombre phases donné, en un courant alternatif d’un nombre de phases différent. de phase convertor A convertor for the conversion phases to alternating npeO6pa30BaTeJIb wcna llpeo6pa30BaTenb TOK C .!JpyrUM 811-19-07 convertisseur frequency frequency current number of a given number of of phases. ToKa c OAUUM UucnoM @as B nepeMeHHbIU @33. Frequenzumformer de fréquence assurant en courant de fase convertitore di fase faseomzetter przemiennik faz fasomformare @as nepeMeHHor0 YUCIIOM Convertisseur fréquence, of alternating current of a different convertidor la conversion alternatif d’une d’un courant alternatif d’une certaine convertidor convertor changer A convertor for the conversion of alternating current to alternating current of a different frequency. of a certain de frecuencia convertitore di frequenza frequentieomzetter przemiennik czestotliwosci frekvensomformare autre fréquence. frequency llpeO6pa30BaTWlb YaCTOTbI llpeo6pa30saTenb ApyrOii UaCTOTbI. 811-19-08 convertisseur nepeMeHHor0 à fréquences Convertisseur ToKa 0A~0ii UacToTbI B nepeMeHHbIii TOK fixes de fréquence à rapport fixe entre les fréquences d’entrée et de sortie. fixed frequency A frequency frequencies convertor convertor in which the ratio between the input and output is fixed. llpeO6pa30BaTWlb IIOCTORHHOÜ‘IaCTOTbl npeO6pa30BaTenb YaCTOTbI, BbIXOAHOü YWTOTaMU B KOTOPOM OTHOUIeHUe MeHcny BXOAHOii IIOCTORHHOC. U Umformer mit fester Frequenz convertidor de frecuencias fijas convertitore (di frequenza) a frequenze fisse frequentieomzetter met vaste frequentieverhouding przemiennik czqstotliwoéci o stalej przekladni omformare med fast frekvensforhallande 50(811) 0 IEC 811-19-09 convertisseur à fréquences Convertisseur variables de fréquence à rapport de sortie, une des fréquences variable frequency 87 - variable pouvant entre les fréquences demeurer d’entrée et fixe. convertor A frequency convertor frequencies, in which npeo6pa30aarenb providing a variable ratio between one of the frequencies nepeMeunoü may remain input and output fixed. Umformer mit regelbarer Frequenz convertidor de frecuencias variables convertitore (di frequenza) a frequenze variabili frequentieomzetter met variabele frequentieverbouding przemiennik czqtotliwosci regulowany omformare med variabelt frekvensfi5rballande uacrorbi llpeo6pa30BaTenb UacToTbI, o6ecneruBaIomUü nepeMeHHoe 0THomeUUe MexAy BXOAHOU U BbIXOAHOfi YaCTOTaMU, B KOTOpOM OAHa U3 YaCTOT MO%?I OCTaBaTbCR nOCTOaHHOir. 811-19-10 convertisseur de courant continu Convertisseur, d’un courant continu en un courant continu d’une autre tension. d.c. convertor A convertor voltage. for the conversion npeo6pa30earenb of direct current to direct current of a different nocronnnoro Gleichstromumformer convertidor de corriente continua convertitore di corrente continua gelijkstroomomzetter przeksztaltnik prqdu statego likstrijmsomformare rorca l-lpeO6pa30BaTeAb, npeAHa3Ha’IeHHbIü AJIa npeo6pa30BaHUa nOCTOaHHOr0 ToKa oAUor0 HanpsxeHua B nocTo5mnbIil TOK Apyroro HanpnxeHUa. 811-19-11 hacheur (de courant) Convertisseur électronique de puissance de courant continu ne comprenant pas de circuit intermédiaire à courant alternatif, qui délivre une tension variable, en faisant alterner des périodes de conduction et de non-conduction en proportions variables. chopper A d.c. electronic power convertor without variable output voltage by varying tion in adjustable ratio. aMnynbcHblü an intermediate the periods of conduction a.c. link giving Gleichstromsteller (Chopper) interruptor pulsatorio frazionatore chopper ; directe gelijkstroomomzetter przeksztaItnik impulsowy prqdu stalego przerywacz chopper a and non-conduc- npeo6pa30narenb npeo6pasoBaTenb 3Hepruu nOCTORHHOr0 ToKa 6e3 npoMexyToUHor0 3BeHa nepeMeHHor0 ToKa, o6ecneUUBammUir pa3nUrHoe BbIxonHoe HanpaxeHUe nyTeM U3MeHeHUU nepUoAoB np0BoAU~oc~~ II HenpOBOAUMOCTU. %IeKTpOHHbIU 811-19-12 redresseur Convertisseur statique de courant alternatif en courant continu ou ondulé. current to direct rectifier A static convertor undulating for the conversion of alternating or current. Gleichrichter rectificador raddrizzatore gelijkrichter prostownik likriktare BblllpllMllTC3lb 811-19-13 CTaTUYeCKUti npeO6pa30BaTeAb, nepeMeHUor0 ToKa B nocToamIbIii npeAHa3HaUeHHbIii AJIa npeO6pa30BaHUa UnU nynbcspyromuii. onduleur Convertisseur statique de courant continu en courant alternatif. invertor A static convertor for the conversion of direct current to alternating current. llHBC?pTOp CTaTWIeCKUU nepeMeHHbIU. npeO6pa30BaTeAb AAa npeo6pa30BaHua nOCTORHHOr0 TOKa B Wechselrichter ondulador invertitore wisselrichter falownik viixelriktare ; 811-19-14 (41 l-04-07) groupe convertisseur Groupe composé ou plusieurs (tournant) d’un ou plusieurs moteurs mécaniquement accouplés à une génératrices. motor-generator A set which more 50(811) 0 CE1 88 - set consists of one or more motors mechanically coupled to one or Motor-Generator-Satz grupo convertidor (giratorio) gruppo convertitore (rotante) motor-generator zespti silnik-prqdnica motorgenerator generators. Morop-reneparopuan ycranoesa YCTaHOBKa, BK,IEOYaEOILWI OAllH IlJIA HWKOJIbKO ABHraTenefi, MeXaHWICCKII COeAAHCHHbIX C OAHHM IUIH HCCKOJIbKAMMreHepaTOpaMH. 811-19-15 groupe auxiliaire Ensemble comportant un moteur d’entraînement électrique ou thermique et une ou plusieurs génératrices destinées à alimenter les services auxiliaires. auxiliary generator A set comprising prime mover set one or more to provide ncnoMorareabnafl generators auxiliary reueparopuan power driven by an electric motor or a Hilfsgeneratorsatz grupo auxiliar gruppo ausiliario boordnetgenerator zespol silnik-prqdnica hjtilpkraftaggregat pomocniczy supplies. ycranonra YCTaHOBKa, BKJIIOYZUOLLWIOAIIH MJIl?HeCKOJlbKOreH’?paTOpOB, IIpPiBOAHMbIX B A&CTBHC WICKTpOABHraTCJIeM IUII4 IICpBWiHbIM ABIITaTCJCM, AJIR IIATaHAII BCIIOMOraTWIbHOl-0 060p)‘AOBaHIWI. 811-19-16 groupe (d’excitation) de freinage Groupe convertisseur destiné à l’alimentation des enroulements des moteurs de traction fonctionnant en génératrice pendant électrique. dynamic d’excitation le freinage brake exciter A motor-generator set supplying the field windings of traction they may act as generators during dynamic braking. motors Bremserregermaschine grupo (de excitation) de frenado gruppo (d’eccitazione) di frenatura opwekker voor elektrisch remmen wzbudnica hamowania dynamicznego elbromsmatare SO that BO36J’AUTC!JTb 3JleKTpO~UHaMl4’lt?CKOl-O TOPMOSB MOTO~-reHCpaTOpHZl YCTaHOBKa, npCAHa3HPiCHH%I AJIR IIATaHAR 06MOTOK B036YW(AeHPiR TRFOBbIX ABGilYlTenCii TaK, YTO6bI OHH ACiiCTBOBaAH B pemiMe ï-eHCpaTOpa B IICpkïOA AlïHaMPiW?CKOrO TOpMO~tteHli~. SECTION 811-20 - ACCUMULATEURS SECTION 811-20 - BATTERIES PA3AEJI 811-20 - AKKYMYJIIITOPbI 811-20-01 (486-01-01) accumulateur (électrique) Système électrochimique électrique capable reçue et de la restituer (electrochemical) battery d’accumuler, sous forme chimique, par transformation l’énergie inverse. ce11 An electrochemical system capable of storing in chemical from energy received and which cari give it back by reconversion. (Batterie-Zelle) Akkumulator acumulador (eléctrico) accumulatore (elektro-cbemische) ce1 of accumulator akumulator elektrisk ackumulator the electric BTOpBSHblii X,,Mlt’,‘?CKki BCTOYHWKTOKâ BKKYMYJlRTOP HaKNIJIPiBaTb IIOlIJ’%leMj’IO %eKTpOXPïMWIeCKa~ CIICTeMa, cnoco6aarr WICKTpIPICCKJ’IO JHeprtWO B XllMHYCCKOii +OpMe II BOJBpaLLIaTb Cë 06paTHO IIOCpeACTBOM IIpeO6pa30BaHWI. 811-20-02 (486-01-03) batterie (d’accumulateurs) Deux ou plusieurs d’énergie. éléments connectés entre eux et utilisés comme source (secondary) battery (rechargeable) battery storage battery (USA) Two or more cells electrically connected and used as a source of energy. Batterie bateria (de acumuladores) batteria (di accumulatori) accubatterij bateria akumulatorow batteri - 50(811) 0 IEC 811-20-02 (486-01-03) 89 - GiKKYMJ’JlRTOPHaR 6aTapefl ,@a aKKyMyJISITOpOb, CBSI3aHHbIX MeHcAy ~0608 HJIII 6onee 3JIeKTpAYeCKPIM COeAEIHeHIleM PI PICnOJIb3yeMbIX B Ka=IeCTBe IICTO'IHIIKa 3HeprHH. 811-20-03 (486-03-01) capacité (d’un accumulateur) Quantité d’électricité (charge res-heure (Ah), qu’une conditions spécifiées. capacity The batterie électrique), généralement complètement chargée exprimée Kapazitat capacidad (de una bateria) capacità (d’una batteria) capaciteit (van een ce1 of accubatterij) pojemnoJC akumulatora kapacitet en ampè- peut débiter dans des (of a cell or batte@ quantity hour (Ah), of electricity which a fully (electric charged charge), battery usually cari deliver expressed under in amperes- specified condi- tions. BMKOCTb (aKKyMyJlflTOpa IIJIII6aTapea) KOJIWIeCTBo 3HeprMA (3JIeKTpWIeCKHii JapRA), 06bIYHO BbIpaxeHHOe B KOTOpOe MOWZT 6bITb OTAaHO IIOJIHOCTbK) 3apSDKKeHHbIM aMnep-sacax, aKKyMyJIRTOpOM npH 3aAaHHbIX yC3IOBIUlX. 811-20-04 autonomie (d’un véhicule alimenté par une batterie d’accumulateurs) Parcours maximal qu’un véhiculé donné peut effectuer, sans qu’il soit procédé à une recharge de la batterie, lorsque celle-ci est complètement chargée au moment du départ. operating range (of a battery-electric Aktionsradius (eines Batterie-Fahrzeuges) autonomia (de un vehiculo alimentado por una bateria de acumuladores) autonomia (d’un veicolo ad accumulatori) actieradius (van een elektrische batterijvoertuig) vehicle) The maximum distance over which a given vehicle cari operate without recharge of the battery, assuming that the battery is fully charged at the time zasiqg (jazdy) aktionsradie of departure. pa6ovuii ~EGllla30H (aKKyMyJISITOpHOr0 3JIeKTpHYeCKOrO IIOABIDKHOr0 COCTaBa) MaKCIIMaAbHOe paCCTOSIHFIe, KOTOpOe MOTeT npOXOAHTb AaHHaSI eAIIHI%IIa nOABIEKHOr0 COCTaBa A0 pa3pSIAKkI aKKyMyJIRTOpOB, npeAnO,Iaran, YTO B MOMeHTOTnpaBJIeHPIR COCTaBa aKKyMy,IRTOpbI IIOJIHOCTbIO 3apSKeHbI. 811-20-05 (486-01-12) décharge (d’un accumulateur) Opération pendant laquelle un accumulateur fournit du courant à un circuit extérieur par la conversion de l'énergie chimique en énergie électrique. discharge (of a ce11 or battery) An operation during which a battery delivers current to an external the conversion of chemical energy to electric energy. 811-20-06 (486-01-11) circuit by charge (d’un accumulateur) Opération pendant l’énergie électrique laquelle un accumulateur reçoit d’un circuit extérieur qui est transformée en énergie chimique. de charge (of a ce11 or battery) An operation during which a battery receives energy is converted which 3apflAKa(aKKyMyJIRTOpa npOueCC, into chemical from an external HJIA 6aTapea) npH KOTOpOM aKKyMyJIRTOpHaR 6aTapeH cycle d’utilisation (d’un IIOJIyYaeT OT BHeIIIHeti B XAMWIeCKyIO. accumulateur) Ensemble d’une décharge et d’une l’accumulateur dans son état initial. operating Laden carga (de una bateria) carica (d’una batteria) laden (van een ce1 of accubatterij) ladowanie laddning energy. UenH 3JIeKTpWIeCKyIO 3HeprHEO,npeo6pa3yeMyIO 811-20-07 circuit electric Entladen descarga (de una bateria) scarica (d’una batteria) ontladen (van een ce1 of accubatterij) wyfadowanie urladdning charge ultérieure destinée à rétablir cycle (of a ce11 or battery) The discharge and subsequent initial conditions. recharge of the ce11 or battery to restore the Arbeitszyklus ciclo de utilizac%n (de una bateria) ciclo di utilizzazione (d’una batteria) gebruikscyclus (van een ce1 of accubatterij) cykl pracy driftcykel 811-20-07 pa6oquti 50(811) 0 CE1 UUKJI (aKKyMynZ4TOpa IlJIu 6arapen) Paspnnxa u nocnenyroman AO nepuonauanbuoro 811-20-08 90 - sapsnxa ranbsauureckoro aneMeura nnu Garapen COCTO~HAS. charge automatique Système automatisches de charge d’une batterie, dans lequel le courant matiquement à l’état de charge de la batterie, afin rapidement que cela est compatible avec sa protection, décharge initial. automatic An est adapté auto- de la recharger aussi quel que soit l’état de Laden carga automatica carica automatica automatisch laden ladowanie samoczynne automatisk laddning charge arrangement automatically for recharging varied as required a battery in which aim of recharging as quickly as possible consistent battery, whatever its initial state of discharge. anroMarnnecuafl CHCTeMa the charging current by the state of the battery, generally with is with the the safety of the 3apflAna 3apRAKH Garapeu, B KOTOPOti 3apSAHbIi-i TOK I13MCHRCTCII aBTOMaTWIeCKH B COOTBCTCTBI’IAC IIapaMeTpaMa II KOTOpaR npeAHa3Ha9eHa AJE YCKO,,CHHOfi 3apSIAKH, COrnaCyKWCüCR C TpC6OBaHWZM 6e30naCHOCTU Garapen, 811-20-09 HC3aBIICIIMO OT IICpBOHaYanbHoro COCTORHkiRpa3pflAKH. charge rapide Charge durée. Schnelladen partielle faite généralement à un régime élevé, pendant une courte boost charge rapid charge A partial charge, AosapeAua ycuopenuafl usually sapnnua IIpOH3BOlWMaX SECTION Sll-21- COMPRESSEURS SECTION 811-21- COMPRESSORS PA3AEJI 811-21- 06bIYHO B ET POMPES AND PUMPS KOMIlPECCOPbI M HACOCbI compresseur Machine freins, Kompressor destinée à produire de l’appareillage l’air comprimé pneumatique, nécessaire au fonctionnement des etc. compresser A machine carica rapida snelladen ladowanie szybkie snabbladdning at a high rate for a short period. YaCTH’iHarr 3apRAKa aKKyM,‘JISITOpHOIi Garapen, YCKOPCHHOM PEKHMC. 811-21-01 carga Wda supplying compressed air to operate brakes, pneumatic control (Hauptluftpresser) compresor compressore compresser sprgiarka kompressor gear, etc. Mamsua, npe~na3nauenHaR Anfl o6ecneuenus noAaw CxaTOrO BO3AyXa AnR IIpHBeAeHWI B AetiCTBEIC TOPMOSOB, IIHeBMaTWICCKOti CIICTeMbI ynpaBnCHH% M T.A. 811-21-02 groupe (moteur) motocompresseur Ensemble compresseur constitué par un compresseur comprenant habituellement valve de sécurité, etc. compresser Kompressor-Einheit (Satz) grupo (motor) compresor ; motocompresor le régulateur et son moteur de pression, d’entraînement le silencieux, et le filtre, la unit Equipment comprising including the governor, a compresser and its driving motor, silencer, strainer, safety valve, etc. and usually (gruppo) m”tocompressore compressoraggregaat zesp% spreiarkowy kompressoraggregat -9l- 50(811) 0 IEC 811-21-02 KOMIlpIXCOpH2lSl)XT&3HOBKa(MOTOp-KOMnpeCCOpa) ArperaT, coc~onm~iti perynnrop, 06bIYHO 811-21-03 compresseur ~3 KoMnpeccopa ABm-aTenff 14 BKnwIammG Hilfskompressor auxiliaire Compresseur destiné à produire du compresseur principal. auxiliary 14 ero rnymuTenb,@InbTp,npeAoxpaH~TenbHbIlKnanaHkI~.A. de l’air comprimé, avant le fonctionnement compresser A compresser intended to produce compresser is available. a supply of compressed air before the main comPresor auxiKar compressore ausiliario hulpcompressor sprqiarka pomocnicza hjalpkompressor BCllOMOl-BTeJlbHblEÏKOMllpWCOp KoMnpeccop, IIpcAHa3HaYeHHbIti pa6OTbI rnaeaoro 811-21-04 compresseur Kolbenkompressor à pistons Compresseur comprimé Ann IIOAaWI CHCaTOrO BO3AyXa A0 HaYana Kohotpeccopa. comprenant un ou plusieurs cylindres, dans lesquels l’air est par des pistons. reciprocating compresser A compresser comprising by a piston or pistons. nopmesblti one or more cylinders in which air is compressed compresor de piston compressore alternativo zuigercompressor sprgiarka tlokowa kolvkompressor Kohmpeccop KoMnpeccop, COAepHtamIIti OAAH MJIH HeCKOnbKO UkInHHApOB, B KOTOpbIX B03AyX CLRMaeTCII IIOpUIHcM IlnM IIOpUIHSIMEI. 811-21-05 compresseur rotatif Rotationskompressor Compresseur dans lequel la rotation d’un ou plusieurs éléments conjugués convenablement entre eux et avec l’enveloppe extérieure engendre la compression de l’air. rotary compresser A compresser in which air is compressed between one or more shaped rotating elements and the casing within which they move. compresor rotative compressore rotative roterende compresser spraiarka wirnikowa rotationskompressor specially POT8UWOHHblÏi KOMllpeCCOp Koïvrnpeccop, B KOTOpOM HcCKOnbKAMH BpamafOmIIMI4 KOTOpOM OHIIABIWaH3TCII. 811-21-06 BO3AyX GXIIMaeTCII 3JIcMeHTaMII oc0608 MEKAy OAHHM Anli @OpMbI Ii KOpIIyCOM, B pompe à vide Machine Vakuumpumpe rotative fonctionnement ou à pistons destinée à produire le vide nécessaire au du frein à vide. exhauster vacuum exhauster A reciprocating or rotary machine creating vacuum to operate bomba de vacio pompa del vuoto vacuumpomp pompa proiniowa vakuumpump the vacuum brake. BaK~MHblti HPCOC Porauaomian mn4 nopmeeaan Matmina, npenna3ua9euna5i Ann co3uanmr BaKyyMa,HcO6XOAHMOrO AJIR pa6OTbI BaKyyMHbIX TOpM030B. 811-21-07 pompe à huile Pompe destinée refroidissement. Olpumpe à faire circuler de l’huile dans un circuit de pression ou de oil pump A pump which circulates oil in a pressure or cooling circuit. MaCJlflHblk H%OC Hacoc, KOTOpbIti BbI3bIBacT UkIpKyJUIUIIKl MaCna B CUCTeMe AaBJIcHHn Ami 0xnaHcAeHmI KoMnpeccopa. bomba de aceite pompa dell’olio oliepomp pompa olejowa oljepump - 92 811-21-08 50(811) 0 CE1 handbetiitigte Luftpumpe bomba de aire manual pompa a mano handluchtpomp spreiarka reczna handdriven luftpump pompe à air manuelle Pompe à commande fonctionnement manual destinée à produire de l’air comprimé, avant le du compresseur. air pump A manually driven manuelle operated compresser pump used to produce compressed air before a power- (Handluftpresser) operates. BO3AJ’lUHblfi HBCOCC PYYHblM IIPHBOAOM Hacoc C pyYHbIM Bo3AyxaAo IIpIfBOAOM, IIpCAHa3Ha9eHHbIfi An5I BbIpa6OTKII 0KaTOrO Haqana pa6OTbI KoMnpeccopa. SECTION 811-22 - REFROIDISSEMENT À AIR SECTION 811-22 - AIR COOLING PA3AEJI 811-22 - B03AYIBHOE 811-22-01 OXJIAXAEHHE Liifter ventilateur Machine destinée refroidissement à augmenter l’énergie d’un moteur, de pression d’un transformateur, ou dynamique de l’air de etc. blower fan A machine designed to increase the pressure for a motor, transformer, etc. or kinetic energy of cooling ventilador ventilatore ventilator wentylator flakt ; dmuchawa air BeHTARflTOP MamuHa, npeAuaaHa4eHHaa oxnaHcAafomer0 811-22-02 BosAyxa Ann yBCnWieHH~ AaBneHMn B ABMraTene, rpaHc@opMarope EIJIII ABHx(eHax u r.n. Liifteraggregat grupo (motor) ventilador groupe (moteur) ventilateur motoventilateur Ensemble constitué par un ou plusieurs ventilateurs et leur moteur d’entraî- (gruppo) ventilator groep zesp81 wentylacyjny fliiktaggregat nement. fan set A unit made up of one or more blowers and their driving ; motoventilador m”toventi’atore motor. BeHTUnflTOpHaRYCTaHOBKa Arperar, COCTO5IIIQI8 ABwaTenek 811-22-03 ventilateur ventilateur radial centrifuge Ventilateur traversé 113 linA OAHOI-0 par l’air en direction HCCKOnbKHX BeHTkInSTOpOB II Radialliifter ventilacion radial ; ventilador centrifuge ventilatore centrifuge ; ventilatore radiale radiale ventilator wentylator odsrodkowy ; dmuchawa osiowa radialfliikt radiale. radial flow fan A fan through 811-22-04 which the air moves radially. qeHTpO6exHblii B‘?HTWIflTOp BCHTkInRTOp,B KOTOpOM B03AyX ABIGKCTCII B paAHanbHOM HaIIpaBneHm. ventilateur ventilateur Ventilateur rotation. Axiallüfter ventilador axial ; ventilador axial à hélice dans lequel le mouvement de l’air a lieu parallèlement à l’axe de A fan in which vex~~~~“i~~~~ wentylator axiaiflakt axial flow fan the air moves in a direction parallel to the axis of rotation. OCI.?BOfi BeHTtlJlflTOp BeHT&in5ITOp,B KOTOPOM OCII BpaIueHHa. ~03Ayx ABnxeTcff B HanpaBneHu%napannenbaoM de hélice osiowy ; dmuchawa osiowa 50(811) 0 IEC 811-22-05 ventilation naturelle Ventilation dans ventilateur, par convection laquelle le mouvement 93 - de l’air ou par le mouvement a lieu, sans l’aide d’un du véhicule. natural ventilation A cooling system in which the movement of the air takes place by convection or by the movement of the vehicle, without the aid of a fan. natiirliche Beliiftung ventilation natural ventilazione naturale natuurlijke ventilatie przewietrzanie naturalne naturlig ventilation eCTeCTBL?HHBfl Bt%lTtUlRUWl CHCTeMa OXJIaXAeHAR,B KOTOpOfi ABiIXeHAe BOJAyXa IlpOHCXOJUiT 3a CYeT KOHBeKUAII kIJII4 ABATeHIIR eAliHHUb1 IIOABAXHOl-0 COCTaBa 6e3 I’IOMOIIW BeHTkin5lTOpa. 811-22-06 ventilation forcée Ventilation externe. dans laquelle le mouvement de l’air est obtenu par une force forced ventilation A cooling system in which the air is moved by external power. Fremdbelüftung ventilation forzada ventilazione forzata geforceerde ventilatie przewietrzanie wymuszone forcerad ventilation llpElHJ’AllTt!JlbHaRBeHTflJlfl~lWl CPiCTeMa OXJIaXAeHAR, B KOTOpOii ABIlXeHIle BOJAyXa OCYIIleCTBJIReTCII 3a CYeT 3HeprPWi BHeIIIHeTO HCTOYHAKa. 811-22-07 autoventilation Ventilation mouvement dans laquelle de l’air. le rotor de la machine engendre lui-même le self-ventilation A cooling system in which the air is moved CPïCTeMa OXnaXAeHRR, B KOTOpOfi pOTOpOM CaMOfi MaIIIAHbI. by the rotor of the machine ABItXeHHe SECTION 811-23 - ÉCLAIRAGE, BOJAyXa PA3AEJI 811-23 - OCBEuEHkIE, 811-23-01 éclairage éclairage Mode ET CLIMATISATION AND AIR CONDITIONING OTOIIJIEH&IE, KOHAI4I.JkIOHRPOBAHI4E général collectif d’éclairage de distribution multiple OCyIIIeCTBZWI‘ZTCSJ CHAUFFAGE SECTION 811-23 - LIGHTING, HEATING itself. dans lequel les voitures placé Eigenbeliiftung autoventilacion autoventilazione eigenventilatie przewietrzanie wfasne sjalwentilation sont éclairées au moyen d’un circuit le long du train. coach lighting B03AYXA Allgemeinbeleuchtung iluminacion general ; iluminacion colectiva illuminazione centrale treinverlichting odwietlenie (wagonu) centralne belysning med genomgaende matning A method of lighting in which the coaches are lit by means of a supply circuit distributed throughout the length of the train. UeHTpWll(30BaHHOe OCBeUJeHile Cnoco6 OCBeILIeHHR,IIpPI KOTOpOM OCBeIUeHlle BaTOHOB OCYlUeCTBnReTCII OT ceTI.i,nponoxeHHoii Bnonb noesna. 811-23-02 éclairage Mode autonome d’éclairage indépendant individual dans lequel chaque voiture comporte un circuit d’éclairage de celui des autres voitures. coach lighting A method of lighting lighting circuit. in which each coach is tïtted with a self-contained BBTOHOMHOe OCBelWHUt! Cnoco6 OCBe~eH~~,~p~KOTOpOMKaXAbI~Ba~OHCHa6W(aeTCIIaBTOHOMOHO~ OCBeTHTenbHOfi CeTbIO. Einzelwagenbeleuchtung iluminacion autonoma illuminazione autonoma rijtuigverlichting oswietlenie (wagonu) indywidualne individuel1 vagnbelysning 811-23-03 (845-09-10) éclairage 50(811) 0 CE1 94 Notbeleuchtung de secours Eclairage prévu l’éclairage être utilisé en cas de défaillance de l’alimentation de iluminacion lighting provided asapaiieoe for use when the supply to the normal lighting de socorro illuminazione d’emergenza noodverlichting oawietlenie awaryjne nodbelysning normal. emergency Lighting pour fails. ocnemeune Ocsememe, IIpeAyCMOTpeHHOe IIoBpeaAeHMR cnysae a 06bIYHOrO OCBemeHAII. 811-23-04 Stirnleuchte phare Lampe électrique montée sur les parois frontales et dont les rayons lumineux sont concentrés. du véhicule de tête du train EaE frontlamp ; frontsein projektor czolowy ; reflektor toppstralkastare headlamp An electric giving lamp mounted a concentrated on the front of the leading vehicle of a train and czofowy beam. IlpoxeeTop %eKTpWIeCKaa JIaMna, AaIOmaa CKOHueHTpIIpOBaHHbIti JIy’I CBeTa CI yCTaHOBAeHHaa Ha JIO6OBOti ‘IaCTH rOJIOBHOfi eAPIHIWbI nOABHH(HOr0 CocTaBa. 811-23-05 génératrice Génératrice, circuit Generator d’éclairage souvent d’éclairage entraînée électrique par l’essieu, destinée à l’alimentation du d’un véhicule. lighting dynamo A generator, reaepaTop often axle-driven, supplying the lighting circuit of a vehicle. generatriz (Lichtmaschine) .r de iluminac’on generatore d’illuminazione verlichtingsgenerator prqdnica olwietleniowa belysningsgenerator ocnemennfl reHepaTop, 06bIYHO npuBoAHMbIti B AeI?CTBHe OT OCR, npeAHa3HaqeHHbIb AJIa IIHTaHPIa OCBeTPITenbHOii CeTPi eAUHMIlb1 IIOABIIEHOrO CocTaaa. 811-23-06 Klimatisierung climatisation Traitement de l’air ambiant d’humidité de valeurs pour l’amener à une température .I climatizac’on et à un degré préfixées. air conditioning Treatment of temperature the ambient air to bring it to predetermined conditions of climatizzazione luchtbehandeling klimatyzacja luftkonditionering ; klimaatregeling and humidity. KOH~AUAOHBpOBaHHe BO3nyXa 06pa6oTKa OKpyx(aIomer0 KOHA~~H 811-23-07 préchauffage Chauffage er0 A0 3aAaHHoft Vorheizen precalefaccion (de un vebiculo) preriscaldamento (d’un veicolo) voorverwarming (van een voertuig) podgrzewanie wstcpne fijruppvarmning avant la mise en service d’un véhicule. (of a vehicle) a vehicle nonorpes AJIa AOBeAeHIIR I1 BJIaxHOCTA. (d’un véhicule) effectué pre-heating Heating BO3AyXa no -reMnepaType before it enters service. (e~AHM,,bI no~BnxHoro oTonneHMe ~~HHEI~bI COCTBBB) IIOABMTHOrO COCTaBa IIepeA nycKoM eë a 3xcnnyaTaumo. 811-23-08 refroidissement Refroidissement son installation Vorküblen préalable d’un véhicule avant sa mise en service, en faisant fonctionner de climatisation. pre-cooling Cooling the passenger of a vehicle before accomodation it enters service. by operating the air conditioning system .I refrVZerac’on previa prerefrigerazione voorkoeling chlodzenie wstgpne foravkylning 00007 - 50(811) 0 IEC 811-23-08 npeneapnTeabeoe OxnaxAeHHe 0xaaXgeeue naccaEupcKAx Kyne c IIOMOUIbIO CHCTeMbI KOHAUUUOHUPOBaHUR BOJAyXa CAUHHUbI IIOABU~HO~O COCTaBa IIepeA nyCKOM eë~ 811-23-09 3KcnnyaTaUmo. installation installation de préconditionnement de préchauffage Installation stationnaire destinée à alimenter les circuits de climatisation de chauffage d’un train avant sa mise en service. ou energy-supply station pre-heating supply pre-conditioning supply A fixed installation supplying equipment of a train before nirrammafl cTaHuufl power to the air-conditioning or Energieversorgungsstation instalacion de precalefaccion impianto per la preclimatizzazione impianto per il preriscaldamento voorverwarmingsinstallatie urzqdzenie klimatyzacji wstqpnej varmepost ; heating it enters service. CTaUUOHapHZSI YCTaHOBKa, IIUEWJIIW4 06Op)‘AOBaHUC AJIS OTOIIJIeHWl EiJIU KOHAllUllOHIIpOBaHIIR BO3AyXa B nOe3AeAO nyCKa B JKCnJIyaTaLWO. 811-23-10 contacteur de chauffage Contacteur mettant sous tension les circuits de l’installation et/ou des services auxiliaires d’un ou plusieurs véhicules. Heizschütz (Energieversorgungsschütz) contactor de calefaccion contattore ausiliario (ad alta tensione) hoogspanningsverwarmingsschakelaar stycznik ogrzewania tagvarmekontaktor de chauffage heating contactor train power supply contactor auxiliary power supply contactor A contactor controlling the supply services of one or more coaches. of power to the heating circuits or other BblKJltO’iaTCJlbllO~WlU IIUTBHUR BblKJIlOYBTCJlbBCIIOMOI-aTt?JlbHblX Uelleii KOHTaKTOp, OCyIJJeCTB.WlEOIU~ti &onwenbHbIx Ueneii mm npymx naccaXKApcKHx BWOHOB. 811-23-11 conduite ynpaaneskie 3HeprocHa6~eHkieM uenel OAHOTO UJIU HeCKOJIbKHX de chauffage Conducteur électrique constituant installations de chauffage la ligne de train, pour et d’autres services auxiliaires, l’alimentation des sur chaque véhicule. heating train line train power supply line auxiliary power supply line An electric table other services running throughout a train and supplying or on each coach. MaracTpaab 3HeprocHa6Xenns MaIllC~p%lb 3HeprOCHa6îlteHUfl BCllOMOEWWlbHbIX IWl& %IeKTpWIeCK&ï nmam&i the heating Zugsammelschiene (Zugheizleitung) conducto de calefacciCm condotta ad alta tensione hoogspanningsverwarmingskabel przewod (elektryczny) zbiorczy ogrzewania tagvtirmeledning Ka6enb, 0ronmenbHym noe3Aa npono~eHHbl8 HJIH npyrae no Uem BCeMy COCTaBy Kaxnoro noe3na II naccamïpcKor0 BaroHa. 811-23-12 accouplement coupleur de chauffage Connexion électrique, facilement désaccouplable, comportant une boîte et une fiche pour la jonction de la conduite de chauffage entre les véhicules. heating jumper train power supply jumper An electrical connection, easily disconnected, comprising coupling the heating train line between vehicles. a plug and socket Me)lEAJ’BiWOHHOC COeJ,UHeHU‘ZMarUCTpanU OTOUJIeHUR M‘SK~J’BZWOHHOeCOCAUHCHUCMarUCTpanU 3HePrOCHa6WHUfl PasseMHoe 3neKTpwecKoe coemïHemïe, u KoTopoe BX~AIIT UmencenbHafl po3e-rKa, npenHa3HaqeHHbIe Ans coemHeHm OTOIIJEHUR MEUAy CAUHUUaMU nOABkïTHOr0 COCTaBa. mrencenb z4 Mamc-rpam Zugsammelschienenkupplung (Zugheizkupplung) acoplamiento de calefacciCm accoppiatore (ad alta tensione) hoogspanningsverwarmingskoppeling sprzqgnik ogrzewania elvarmekoppling 811-23-13 96 - 50(811) 0 CE1 dégivreur Scheibenheizung Dispositif destiné à empêcher la formation de glace sur les vitres de la cabine de conduite. defroster A device to dispel ice from the Windows of a driver’s cab. descongelador sbrinatore ruitverwarming odmraiacz szyby defroster aHTHO6JleAeHUTeJlb YcTpoücT~o 811-23-14 Am ycTpaHeHUs HaneAH c OKOH Ka6UHbI MaImiHIICTa. antibuée Scheibenklaranlage Dispositif destiné à empêcher cabine de conduite. la formation d’humidité sur les vitres de la demister A device to dispel mist from the Windows yc~potic~no npoTne 3anoTenaana YcTpoficT~o 3anoTeBaHm. ,&JIH of a driver3 antivaho dispositivo antiappannamento ontwasemer odparowywacz szyby ....< cab. cTeKofl npeAoxpaHeHm CTeKOn Ka6AHbI MaLIIUHUCTa 01 SECTION 811-24 - MESURE DE LA VITESSE DES TRAINS SECTION 811-24 - MEASUREMENT PA3AEJI 811-24 - H3MEPEHHE 811-24-01 génératrice CKOPOCTM l-IOE3AA d’essieu Génératrice entraînée par un essieu et dont proportionnellement à la vitesse du véhicule. axle-driven la vitesse de rotation varie generator A generator driven by an axle and whose rotational to the speed of the vehicle. oceaol OF TRAIN SPEED speed varies in proportion Achsgenerator generatriz accionada generatore d’asse asgenerator prqdnica odosiowa axeldriven generator por eje reaepaTop reHepaTOp, npUBOAUMbIti B AetiCTBUe OCbEO, YaCTOTa BpaIIJeHkm KOTOpOrO U3MeHReTCII npOnOpuUOHalIbH0 CKOpOCTUABEGUeHEiReAUHUUb1 nOABUXHOT0 cocTaBa. 811-24-02 génératrice tachymétrique Génératrice angulaire qui engendre une tension de sortie proportionnelle à la vitesse de son rotor. tacho-generator A generator angular which produces an output voltage proportional to the rotor Tacho-Generator generador tacométrico generatore tachimetro tachogenerator prqdnica tachometryczna takometergenerator speed. TaxorenepaTop reHepaTop, co3AamuUl yrnonoii c~opocT~ poTopa. 811-24-03 BbIxoAHoe Hanpmeme, nponopunoaanbaoe tachygraphe Appareil qui enregistre du temps une vitesse, généralement ou de la distance celle d’un train, en fonction parcourue. tachograph An instrument which produces a record a function of time or distance travelled. of speed, usually the train speed, as Taxorpa<P rIpUGop, npeAHa3HaqeHHbIti AJIR 3anUCU CKOpOCTH, 06bIYHO noesAa, a @YHK~I~P~ npeMean nnri npoki~ennoro paccT05IHUa. CKOpOCTU Fahrtenschreiber tacografo tachigrafo tachograaf rejestrator predkoici fardskrivare 50(811) 0 IEC 811-24-04 - 97 Geschwindigkeitsmesser tacometro tachimetro (della velocità di marcia) snelheidsmeter miernik predkoici ; predkoiciomierz hastighetsmatare tachymètre Appareil indiquant la vitesse linéaire d’un train. speedometer An instrument indicating the linear speed of a vehicle. cicopocreMep l-lpu6op,yKa3bIBa10111aii 811-24-05 compteur de tours Appareil servant JIHHeiiHyIO CKOpOCTb ABuTeHuR à mesurer la vitesse de rotation nOe3Aa. d’un organe Drehzahlmesser cuento-vueltas tachimetro (della velocità di rotazione) toerenteller obrotomierz ; miernik predkoici obrotowej varvraknare tournant. tachometer An instrument for measuring the speed of rotation of a rotating body. TaXOMeTp npeAHa3HaYeHHbIii npu60~, BpauramuerocR Tena. 811-24-06 Ann u3MepeHus YaCTOTbI BpaIueHus capteur (de vitesse) Organe MeBfühler influencé dispositif par de mesure, (speed) detecting la vitesse par exemple à mesurer qui transmet un signal à un un tachygraphe. element An element which responds to the speed to be measured signal to a measuring instrument, e.g. a tachograph. and which gives a captador (de velocidad) captatore (di velocità) (snelheids)opnemer czujnik (prcdkoici) hastighetsgivare AaT’lUK CWOPOCTU YCTpOtiCTBO, pearupyIOLIle.2 HenOCpeACTBeHHO Ha u3MepXeMyEO CKOpOCTb u nonamuee curHan Ha u3MepmenbHbIil npH6op,Hanpmrep,HaTaxorpa@. 811-24-07 radar de mesure Radar-Geschwindigkeitsmesser Equipement émetteur-récepteur pour la mesure de la vitesse, fonctionnant sur le principe de l’effet Doppler, par comparaison des fréquences et par réflexion radar de medida tachimetro radar des ondes sur le support de la voie. radar speedometer Radio transmitting/receiving equipment using the Doppler speed by comparing the frequencies of the signal emitted and that received by reflection from radarsnelheidsmeter miernik prqdkolci radarowy hastighetsradar effect to measure by the equipment the track supports. PaAilpHblii CKOpOCTeMep Panuonepena-r9uK-panAonpAeMHAK c ucnonb30BaHueM 3@eKTa nonnnepa ~niru3~epeHunc~0p0c~uny~e~cpaBHeHua~ac~o~nocbInae~orocur~~au curaana,nonysaeMoro npu 0TpaaeHuu 0~ ny-renblx onop. SECTION 811-25 - CIRCUIT~ ET ÉLÉMENTS SECTION811-25- DE CIRCUITS CIRCUITS AND CIRCUITELEMENTS PA3~EJI811-25-LI[El-IHH3JIEMEHTbIIJEl-I13 811-25-01 circuit haute tension Circuit parcouru contact. Hochspannungskreis par le courant, à la tension d’alimentation high voltage circuit A circuit carrying current at contact line voltage. uenb Bbxotcoro nanpaxenaa ueIIb,HeCyILIaR TOK C HaIIp5IwteHueM B KOHTaKTISOi? CeTu. de la ligne de circuito a1ta tension circuito ad alta tensione hoogspanningskring obw6d wysokiego napiccia hijgspanningskrets 811-25-02 98 - 50(811) 0 CE1 circuit basse tension Niederspannungskreis Circuit parcouru par un courant d’une tension sensiblement inférieure à la circuito baja tension tension de ligne et provenant d’une batterie d’accumulateurs, d’un groupe circuito a bassa tensione laagspanningskring convertisseur ou d’un transformateur. obwbd niskiego napiqcia lagspanningskrets low voltage circuit A circuit carrying current at a voltage significantly less than voltage of the contact line and supplied by a battery, a convertor or a transformer. Uenb H83Koro nanpaacemin UeIIb, HeCyIWUl TOK C HanpSDKeHUeM, 3HaSUTWIbHO MeHbIIIUM, YeM B KOHTBKTHOÜ ceni, KOTOPbIIiI co3naeTcrr aKKyMyJlXTOpHOti Garapeeii, npeO6pa30BaTeneM unu rpancc)opMa-ropoM. 811-25-03 circuit de puissance circuit de traction Circuit parcouru par le courant des machines et appareils, tels que les convertisseurs et les moteurs de traction, qui transmet la puissance de traction. power circuit Fahrstromkreis circuito de potencia ; circuito de traction circuit0 di trazione hoofdstroomkring ; tractiestroomkring obwbd trakcyjny huvudkrets ; traktionskrets traction circuit A circuit carrying the current of the machines and equipment, such as the convertors and traction motors, which transmit the traction output. cnnonan Tflronaa 9enb, uenb Uenb 06TeKaeMaR peanusauneii A -r.n. 811-25-04 r5rroaoil TOKOM MaUIUH U 060pyAOBaHUR, CBII3aHHaR C MOJ.UHOCTUnpeo6pa3osareneii, raronbtx nsrirareneti circuit de freinage Circuit parcouru par le courant de freinage électrique, machines participant à sa production. englobant toutes les braking circuit A circuit carrying the electric braking current, volved in its generation. including the machines Bremsstromkreis circuito de frenado circuito di frenatura remstroomkring obw3d hamowania elbromskrets in- TOPMOSHBR Uenb qenb, 06TeKaeMaR TOPM03HbIM TOKOM, B TOM YUCJIe TOKOM MaIJ.IUH, yYaCTByIoLLwX B ero BbIpa60TKe. 811-25-05 circuit des auxiliaires Circuit parcouru par le courant des appareils auxiliaires tels que les compresseurs et les ventilateurs. auxiliary circuit A circuit carrying the current of the auxiliaries such as the compressors fans. BcnoiuoraTenbaan Hilfsstromkreis circuito de 10s (aparatos) circuit0 ausiliario hulpstroomkring obwody pomocnicze hjiilpkraftkrets auxiliares and Uenb LJenb, 06TeKaeMa5I TOKOM ncnoMorarenbuor0 060pyAOBaHUR, TaKoro KaK KOMnpeCCOpbI U BeHTUJUiTOpbI. 811-25-06 circuit d’alimentation du train Circuit fournissant la puissance nécessaire aux installations de chauffage, de climatisation et autres services auxiliaires, sur chaque voiture d’un train. train power supply circuit train auxiliary circuit A circuit supplying substantial amounts of power to each vehicle of a train for air-conditioning, heating and other auxiliary services. Zugversorgungsstromkreis circuito de alimentation del tren condotta d’alimentazione del treno boordnetstroomkring obwody zasilania (nietrakcyjne) pociagu genomgaende hjalpkraftkrets 50(811) 0 IEC 811-25-06 qenb 3HeprocHa6wemfl 99 - noesna BCIIOMOI-aTeJlbHafl Uellb llOe3fla uenb, IIOKOTOpOfi ~OABWKHOI-0 OC)‘J.UeCTBJI~eTCrt COCTâBâ KOHAHUkïOHAPOBaHUR 811-25-07 nOe3Aa BO3AyXa, 3Hepï-OCHa6ZeHHe AJISI K%KAOi? C06CTBCHHbIX OTOnJIeHEIR HJ’xA, B U n&WïrOTOB~eHH~ eAWHElUb1 WCTHOCTII, nHU.W. circuit de chauffage Circuit parcouru des véhicules par le courant servant au chauffage du véhicule moteur ou remorqués. heating circuit A circuit carrying oronnrenbuaa &?nb, motor and trailer vehicles. qenb 06TeKaeMaSI UOABHEHOrO 811-25-08 the current for heating Heizstromkreis circuito de calefaccion circuito di riscaldamento verwarmingsstroomkring obwody ogrzewania tr%gvSrmekrets TOKOM AJIfl OTOnJIeHHR TIIrOBbIX A IIpPiUeIIHbIX eAHHUII COCTâBa. circuit d’éclairage Circuit parcouru par le courant servant à l’éclairage véhicules moteurs et des voitures remorquées. intérieur et extérieur des lighting circuit A circuit carrying the current for lighting and trailing vehicles. the inside and outside of powered Beleuchtungsstromkreis circuito de iluminacion circuito d’illuminazione verlichtingsstroomkring obwody oswietlenia belysningskrets OCBeTliTeJlbHaHUeflb UeIIb, 06TeKaeMaR rsrosbrx 811-25-09 TOKOM u npnuenabrx AJIR enamm OCBeLUeHMR BHyTpeHHeti UOABH~H~T~ El HapJ’%HOii YâCTU cocraaa. circuit de batterie Circuit, généralement à basse tension, d’un véhicule moteur, parcouru par le courant d’une batterie d’accumulateurs et de son dispositif de charge. battery circuit A circuit, charging usually low arrangements voltage, carrying on the vehicle. the current of a battery and any Batteriestromkreis circuito de bateria circuito di batteria accubatterijstroomkring obwody baterii (akumulatorow) batterikrets Uenb IIPTaHUflOT aKKyMyJlHTOpa uenb, 06bIYHO 6arapea 811-25-10 HIISKOrO Ii JapZ4AHblX HZtIIpSKeHAR, YCTPOfïCTB 06TeKaeMZ-I Ha eAl4HPfUe TOKOM BKKYMYJIRTOPHOti IIOABEDKHOTO COCTaBa. circuit de lancement Circuit particulier, établi en vue du lancement d’un moteur à combustion interne, par sa génératrice fonctionnant comme moteur ou par un moteur d’entraînement starting électrique circuit A specific circuit generator acting nycroeaa qenb Cneuuanbuas CTaPTePHbIM for starting as a motor up an interna1 or by a separate combustion engine by its starter motor. Ann sanycxa naurarena r3uyrperiuero cropasan pa6oTaIOLLwM B PeXGïMe ABHI-LlTeAR, HJIH OTAeJIbHblM Uenb reHepaTOpOM, 811-25-11 séparé. ABHI-LlTeAeM. circuit de mesure Circuit aboutissant enregistreurs instrument à des instruments installés principalement de mesure électriques dans la cabine ou à des appareils de conduite. circuit A circuit terminating principally AnlaDstromkreis circuito de lanzamiento circuito di lancio startstroomkring obwod rozruchowy startkrets for fi3rbrGningsmotor in electrical in the driver’s cab. measuring or recording apparatus tïtted MeBstromkreis circuito de medida circuito di misura meetstroomkring obwody pomiarowe instrumentkrets 811-25-11 u3iuepwTeabHan uenb ,&E4 50(811) 0 CE1 uenb nOAKJWY%eHHH YCTaHOBJIeHHbIX 811-25-12 lOO- A3MepATeJIbHbIX IlpePiMyIlleCTBeHHO B npa6opoB, PiJTH 3anACbIBaEOIIUiX Ka6EIHe ynpaBJleHMff. circuit de commande Circuit servant Steuerstromkreis A mettre en action des équipements de puissance ou des auxiliaires. control circuit A circuit used to actuate the power or auxiliary equipment. circuito de contra’ circuito di comando stuurstroomkring obwody sterownicze man6verstrGmkrets qenb ynpasrenua AcnonbsyeMan 4enb, 811-25-13 nnn npHBeAeHM2 B AeiiCTBHe CHJIOBOrO Ii 06Opy~OBaHan. BCnOMOraTeJIbHOrO circuit d’asservissement Verriegelungsstromkreis Circuit reliant des dispositifs mécaniques, électriques ou autres, par exemple au moyen de contacts auxiliaires, afin de faire dépendre le fonctionnement d’un dispositif de celui d’un ou de plusieurs autres. cfrcuito “rcuito vergrendelingsstroomkring obwody uzaleinieti (dziarania) ferreglingskrets interlock circuit A circuit linking mechanical, auxiliary contacts, intended dependent on the condition electrical or other devices, for example de enclavamiento di “occo through to make the operation of a piece of apparatus or position of one or more others. uenb ~JIOKI~~OBK~~ LIenb,coenaHa~orrrarrMexaHasecKÝie,3neKTparecKueHnllnpyraeycTpoicTea (HanpHMep, 9epe3 BCIIOMOraTeJIbHbIe KOHTaKTbI), npeAHa3HaYeHHm AJIS o6ecne~eHarr3aB~CMMOCTMpa6OTbIOAH~X~aCTeiryCTpOCiCTBaOTCOCTORHIIR unu 811-25-14 nonoxemm 0nH0ti circuit de signalisation HUM HecKonbKYixnpymx TacTek et de surveillance MeldeJUberwachungsstromkreis circuito de seiializacion y vigilancia circuito di segnalazione e controllo signaleringsstroomkring obwody sygnalizacyjne i kontrolne indikeringskrets Circuit transmettant un signal indiquant si certaines conditions de fonctionnement existent ou non, ou les enregistrant, par exemple un signal indiquant la défaillance de l’équipement électrique. indicating circuit monitoring circuit A circuit operating transmitting a signal indicating or recording whether a particular condition exists or not, for example a signal indicating a failure in the electrical equipment. uenb curuanbnblx LJenb, YCTPO~TB nepenamman Hanawïe HanpaMep, yKa3brBaIomr5e cmHanbI, Ha unu OTCYTCTBHC 0npeneneaHbIx un13 curHanbI, yKa3bIBamwie ycnoBafi fia Hamiwe de commande perYtcTpMpymmae sKcnnyaTaumi, noBpexneaufi B 3JIeKTpOO60pyAOBaHH~. 811-25-15 circuit de orotection Circuit particulier Schutzstromkreis ou partie du circuit spécialisé dans la protection. protective A specitïc circuit circuit, or a part of a control circuit, used for protection. circuito de protection circuito di protezione beveiligingsstroomkring obw6d zabezpieczeniowy skyddskrets uenb 3allWTbl JJenb 811-25-16 I~~II YacTb uemi ynpaBneHan, ucnonb3yeMas nnR 3awïTbI. circuit électroacoustique Circuit phones Lautsprecherstromkreis servant à la transmission et de haut-parleurs. audio-communication des sons, au moyen de micro- by microphones and loud- circuit A circuit for sound communication, speakers. notamment particularly circuito electroacustico circuito di diffusione sonora omroepstroomkring obwod nagloinieniowy kommunikationskrets - 50(811) 0 IEC 811-25-16 101 - uenb panaocsfl3u uenb AJIR o6ecnesemm paAHOCB~3l4,B'faCTHOCTU,CnOMOLUbIO MEïKpO@IOHOB M rpoMKoroBop5ïTenek 811-25-17 circuit de palpage Circuit du dispositif de palpage qui, sur les véhicules la nature du courant de la ligne de contact. supply detection uenb ~aa o6napyîtteana qenb discerne circuit On multi-system vehicles, the circuit electrical characteristics of the contact yCTpOfïCTBa HeCKOJIbKAX polycourants, apparatus which nOABHW(HOrO COCTaBa, senses the ..... pana ToKa Ha CMCTeM of the line. Systemerfassungsstromkreis circuito de deteccion de alimentaci6n ; circuito de palpado circuito per il rilievo (della natura) della tensione di linea (bovenleiding)spanningsdetectiestroomkring obw6d czujnika systemu zasilania eAHHHuaX IIATaHHR, ALWI OupeAeJIeHPW pOAa pa6oraromux TOKa OT B KOHTaKTHOü CeTPI. 811-25-18 Dateniibertragung multiplexage Ensemble commande des circuits permettant, au moyen d’un conducteur à distance et la transmission de nombreux signaux. unique, la multiplexing A system of remote control or indication in which many discrete and/or indication signals are transmitted over a common circuit. control (Multiplex) m”‘tifrlexado trasmissione multiplex multiplexsysteem obw68 wieiodostqpny ; obw6d multipleksowy multiplexsystem CiWTeMa C OiheflllHeHAeM JByKOBblX KaHaJlOB CHCTeMa AHCTaHuHOHHOrO HeCKOJIbKO nepeAaeTcs 811-25-19 ynpaBJleHWI cm-HanoB AACKpeTHbIX B 061uy10 circuit électrique HJIEl IIHAHKaLWi, ynpaBneHHs B M/wu4 uenb. du frein pneumatique Circuit servant à la commande du frein pneumatique, au moyen électropneumatiques et d’autres organes actionnés électriquement. electro-pneumatic A circuit de valves brake circuit for control electrically KoTopoti AHAAKaUIIII of the air brake by electro-pneumatic actuated valves and other Steuerstromkreis für pneumatische Bremse circuito eléctrico de freno neumatico circuito del freno elettropneumatico elektro-pneumatische remstroomkring obw6d sterowniczy hamulc6w elektropneumatycznych elpueumatisk hromskrets components. cxeMa 3JleKTpOnHeBMaTAYeCKOr0TOpMOSa Ann Lfenb ynpaBneHas 3,IeKTpOnHeBMaTAYeCKUX 811-25-20 B03AyUIHblM KJIanaHOB Pi ApyrHX TOpM030M 3JIeKTpWIeCKHX nOMOLUbI0 C WIeMeHTOB. Steuerkabel table de conducci6n fil de conduite fil de commande (déconseillé) Conducteur du circuit de commande de train du véhicule. reliant l’organe de conduite aux lignes przew2d sterowniczy styrkabel cab table control Control vehicle. table ~u’~~t~~‘or’a~‘a~e~in multiplo) kabinowy (deprecated) circuit cabling connecting the cab equipment to the train lines of the nposoAaynpae~eHm npoBoAa ueneir ynpaanesw, coenmnnomne annaparypy ynpasnemïrr ~Oe3AOMCnOe3AHbIM~Ma~~CTpaA~M~O6OpyAOBaH~~eA~H~UbI~OAB~~HOrO COCTaBa. 811-25-21 ligne de train Zugsteuerleitung Conducteur s’étendant sur toute la longueur de chaque véhicule d’un train et pourvu de coupleurs pour maintenir la continuité électrique entre tous les linea de tren fi’o treno véhicules. train line A conductor extending the whole length of each coach of a train with couplers to maintain electrical continuity throughout the train. treindraad przewod wzdluiny pociqgu genomgaende kabel 811-25-21 noe3quafl Ka6enb Marucrpaab C MexAyBarOHHbIMU xaxnoro aarona 3neKTpmecKym 811-25-22 50(811) 0 CE1 102- COeAUHeHUnMU,IIpOnOlKeHHbIti II0 coc-raaa noesna A o6ecneuasarotnar% uenb Memsy BaronaMu noesna. BCeii AnUHe nenpepbmnyro durchgehende ligne omnibus Ligne de train utilisée pour interconnecter de même polarité, tout le long du train. les appareils de prise de courant condotta di collegamento delle prese di corrente doorgaande voedingskabel lqcznik odbiornikow prqdu bus line A train line used for interconnecting collecter shoes of like polarity Leitung Iinea Omnibus through- genomg&ende matarkabeL out the train. cnnonafl noe3unan Doesnaaa TOKOnpUeMHUKOB 811-25-23 Marecrpaab Maruc-rpanb, ncnonbsyeMa5I OAHOti Ami CoeAUHeHua nOnSIpHOCTU,RMeK)LIwXCR MexAy B COCTaBe c060ü BCeX noe3Aa. Steuerleitung ligne de commande Ligne de train utilisée pour interconnecter commande. les manipulateurs ou les circuits de control train line A train line used for interconnecting noe3qnaa Marucrpanb Doesnaan 811-25-24 coupleur or control circuits. ynpasaeenfl Maracrpanb, UcnonbJyeMan h4amunncra KOHTpOnnepOB master controllers An5l neneii unu COeAUHeHUX co6oü MexAy ynpanneaun. elektrische électrique Appareil employé pour attelés l’un à I’autre. connecter les circuits électriques de deux véhicules acoplador used to connect snempareacoe YCTPOI~TBO, Mexqyearouuoe npUMeHffeMoe cqenneaablx 811-25-25 the electric of two coupled vehicles. coeuaueuae Ans COeAUHeHUR ~06012 eAUHUU MexAy circuits 3neKTpPWeCKUX tIOABU?KHOrO Ueneti AByX COCTaBa. Kupplungsleitung câblot d’accouplement Elément de coupleur électrique comprenant un câble convenablement amovible ou non, et qui assure la continuité attelés I’un à Vautre. jumper table (between An electric coupler électrique isolé, entre deux véhicules vehicles) in which vehicles are made through tïxed or removable. ua6enb Kupplung eléctrico accoppiatore (elettrico) elektrische koppeling sprzegnik elektryczny mipdzywagonowy anslutningsdon electric coupler A device linea de control filo treno di comando doorgaande stuurstroomdraad ; treindraad przewod sterowania ukrotnionego multipelkabel the electrical a suitable connections insulated external M‘SXAJ’BarOHHOpO COc?~liUeHklfï(MexAy between table, eAUHUUaMU cab’e de acoplamiento presa di accoppiamento koppelkabel (tussen voertuigen) kabel sprzegnika ; kabel Iqcznika anslutnbrgskabel coupled which may be IIOABU?KHOrO COCTaBa) 3neMeH-r Mexnysaronnoro COeAUHeHUe CuenneHHbIX rIpeACTaBn5IIOIIJUfi o6pa30M 811-25-26 co6oii U30nUpOBaHHbIti coenurieriuff, MemAy co6oü CxeMHbI% anu o6ecnesanaromnn eAuHUU nOABUxHOr0 HeC%eMHbIfi 3nercrpmreckoe COCTaBa U COOTBeTCTByEOIWiM Ka6enb. balai de retour de courant Dispositif porté par le véhicule et destiné à dériver le courant de retour en dehors de certains organes tournants, tels que les roulements, en le conduisant directement à l’essieu. earth-return brush A device on a vehicle to divert the return current away from rotating components such as roller bearings, and lead it directly to the axle. Erdungskontakt (Radsatzkontakt) escobilla de retorno de corriente dispositivo di titorno (di corrente) retourstroomborstel szczotka prqdu powrotnego aterledningsdon 50(811) 0 IEC 811-25-26 - 103- meTKa 383eMneHkm-ï pacnonoH(ennoe YCTPO~~CTBO, IlpCAHa3HkW2HHOC AJI5l spamaromnec5r YaCTn,TaKtie, HCIIOCpeACTBeHHO 811-25-27 coupleur contacts together KâK POJIUKOBbIe dont les connexions cocTaua MUHYR IIOAIIIUIIHUKU,U électriques dans les accouplements electric automatic electric nonanmnoro TOKa, A HeKOTOpbIC II~ABOA~ ero automatique électrique contacts incorporés les véhicules. An enmrnne 06paTHOrO Ha OCb. électrique Coupleur na OTBOAa sont assurées mécaniques par des automatiques entre coupler coupler in which incorporated automatically the electrical in mechanical on impact. connections couplings are made through connect vehicles which automatische elektrische Kupplung acoplador eléctrico automatico accoppiatore (elettrico) automatico koppeldoos (voor automatisch koppelen) sprzqgnik elektryczny samoczynny automatiskt elkoppel anTocuenKa % E.MeHT MClKA,'BWOHHOrO COeAnHeHne aBTOMaTn'IeCKn 811-25-28 équipement o6ecne%rsaromuti COeAUHCHUR, CIIOMOII(bH, KOHTaKTOB,UMW3I,IJUXCII COeAnHIIIOmUX eAUHUUblIIOABU~HOr0 COCTaBa rpi yAape. des auxiliaires Ensemble des organes montés sur un véhicule, l’air comprimé, la ventilation, la signalisation, auxiliary 3neKTpnueCKOe B MeXaHUYecKUXcUenKaX, pour l’éclairage, le chauffage, la manoeuvre des portes, etc. equipment A set of components tïtted to a vehicle for lighting, ventilation, signalling, operating of doors, etc. heating, Hilfseinrichtungen equipamiento de 10s (servicios) tsewizi) hulpapparatuur wyposaienie elektryczne hjalputrustning nietrakcyjne air-compressing, BCllOMOraTeJlbHOe060pyAOBaHkIe KOMIIJIeKT O60pyAOaaHUSI, KOHAnIInOHupOBaHUs Asepel yCTaHaBAUBaeMOr0 npenna3ria~emroro COCTâBB, BO3AyXa, Ha eAUHuIle BeHTnnsnun, IIOABIDKHOI-0 0Tonnenux oceemeeun, Ana curHanu3amq noesAa, OTKpbIBanUII n T.n. SECTION 811-26 - TRANSFORMATEURS DE PUISSANCE SECTION 811-26 - POWER TRANSFORMERS PA3AEJI 811-26 - CHJIOBbIE TPAHCcf>OPMATOPbI 811-26-01 (421-01-01) transformateur ET INDUCTANCES AND REACTORS kl ICATYIIIKH MHAYKTHBHOCTH Leistungs-Transformator de puissance Appareil statique a induction électromagnétique, à deux enroulements ou plus, destiné à transformer un système de tension(s) et courant(s) alternatifs en un autre système de tension(s) et courant(s) alternatifs, de valeurs généralement différentes et de même fréquence, en vue de transférer une puissance électrique. power transformer A static piece magnetic into of apparatus induction, another system the same frequency with two or more windings which, by electroof alternating voltage and current of voltage and current usually of different values and at for the purpose of transmitting electrical power. transforms a system CWlOBOfi TpaHC@OpMaTOp CTaTuuecKoe 06MOTOK 3neKTpoMarHuTHoe U 3,IeKTPOMaTHUTHOü n nepeMeHuor0 npenna3na~ennoe UHAYKUUU ToKa B Apyrym yc~pOMcTB0, AAn OAHOii nMeH3mee IIpeO6pa30BaHUa CUCTeMbI cncTeMy IIepeMeHHOrO nepeMeHnor0 ~epeMeHHOrOTOKa,O6bIYHOCApyrUMU3HaYeHU~MU,HO~pnTOü~eYaCTOTe c UenbIo nepeAaw3neKTpnuecKol MomHocTn. Ase nnn 6onee IlOCpCACTBOM HarIpRxenUU HanpxxeHun n auxiliares ausiliari transformadqr trasformator’ de p”tencia d’ frotenza hoofdtransformator transformator mocy krafttransformator 811-26-02 transformateur à noyau radial Transformateur dans lequel radialement est entouré, le noyau 104- central 50(811) 0 CE1 à tôles magnétiques par les enroulements cylindriques, de façon trique. Les culasses de retour sont disposées radialement autour central liées avec ce dernier a travers de très faibles entrefers. transformer with radially A transformer the windings, laminated Transformator transformador trasformatore transformator kern transformator transformator disposées concen- dunoyau tore mit radial geblechtem Kern de nhcleo radial a mante110 met radiaal gelamineerde o rdzeniu pakietowanym med radiellt laminerad karna in which the radially laminated central tore is surrounded by in the form of concentric cylinders, and the shell is in the form of a number of external yokes arranged radially round the tore of radial laminations having negligible air gap to the tore. and built up TpaHC+OpMaTOp C paAIfSlbH0 UIHXTOBBHHLIM CepAe’lHI4KOM TpaHC+OpMaTOp, 06MOTKaMU @O,,Me 811-26-03 (421-01-U) B KOTOpOM B BUAC paAUaAbH0 IIIUXTOBaHHbIii KOHUCHTpUYCCKUX MHOXWCTBa BHeIIIHUX CCpAWHUKa U COCTaBJIeHHbIX B03AYL”HbIM 3a30pOM RpM, UUJIUHApOB, CepAWHUK paCIIOAaE%OI.IJUXCR U3 paAUaJIbHbIX OKpJQKCH 6pOHX BbIIIOJIHeHa a paAHanbH0 IIJIaCTUH B BOKpyr C HC3HaYUTenbHbIM K CCpAWHUKy. autotransformateur Transformateur dont au moins deux enroulements ont une partie commune. auto-transformer A transformer in which at least two windings have a common part. Spartransformator autotransformador autotrasformatore spaartransformator autotransformator sparkopplad transformator aBTOTpaHC@OpMaTOp 811-26-04 TpaHC@OpMaTOp, ABe transformateur de réglage Transformateur sieurs sections, regulating UJIU 6onee 06MOTOK KOTOpOrO UMCH3T permettant, grâce à un enroulement spécial d’obtenir une tension réglable a volonté. 06myro YaCTb. divisé en plu- transformer A transformer with a special winding the voltage to be varied at Will. divided into several sections enabling Regeltransformator transformador de regulacion trasformatore di regolazione regeltransformator transformator regulacyjny reglerbar transformator peQVl&ipyiOLUli~TpaHC+OpMaTOp B TpaHC$OpMaTOp, cneuuanbHan 811-26-05 (421-01-12) KOTOPOM 06MOTKa transformateur Ana pasneneaa nonyseanrr 3aAaHHoro Ha HecKonbKo Hanprrxewïrr cTyneaeti. survolteur-dévolteur Transformateur dont l’un des enroulements est destiné à être inséré en série dans un circuit, afin d’en modifier la tension et dont l’autre enroulement est un enroulement d’excitation. booster transformer buck-boost transformer series transformer (USA) A transformer of which one winding a circuit in order winding. is intended to alter its voltage to be connected and the other winding Zusatz/Absatz-Transformator transformador adicionador-sustractor trasformatore serie opjaagtransformator transformator dodawczy tillsatstransformator in series with is an energizing JlllHeliHblÏi &WJ’Jl~pOBO’SHbIfiTpaHC@OpMaTOp TpaHC@OpMaTOp, OAHa U3 nanpr-nxeuna B Heu, a npyraa 811-26-06 transformateur 06MOTOK BKJIH)YeHUR nocnenoBaTenbHor0 B 06MOTKa KOTOpOrO uenb c RBnReTCR IIpCAHa3HWICHa uenbH3 O~MOTKOI? AJIS perynnpoaaamr B036yxAeHnR. à gradins Transformateur comportant, sur l’enroulement primaire ou secondaire, prises permettant d’obtenir une tension secondaire variable. des tapped transformer A transformer comprising a tapped a variable secondary voltage. primary or secondary winding to obtain Stufentransformator transformador de tomas trasformatore a prese transformator met aftakking transformator zaczepowy transformator med lindningskopplaruttag 50(811) 0 IEC 811-26-06 - 105 - TpaHC<l>OpMaTOp C OTBl?TBJlWl4RMR TpaHC@OpMaTOp, COAepHtaLLIHYi BTOpIIYHyIO 06MOTKy CeKIUIOHHpOBaHHyIO nony9eaarr AJIfl IIepBWIHyIO perynwpyeMor0 &UNI BTOpWIHOI'O rianp5nxemix. 811-26-07 (421-01-14) transformateur immergé Transformateur dans l’huile dont le circuit magnétique et les enroulements sont immergés dans l’huile. oil-immersed type transformer A transformer of which the magnetic circuit and windings are immersed in oil. Oltransformator transformador sumergido trasformatore in olio olietransformator transformator olejowy oljeisolerad transformator en aceite MaCJlflHbIêTpaHC+OpMaTOp TpaHC@OpMaTOp, MarHATHaR CkICTeMa M 06MOTKII KOTOpOrO IIOrpyxeHbI B MaCJIO. 811-26-08 (421-01-16) transformateur de type sec Transformateur immergés Trockentransformator dont le circuit magnétique dans un diélectrique et les enroulements ne sont pas liquide. dry-type transformer A transformer of which in an insulating the magnetic circuit and windings are not immersed de tiPo seco trasformatore a secco droge transformator transformator suchy torrisolerad transformator transformador liquid. CYXOÏITpaHC$OpMaTOp TpaHC@OpMaTOp,MarHUTHas B WIAKHI? 811-26-09 (421-03-06) enroulement -En Ii 06MOTKII KOTOpOrO He norpyweebl MaTepPIaL primaire Enroulement active. Note. CHCTeMa 3JIeKTpOEi30JISIIWIOHHbI~ qui, traction de contact, tension ». cet PrimGwicklung en service, reçoit du réseau électrique,lorsque enroulement cette d’alimentation puissance est également la puissance est fournie appelé haute- Primario awolgimento primario primaire wikkeling uzwojenie parlaligne «enroulement arrollamiento piemotne prlm~rlindnlng primary winding A winding Note. - which, in service, receives In electric traction, it may be referred active power when this power to as “high voltage from the supply is supplied network. from the contact line winding”. nCpBW,Hafl 06MOTKa (TpaHC@OpMaTOpa) 06MOTKa, KOTOpas MOIIIHOCTb B yCJIOBWIX OT IICTOYHIIKa IIHTOHIIR. xoxnyaraunn B WIeKTpWIeCKOti @hSWeYWf!?. - KOHTaKTHOii JIIIHIIH, OHa TFIR,KOrAa MOxeT nony=raer 3Ta Ha3bIBaTbCII MOIIIHOCTb aKTABHyI0 IIOAaeTCH I'O6MOTKa OT BLICOKOTO nanp5rxeumY. 811-26-10 (421-03-07) enroulement secondaire Enroulement tion. secondary SekundGwicklung qui, en service, fournit la puissance active au circuit d’utilisa- winding A winding which, in service, delivers active power to the load circuit. arrollamiento secundarlo awolgimento secondario secundaire wikkeling uzwojenie wtbrne sekundarlindning BTOpWHZWl06MOTKa (TpaHC@OpMaTOpa) 06MOTKa,KOTOpax B uenb 811-26-11 ByCJIOBARX3KCIIJIyaTaIII4~ IIOAaeTaKTRBHyIC MOwHOCTb uarpy3Ku. enroulement de chauffage Enroulement ou partie circuit de chauffage. d’enroulement d’un transformateur qui alimente le (train) heating winding A winding circuit. or part of a transformer winding which supplies the train heating Heizwicklung arrollamiento de calefaccibn awolgimento per il riscaldamento treno) (trein)venvarmingswikkeling uzwojenie grzewcze (pociqgu) tagvarmelindning (del 811-26-11 AJIPi YaCTb 06MOTKI& enroulement auxiliaire (d’un Enroulement ou partie circuit des auxiliaires. IIkïTaIOIUaH A winding circuits. OTOIIHTenbH,‘W transformateur d’enroulement auxiliary winding (of an electric de traction d’un traction or part of a transformer UeIIb IIOe3Aa. électrique) transformateur qui alimente le winding which supplies tractietransformator) uxv+ojenfe pomocnfcae the auxiliary hjalpkraftlindning 06MOTKa unu UCIIA TRrOBOTO 06MOTKPï YaCTb BCIIOMOraTeJIbHbIC TpaHC@OpMaTOpa) nurammaa TpaHCijJOpMaTOpa, JIOKOMOTHBa. enroulement de réglage Enroulement Regelwicklung spécial d’un transformateur, mise en ou hors transformateur. service permet divisé en plusieurs sections, dont la le réglage de la tension aux bornes du A special winding of a transformer, divided into several sections be switched in or out to vary the transformer terminal voltage. perynupoBorHan CllCUPianbHaS4 811-26-14 T,laHC@OpMaTOpa, PLJIH na 3axkiMaX which may pa3AeJIeHHa53 BbIKJIEOYCHlle KOTOPbIX Ha HWKOJIbKO II03BOJ‘SIeT H3MCHPiTb rpanc@opMaropa. prise de réglage Anzapfung Borne du transformateur ment de réglage. reliée à l’extrémité d’une des sections de l’enroule- toma de regu’acion presa di regolazione tapping A transformer regulating de regu’acion di regolazione regelwikkeling uzwojenie regulacyjne o6MoTKa 06MOTKa BKJIIO4eHUe nanpr4Xemïe arro”amiento awolgimento reglerlindning regulating winding CeKUki, Hilfswicklung arrollamiento auxiliar (de un transformador de traction eléctrica) awolgimento ausiliario boordnetwikkeling (van een elektrische transformer) BC,,OMOrZ,T‘2JlbHafl 06MOTKa (3,IeKTpWIeCKOrO 811-26-13 50(811) 0 CE1 06MOTKa, IIATaIomafl OTOuuTeJtbHymIltWb llOe3ES 06MOTKa 811-26-12 106- terminal connected to the end of one of the sections of the aftakking zaczep regulacyjny regleruttag winding. SBXCIEAM BbIBOAa 3axKMM TpaHC@OpMaTOpa, peryJIkipOBO’IHOti 811-26-15 (421-03-13) COeUkIHCHHbIii C BbIBOAOM OAHOii H3 CeKUHii 06MOTKII. enroulements concentriques Disposition forme dans laquelle de cylindres les enroulements ou parties d’enroulements ont la concentriques. uzwojenie wspoEosiowe concentric windings An arrangement concentrically. Zylinderwicklungen arrollamientos concéntricos awolgimenti concentrici concentrische wikkelineen where the windings or parts of windings are arranged koncentriska lindningar KOHueHTpUYeCKue06MOTtUI 06MOTKII 811-26-16 (421-03-14) PiJIEï YaCTM 06MOTOK, PaCIIOJIaraeMbIe KOHUeHTPAYeCKU. enroulements alternés Scheihenwicklungen Disposition dans laquelle les enroulements ou parties succèdent dans le sens axial sur le même noyau. Note. - Normalement, les enroulements d’enroulements se schijvenwikkeling uzwojenie warstwowe lagerlindning sont subdivisés. sandwich windings An arrangement where the windings along the same tore. Note. - Normally the windings or parts of windings would be subdivided. arro”amientos a’ternados awolgimenti alternati are arranged axially - 50(811) 0 IEC 811-26-16 (421-03-14) uepenytomeecfl 06MOTKII 107- 06MOTKN BnH 9aCTH OGMOTOK, ~CpCAJ’IOLLWW~ OCeBOM B HaIIpaBneHmi CTepHcH% ~pYiMeY&%'e.- 811-26-17 circulation 06bIYHO AOnTHbI 6bITb pa3AeneHbI. d’huile naturelle Circulation d’huile, dans la cuve d’un transformateur formateur-réfrigérant, tion d’une pompe. natural 06MOTKH qui se fait uniquement ou d’un système trans- par convection, sans l’interven- circulation The circulation of convection without oil in a transformer the use of a pump. tank or cooling system solely natiirliche circulacion circolazione natuurlijke obieg oleju sjulvkylning OlstrLimung (de aceite) natural naturale (dell’olio) (olie)circulatie naturalny by WTeCTBCHHaBUtlpKyJlflUtlR ~PïpK)‘JDILWl 811-26-18 circulation 6axe B MWLJIa MCKnK>WWiTenbHO TpaHC@OpMaTOpa IIOAAeiiCTBPïeM KOHBeKUPiII lUIll 6e3 CHCTeMe OXnaxAeHaa IIpHMeHeHI454 HaCOCa. d’huile forcée Circulation d’huile, formateur-réfrigérant, dans la cuve d’un transformateur ou d’un système transqui se fait au moyen d’une pompe. forced circulation The circulation of oil in a transformer tank or cooling system by means of a erzwungene Olstromung circulacion (de aceite) forzada circolazione forzata (dell’olio) geforceerde (olie)circulatie obieg oleju wymuszony forcerad kylning ww IlpUHj’AlcTeJlbHaSlIVlpiQ’JlflUliH MaCna ~kipKyJIXUFïX IIOMOWbH) 811-26-19 (151-01-33) B 6axe TpaHC@OpMaTOpa IlnA CIICTeMe OXnaxAeHPis C Hacoca. Drossel bobina de inductancia induttore smoorspoel dlawik reaktor ; induktor bobine d’inductance Dispositif caractérisé essentiellement par son inductance propre. reactor inductor choke A device used because (3neurpuuecuuu) peaurop npennasna~eunoe YCTPO~TBO, 3neKTpwiecKoii 811-26-20 inductance Inductance of its inductance. Ann mnonb3oBams ero MHAYKTHBHOCTH B uem. de passage Uberschaltdrossel dont le point milieu est relié en permanence et dont les extrémités sont reliées successivement inductancia au circuit d’utilisation à diverses du transformateur. transition de Paso induttore di transizione koppelsmoorspoel dlawik wyrtwnawczy reglerbar reaktor prises de réglage reactor A reactor the central point of which is permanently connected to the load circuit and whose terminals are successively connected to various tapping points on the transformer. nepexouuoii 06muii pa6oqeI uem pa3nH'iHbIMII 811-26-21 (151-01-34) peaarop PeaKTOp, BeTBeii 3XKHM II 3amïMbI 3axKIIMaMH inductance de lissage Inductance destinée KOTOpOrO KoToporo OTBeTBneHdi IIOACOeAllHeH nocneAosaTenbH0 IIOCTOIIHHO K coeAmeHbI c HaTpaHC@OpMaTOpe. Gltittungsdrossel à réduire la composante alternative d’un courant pulsa- toire. smoothing A reactor reactor used to reduce the alternating component of a pulsating current. inductancia de alisado induttore di livellamento spianamento afviaksmoorspoel dlawik wygladzajacy glattnlngsreaktnr ; induttore di 811-26-21 (M-01-34) crnamusatomeu PeaKTop, peaarop UcnonbsyeMbIii nynbcupymuero 811-26-22 inductance 50(811) 0 CE1 108- Ann cHuaeHue nepeMeHHoii cocTaBnamneti ToKa. Erdstrom-Schutzdrossel inductancia de puesta a tierra de mise à la terre Inductance insérée dans le circuit de terre avant son raccordement à la masse du véhicule, obligeant le courant à passer par les balais de retour de courant et destinée à empêcher une mise sous tension interruption du circuit de retour. earthing du véhicule, induttore di messa a terra aardingssmoorspoel dlawik uziemiajqcy jordningsreaktor dans le cas d’une reactor A reactor inserted in the equipment earth circuit before its connection to the mass of the vehicle, encouraging return current to flow through the earthbrushes but preventing interruption PeaKTOp,BKJIIO~eHHbIi? vTO6bI cocTaBa 811-26-23 IIOABuX(HOr0 ToKa B 9epes cnyvae COCTaBa, meTKu alive in the noA o6ecnewBaIoIIwü 3a3eMnemix, npepbIBaum oKa3anaeb inductance made event of an BUeIIb3a3eMneHuSI060pyAOBaHuRAOCOeAuHeHu~eë eAuHuUb1 o6paTHoro being circuit. peaurop 3aseMnflmuel C MaCCOfi the vehicle in the earth-brush uenu HO IIpOXO?KAeHUe IIpeIIRTCTBylOIUuii 3a3ehmeHm eAuHuua TOMy, noABuaHor0 HanpmeHueM. Bremsdrossel inductancia de frenado induttore di frenatura remsmoorspoel drawik obwodu hamowania reaktor i bromskrets de freinage Inductance insérée dans le circuit de freinage. braking reactor A reactor in the electric braking circuit. TOPMOJHOÏiPeaXTOp PeaKTop 811-26-24 uenw 3neKTpmfecKoro B TopMo3a. induktiver shunt inductif Bobine à noyau de fer insérée dans le circuit de dérivation, en général des enroulements de pôles principaux des moteurs de traction. celui shunt inductive derivatore induttivo inductieve shunt bocznik indukcyjny f5ltfGrsvagningsspole inductive shunt An iron-cored poles coi1 in a shunt circuit, of traction motors usually that associated Nehenwiderstand ; shuntreaktor with the main during tïeld weakening. BHAYKTRBHbIi-i UIYHT ~aTy~KaCOCTanbHbIMCepAeYHuKOM,BKnH3YaeMaRB~~~bocna6~eHuR~OnR, 06bNHO 811-26-25 (431-01-01) CBR3aHHaR C rnaBHbIMu ocna6neaua nom. transducteur (magnétique) IIOnEOCaMu TRrOBbIX ABuraTeneti B IIepuOA vormagnetisierte RegeldrosseVTransduktor transductor (magnético) Dispositif constitué par un ou plusieurs noyaux ferromagnétiques munis d’enroulements, à l’aide duquel on peut faire varier une tension ou un courant alternatif ou continu, par l’intermédiaire d’une tension ou d’un courant indépendant, en utilisant les phénomènes de saturation du circuit magnétique. trasduttore transductor transduktor transduktor transductor A device means consisting of which of one or more an alternating an independent voltage magnetic circuit. ferromagnetic or direct or current, current utilizing cores with windings, or voltage saturation cari be varied phenomena by by in the MarHUTHblïi J’CUJWTeJIb YCTPO~~CTBO, COCTOIILLlee CepAeYHuKOB C aenusuay He3aBuCuMOM MarHuTHOil nepeMeHHor0 HaIIpSKeHuu UenU. A3 OAHOrO 06MOTKaMu, C unu unu IIOMOIUbIO nocTomHor0 UnU TOKe, HeCKOnbKuX @eppOMarHuTHbIX KOTOpOrO MOW(H0 ToKa Hanpmems ucnonb3yx unki SBneHue u3MeHRTb HacbIweHuR npa B 50(811) 0 IEC 811-26-26 inductance 109- saturable Inductance à partir d’une saturable Sattigungsdrossel dont le circuit magnétique valeur déterminée est saturé, en fonctionnement du courant normal, qui la traverse. reactor A reactor whose when the current uacbtmaromati maanetic circuit in normal exceeds a certain value. oneration becomes saturated inductancia saturable induttore saturabile verzadiabare smoorsaoel dxawik uasycalny a mattningsbar reaktor peaurop PeaKTop, MarHUTHaB UCIIb KOTOpOrO IIPU HOpMaJlbHOfi JKCIIJIyaTaUUU HacbImaeTcK B Tex cnyUaax, KorBa TOK npeBbImaeT onpeneneaaoe 3HaUeUue. 811-26-27 inductance dans l’air Inductance air-cored in which se ferme Luftdrossel inductancia en el aire induttore in aria luchtsmoorspoel dhwik bezrdzeniowy reaktor med omagnetisk dans l’air. the magnetic circuit is completed in air. karna ; luftspole 6es craJm PeaKTOp, 811-26-28 le circuit magnétique reactor A reactor peaurop dans laquelle B KOTOpOM MarHUTHaR uenb 3aMbIKaeTCII n0 B03AyXy. circuit magnétique (d’un transformateur) Ensemble constitué par des culasses et des noyaux ou des pôles, souvent tôles feuilletées, parcourus par le flux magnétique d’un transformateur. magnetic en circuit (of a transformer) An assembly comprising yokes, cores and poles, often laminated, magnetic flux of a transformer. carrying the Magnetkreis circuito magnético (de un transformador) circuito magnetico (d’un trasformatore) magnetisch circuit (van een transformator) obwod magnetyczny magnetisk krets MBI-HI(THBflCIICTeMB(TpaHCt$OpMaTOpa) COBOKYIIHOCTb, BKnIoUaIomak spMa, CepAeYHUKU u COCTaBJIeHHbIe 113 IIJIaCTUH, II0 KOTOpbIM 3aMbIKaeTCII TpaHC@OpMaTOpa. 811-26-29 (151-01-25) nonIoca, 3aUacTym MaTHUTHbIfi IIOTOK noyau (magnétique) Schenkel (magnetisch) Pièce magnétique autour de laquelle ments d’un dispositif. (magnetic) sont généralement disposés des enroule- tore The magnetic part of a device around which windings are generally placed. nocleo magnético nucleo (magnetico) (magnetische) kern rdzen magnetyczny (magnet)kZrna (MBI-HNTHbIti)CepAe’IHEïK h’farHUTHafl YaCTb yCTpOI%CTBa, BOKpyr KOTOpOU 06bIYHO yKJIaAbIBamTCSI 06MOTKU. 811-26-30 (151-01-28) culasse (d’un transformateur, électro-aimant, relais ou autre dispositif) Pièce ferromagnétique fixe ne portant généralement pas d’enroulement essentiellement destinée à fermer le circuit magnétique principal. yoke (of a transformer, electro-magnet, et relay or other device) A fixed ferromagnetic part, usually not surrounded by a winding, principal purpose is to complete the main magnetic circuit. whose BPMO Joch culata (de un transformador, giogo (d’un trasformatore, cuve Récipient formateur elektro-magneet, jarzmo ok Kessel dans lequel le circuit magnétique et les enroulements ou d’une inductance sont contenus. d’un trans- tank The vesse1 in which are contained. the tore, yoke and windings of a transformer or reactor elettromagnete, relè o altro dispositivo) juk (van een transformator, AeTanb 113 @eppoMarHUTnoro MaTepuana, 06bIYUO He 0KpyxeHHan 06MOTKaMU, OCHOBHbIM Ha3HaYCHUCM KOTOPOÜ RBJIReTCII &MbIKaHkiC OCHOBHOU MarHUTHOii CUCTeMbI. 811-26-31 electroiman, relé u otro dispositivo) cuba cassa ; cassone bak kadi karl relais of ander toestel) 811-26-31 50(811) 0 CE1 llO- 6au ~OCyA,BKOTOpOMHaXOAIITCRCepAe~HUK,apMOUO6MOTKUTpaHc~opMaToPa unu 811-26-32 peaxropa. Olausdrehungsgef%B conservador de aceite ; deposito de expansion conservateur d’huile réservoir d’expansion Récipient relié à la cuve d’un transformateur dans l’huile, afin de permettre la libre dilatation de l’huile de la cuve et de réduire au minimum les effets nuisibles du contact de l’huile conservatore oil conservator expansion tank A vesse1 connected to the tank of an oil-filled transformer d’o1io expansievat ; conservator zbiornik konserwacyjny oleju expansionskiirl avec l’air extérieur. SO as to permit free expansion and contraction of the oil to minimize the deleterious contact between the oil in the main tank and the air. effect of pacmapuTenb KOHCepBaTOpMaCJla 6axy MaCnOHa~OnHeHHOrOTpaHC@OpMaTOpaAn~ pacmupesua u GKaTuR MacnaCuenbmAOBeAeHU% COCyA,IIpUCOeAUHeHHbItiK o6ecneseum-r CBO6OAHOrO A0 MRHUMyMaBpeAHOrOB03AeI%CTBUR 6axac IIpUKOHTaKTeMaCJIarnaBHOrO B03AyXOM. 811-26-33 aérateur Entliifter Appareil reliant à l’air ambiant la couche d’air se trouvant dans la partie supérieure de la cuve d’un transformateur à fluide liquide de refroidissement, couche d’air dont le volume varie avec la température du fluide. aireador breather A component transformer temperature linking aereatore ontluchter kominek ; oddychacz tryckutjamnare the air space at the top of the tank of a liquid-cooled with the outside air, the volume of the liquid. of the air space varying with the BO3AyXOO6MeHHOeJ’CTpOüCTBO YCTPOGICTBO, o6ecnesuBaIoIuee IIpOCTpaHCTBOM BepXHeti Oxna~AeIIueM U IIpOCTpaHCTBa 811-26-34 coo6meHue 6axa 9acTU HapyaHblM U3MeHaeTCR B03AyIIIHbIM MexAy TpaHC@OpMaTOpa B03AyXOM, IIOCKOJIbKy C U3MeHeHUeM TeMIIepaTypbI C XGIAKOCTHbIM o6aeM BO3AYUHOrO X(UAKocTu. dessiccateur Aérateur rempli contenue dans d’une l'air qui matière pénètre hygroscopique, dans afin d’absorber Luftenfeuchter desecador essiccatore l’humidité le transformateur. luchtdrogen odwiliacz avfuktare drier A breather containing a hygroscopic entering the transformer. material to absorb the moisture in the air BO3AyXOOCJ’lIUSTeJIb YCTPOI~CTBO, anaru 811-26-35 coAepxamee rurpocKonusecKuii 113 BO3AyXa,nocTynaIomero MaTepuan AnR IIorJIoUIeHufl B TpaHC@OpMaTop. Kiihler réfrigérant Appareil partie dans lequel circule et se refroidit le fluide dans lequel baigne la active. radiator radiator kylare ; radiator radiator A component :$f:tTrne through which the transformer oil or cooling liquid circulates and is cooled. paAl#aTOp TpaHC+OpMaTOpa YCT~OI~TBO, TpaHC@OpMaTOpHOe 9epes MaCnO KOTOpOe UnU UupKynupyeT OXJIaH(AaKJOUIuR KUAKocTb. u oxnaaAaeTc52 - 50(811) 0 IEC lll- SECTION 811-27 - RÉSISTANCES ET CONDENSATEURS SECTION 811-27 - RESISTORS AND CAPACITORS PASAEJI 811-27 - PE3kICTOPbI 811-27-01 résistance 13 KOHAEHCATOPbI de démarrage Résistance insérée au démarrage des véhicules, de façon transitoire, en série avec les moteurs de traction à courant continu ou ondulé, en vue de faire varier leur tension d’alimentation et de limiter l’intensité du courant pendant la période de démarrage. starting resistor A resistor traction temporarily motors connected to vary in series with the voltage applied d.c. or undulating and limit Anfahrwiderstand resistencia de arranque resistore di awiamento ; reostato di awiamento aanzetweerstand rezystor rozruchowy startmostr%td current the current during starting. nycuosoii pe3ucrop P'23UCTOp, BKJIKFiaeMbIti nynbcupymmero orpamsewin 811-27-02 ToKa résistance B ToKa Am Uenb TIIrOBbIX u3MeHeHm BO speMn ABUraTeneii IIOCTORHHOTO nuTamuer0 Hanpmemm UnU u nm 3anycKa. de freinage Résistance insérée, lors du freinage électrique, dans le circuit des moteurs traction pour absorber l’énergie qu’ils produisent. de braking resistor A resistor braking connected to absorb in the circuit the energy of the traction which motors during electric ABuraTeneM Bo BpeMH Bremswiderstand resistencia de frenado resistore di frenatura ; reostato di frenatura remweerstand rezystor hamowania bromsmotstànd they produce. TOPM03HOi-4pe3WTOp Pe3uCTOp, BKnKFIaeMbIti 3neKTpU'ieCKOrO B TOpMOweHIGI qenb TIIrOBbIX AJIR IIOrnOlIleHuSI BbIpa6aTbIBaeMOti UMU 3Hepruu. 811-27-03 résistance résistance de passage de transition Résistance insérée formateur, au moment transition temporairement temporarily of progressing nepexouHoi! d’un trans- des deux prises à l’autre. from between two tappings of a transformer at the one tap to another. pe3ncTop PesucTop, no~KnKFIaeMbIti BpeMeHHO rpauc@opMaropa nepexonabrB B UepeXOAUTCOAHOrO 811-27-04 d’une resistor A resistor connected moment entre deux prises de réglage du passage 3a)KuMaBbIBOAa BbIBOAaMU ABYMII MexAY MoMeHT,Koma nepeKnm9aTenb cTyneHel Ha ApyrOk résistance de shuntage shunt résistif Résistance insérée dans le circuit enroulements des pôles principaux sement du champ. de dérivation, par des moteurs de traction, exemple celui des lors de l’affaiblis- shunt resistor A resistor connected in a shunt circuit, e.g. across the main pole windings traction motors, during field-weakening. IItyHTupymmuii pe3ncTop PeJUCTOp, rnaBHbIx flberschaltwiderstand resistencia de paso resistore di transizione overgangsweerstand rezystor przerqczeniowy tiverkopplingsmostand BKnKYfaeMbIti nomocoB B IIIyHTUpyIOIIlyH) TmoBbIxneuraTenel uenb, B nepuon HaIIpUMep, ocna6neaus K 06MOTKaM non5h of Nebenschlugwiderstand resistencia de shuntado derivatore (resistivo) veldverzwakkingsweerstand rezystor bocznikujqcy shuntningsmotstand 811-27-05 résistance charging Ladewiderstand insérée dans le circuit de charge d’une batterie d’un condensateur, pour en régler the charging in the charging k3HCTOp, BK,IWIaCMbIü KOHnCHCaTOpa résistance de charge. d’amortir insérée B qe”b 3ap55nKA nJIR yII,,aB,IeHIDl dans les pointes damping circuit of a battery or capacitor to control 6aTapeu aKK)‘MYJIRTOPHOi? 3apSInHbIM de carga resistore di carica (batteria) laadweerstand rezystor ohciaieniowy laddningsmotstand EUIn un circuit, de courant de quelque qui peuvent nature qu’il soit, en vue s’y produire. resistor A resistor connected in any kind of circuit in order to reduce the current peaks cari be generated racnmal resistencia TOKOM. d’amortissement Résistance Diimpfungswiderstand resistencia de amortiguamiento resistore limitatore dempingsweerstand rezysto; przeciwzakGceniowy dihnpmotstand there. pe3ucTop &3kiCTOp, 811-27-07 ou current. CMKOCTII TOKOB, le courant d’accumulateurs resistor A resistor connected which 50(811) 0 CE1 de charge Résistance 811-27-06 112 - BKJIKPIaCMbII? KOTOPbIC résistance MOI-YT B nm6ym TâM Uenb JVISI ,‘MeHbIIICHMR Erregerwiderstand d’excitation Résistance insérée dans le circuit d’excitation moteur, pour en régler ou limiter le courant. excitation MaKCAMUIbHbIX B03HIIKHYTb. d’une génératrice ou d’un resistor A resistor connected or limit the current. in the excitation circuit of a generator resistencia de excitation resistore d’eccitazione veldserieweerstand rezystor wzbudzenia reglermotstand fiSr magnetiseringskrets or motor to control pe3ucTop no36ymueuun PC3klCTO,,, BKJIWIaCMbIti flna perynupoaaana 811-27-08 résistance résistance B I,UIb BO36y~ACHH~ mm orpanwsenna rCHCpaTOpa IUIII ABHI-aTi%IR Toka. Stabilisierungswiderstand/Puffenviderstand resistencia de estabilizacion de stabilisation tampon Résistance insérée dans un circuit, pour égaliser les charges entre les branches en parallèle, par exemple pour atténuer les effets indésirables des variations de tension de ligne stabilizing resistor en freinage par récupération. resistore stabi’izzatore vereffeningsweerstand rezystor stabiliacyjny stabiliseringsmotstand A resistor inserted in a circuit to equalize the currents between parallel branches, for example to reduce the undesirable effects of variation in line voltage in regenerative cTa6unu3upyromaii PesncTop, pe3ucTop BKJIlOWlCMbIfi EIapNIJEnbHbIMH BJIlWIHHii braking. B OTBOnaMII, I13MCHCHIIR IWIIb JIIJHCfiHOrO BbIpaBHlfBaHHSl ,WIS HaIIpEIMCp, ,WI% ,‘MCHbIIICH!W HaIIpH~KeHH~ B &YSKHMC TOKOB MWKKn)’ HGKWIaTCJIbHbIX pCKyllCpaTPiBHOr0 TOPMO~CHMR. 811-27-09 résistance Regelwiderstand de réglage Résistance insérée dans un circuit, de quelque le courant ou la tension. regulating resistor A resistor connected peryaupyromnfi %3liCTOp, in any kind of circuit to control the current or voltage. pe3ucTop BKJIWIWMbIti HanpaXeHHa. nature qu’il soit, pour en régler B n1o6ym IWIb JUIfl PerJ’JIkïpOBaHIJR TOKB lUIPi resistencia de regulacion resistore di regolazione regelweerstand rezystor regulacyjny reglermotstand 50(811) 0 IEC 811-27-10 - 113- potentiomètre diviseur de tension Résistance avec une ou plusieurs prises intermédiaires des fractions de la tension permettant de recueillir qui lui est appliquée. potentiometer voltage divider A resistor with one or more intermediate voltage across the resistor to be obtained. tappings allowing fractions DrehwiderstandEpannungsteiler potenciometro ; divisor de tension potenziometro ; divisore di tensione potentiometer ; spanningsdeler potencjometr potentiometer ; spanningsdelare of the ~OTeHU~OMeTp Aeanrenb uanpnucennn PeSyiCTOp C OAHIIM o6ecnemBaIomm% 811-27-11 AJIA HeCKOJIbKAMA B03MOLHOCTb npOMeXyTOYHbIMH AeJIeHWJ HanpRXeHWl BbIBOAaMki, MeXgy BbIBOAaML élément de résistance Conducteur résistant, entrant dans la composition d’une boîte ou d’un cadre de résistance, se présentant habituellement sous forme de grilles, de plaques, de bandes, de rubans ou de fils et pouvant comporter des prises intermédiaires. Widerstandselement elemento de resistencia elemento di resistore weerstandselement element rezystorowy motstandselement resistor element A resistive conductor forming part of a resistor case or frame, usually in the form of grids, plates, strips, ribbons or wires and which may have intermediate tappings. Pe3BCTHBHbli-4 3JWMeHT ~pOBOAHAK UIKa@a IIJIaCTIIHbI, 811-27-12 BbICOKOTO pe3PiCTOpOB, COnpOTMBJIeH&W, KOTOpbIe nOJIOCb1, JIeHTbI RBJIffIoIl(HZiCFI o6bmm HJIH npOBOna YaCTblO BbInO~HREOTCR II HMeKIT B 5lQHKa @OpMe IIpOMeXyTO4HbIe HJlM CeTKH, BbIBOnbI. WiderstandskastenIWiderstandsrahmen caja de resistencia telaio di resistori ; cassetta di resistori weerstandsrek zespol rezystorowy motstandsenhet boîte de résistance cadre de résistance caisse de résistance Ensemble d’éléments de résistance montés sur un support commun. resistor case resistor frame A set of resistor elements assembled into a single structure. umnu pesncropoe mua+ pesncropos Ha6op 811-27-13 pe3HCTHBHbIX WIeMeHTOB, CO6paHHbIX B OAHy KOHCTpyKLWO. bloc de résistance Ensemble constitué d’un certain nombre de boîtes ou de cadres de résistances. resistor block An assembly 6now Ha6op 811-27-14 of a number of resistor cases or frames. pesucropoe pana IIIIWKOB AJIA IIIKa$OB pe3EiCTOpOB. section de résistance Widerstandsabschnitt Partie d’un circuit résistant comprise dées à des appareils entre deux bornes tels que contacteurs consécutives, raccor- ou combinateurs. resistor section Part of a resistive circuit contained between two consecutive connected to apparatus such as contactors or controllers. ceuunn YaCTb Widerstandsgerat bloque de resistencia reostato weerstandsblok blok rezystorowy motstr%ndsgrupp terminals pesncropa UenA noncoenuHxeMan KOHTpOJlnepaM. pe3mTopa K Mexay annaparaM, AByMII nocnenymrrrYrMt4 HanpaMep, 3axKAMaMH, KOHTaKTOpaM nnn section de resistencia sezione di reostato weerstandsectie sekcja rezystorow motstandsektion ; inkopplingssteg 811-27-15 114- 50(811) 0 CE1 double isolement Isolement Doppelisolierung à deux étages, le premier et une masse intermédiaire, entre les pièces métalliques et le second sous tension entre la masse intermédiaire et la masse du véhicule. double insulation Two-stage insulation, the lïrst being between the live conductors intermediate frame and the second between the intermediate frame body of the vehicle. doble aF’amiento dopp1o lsolamento dubbele isolatie izolacja podwojna dubbelisolering and an and the ABOüHaSIM3OJI~UiM ~ByXCTyneH9aTaff II3OnII~kiR, IIepBas IIpOBOAaMH,HaXOAR~HMACrr a - BTOpaR IIOABAxHOTO 811-27-16 IIOA MexAy CTyIleHb KOTOpOti HaIlpZWKeHUeM,H IIpOMexyTOYHOii tIpOX0AU-r MeXAy IIpOMexyTOSHOIi paMOï4 II PaMOü, KySOBOM CAAHIIUbI COCTaBâ. résistance nichtlinearer non linéaire Résistance dont la tension aux bornes n’est pas proportionnelle au courant qui la traverse. non-linear resistor A resistor in which the voltage current passing through across the terminals is not proportional to the resistencia Widerstand no linea’ resistore non lineare niet-lineaire weerstand warystor icke-linjart mostand it. H‘YIMHeéHbIfi,M?3WTOp Pe3ucrop, B ~0T0p0M nanpnxenae npoxonamek4y 9epes nero. 811-27-17 condensateur condensateur na 3axnh4ax nenponopuuouanbno TOKY, de lissage de filtrage Condensateur ondulé. destiné à réduire la composante alternative d’un courant smoothing capacitor filter capacitor A capacitor designed to reduce the alternating component of an undulating GMtungskondensator/Siebkondensator condensador de filtrado ; condensador de alisado condensatore di livellamento ; condensatore di filtro afvlakcondensator kondensator wygradzajacy gMttningskondensator current. crnaîuunatomnii KOHACHCaTOp KOHAeHCaTOp+4JlbTpa npenna3na9ennbiYi KOHAeHCaTOp, cocTasnmo~eii 811-27-18 nynbcnpymuero condensateur de démarrage Condensateur, branché asynchrone monophasé, Anlagkondensator en série avec l’enroulement auxiliaire d’un moteur ayant pour but de déphaser le courant dans cet enroulement par rapport démarrage du moteur. starting nepekrennoii yMeHbIIIeHEiR mn -roKa. au courant principal, de maniére à permettre winding of a single-phase le c~:d~n~a~~~e~,,o startcondensator kondensator rozruchowy startkondensator capacitor A capacitor connected asynchronous between motor in series with the auxiliary in order to obtain the main and auxiliary field the necessary phase-displacement currents to permit the motor to start. IlyCKOBOü KOHAeHCaTOp KOHAeHCaTOp, 06MOTKe Q>asbI MexAy KOTOpbIii 811-27-19 noAKntosaeMbIti OAHO(pa3HOrO ToKaMB rnaBHor0 HeO6XOAaM,Anff condensateur nocneAosaTenbH0 aCPiHXpOHHOr0 IIyCKa ABHraTenn ki BcnoMoraTenbHoro K AlIs BcnoMoraTenbHoti AOCTUECHAII noneii ABHraTeJIH. d’extinction Loschkondensator Condensateur destiné a faciliter l’interruption du courant courant de court-circuit d’un bras de convertisseur. commutation CABPïï-a B036yXAeHMR, normal ou du capacitor A capacitor which assists in the extinction current in a convertor arm. of the normal or short-circuit condensador de extincion condensatore di commutazione commutatiecondensator kondensator komutacyjny kommuteringskondensator 50(811) 0 IEC 811-27-19 ncuporacnTeabubtA KOHAeHCaTOp, uouneucavop CIIOCO~CTB~IOIIWI~~ KOpOTKO-3aMKHyTOrO 811-27-20 condensateur TOKa rameauw B MOCTe unu HOpManbHOrO IIpeO6pa30BaTenx. Schutzkondensator condensador de protection condensatore di protezione overspanningsbeveiligingscondensator kondensator ochronny skyddskondensator de protection Condensateur protective 115- destiné à limiter les surtensions transitoires. capacitor A capacitor for limiting fransient overvoltages. 3ZUlViTHbIiiKOHAt?HCaTOp Konneucarop 811-27-21 nna orpammenna condensateur-série nepexonabtx nepenanpaHteukïk (de ligne) Condensateur de puissance destiné à être connecté en série sur une ligne électrique, pour compenser tout ou partie de la réactance de cette ligne. line series capacitor A power capacitor connected in series with an electrical a11 or part of the reactance of that line. line to compensate Leitungs-Reihenkondensator condensador-serie (de linea) condensatore (di linea) in serie seriecompensatiecondensator kondensator kompensacyjny (linii) szeregowy seriekondensator KOHACHCi,TO,,,BKJNVIk?HHblfi llOCJIC~OBZITeJlbHO B 4CIIb 811-27-22 IIOCneAOBaTenbHO CunOBOti KOHAeHCaTOp, IIOnHOrO un11 WiCTu'IHOrO condensateur yCTpaHeHu5l d’amélioration IIOAKnKFieHHbIü peaKTuBHOr0 A power capacitor CeTu Anfl CeTu. de facteur de puissance Condensateur de puissance destiné à être connecté pour en améliorer le facteur de puissance. power factor correction K COIIpOTuBneHUR en parallèle sur un circuit, capacitor connected in parallel with a circuit to improve its power Kompensationskondensator condensador de mejora del factor de potencia condensatore rifasatore arbeidsfactorverbeteringscondensator kondensator poprawy wspolczynnika parallellkondensator factor. uosuteucnpymuuiir KOHA‘?HCaTOp CnnoBoü xonneuca-rop, ynywueHun K03@xwueHTa nonxnro9aekfbtti napannenbao a uenb c uenbI0 MOUIHOCTU. SECTION~~~-28-ÉLECTRONIQUE SECTION811-28 - ELECTRONICS PA3AEJI811-28-3JIEICTPOHklKA 811-28-01 électronique Partie de l’électrotechnique qui tire parti de la propriété de conduction asymétrique de certains matériaux pris isolément ou en combinaison avec d’autres par exemple: semiconducteurs, transistors, thyristors, microproces- seurs. electronics The field of electrical conductivity others e.g. devices. engineering displayed by certain semiconductors, which exploits materials, transistors, the property alone thyristors, of asymmetric or in combination microprocessor with control sneuvpounua ~a3Aen3neKpOTeXHuKu,~OCB~~eHHbI~u3yYeHuH3CBO~CTB~~CuMMeTpu~HOii IIpOBOAuMOCTu, caMocTosTenbH0 KOTOpbIM unu nOnylIpOBOAHUKU, ycTpolcTBa ynpaxneaux. B coveTawïu TpaH3UCTOpb1, 06naAaIoT c ApyruMu TupUCTOpbI, HeKOTOpbIe MaTepuanaMu, MaTepuanbI HanpuMep, MUKpOIIpOUeCCOpHbIe Elektronik electronica elettronica elektronica elektronika elektronik mocy 811-28-02 (551-01-01) électronique Partie 116- 50(811) 0 CE1 Leistungselektronik electronica de potencia elettronica di potenza vermogenselektronica energoelektronika kraftelektronik de puissance de l’électronique qui traite de la technique de puissance. power electronics That part of electronics which deals with power technology. cnJtonaa sneurpounua Pa3Aen 811-28-03 WIeKTpOHUKU, électronique Partie KOTOpbIti CBR3aH C CUnOBOfi TeXHUKOü. Steuerelektronik electronica de control elettronica di comando stuurelektronica elektronika sterownicza styrelektronik de commande de l’électronique qui traite de la technique de commande. which technology. control electronics That part of electronics deals with control saerrpounuaynpanaeenfl PaJAen 811-28-04 3neKTpOHUKU, redresseur C TeXHUKOii yIlpaBneHu% commandé Redresseur équipé d’un élément, tel que gâchette peut être appliquée controlled rectifier A rectifier provided voltage CBII3aHHbIfl en vue de régler with an element, may be applied ou grille, auquel une tension ou d’empêcher le passage du courant. such as a gate or grid, to which a control to regulate or prevent the passage gesteuerter Gleichrichter rectificador controlado raddrizzatore controllato gestuurde gelijkrichter prostownik sterowany styrd likriktare of current. j’IlpaBJl%leMbIiÏBbIIlpBMnTWIb BbIllpRMUTCnb, 3neKTpOA CHa6XeHHbIfi UnU CeTKa, perynupoBaHua 811-28-05 redresseur unu Ha 3nCMeHTOM, KOTOpbIii npepbIBaHua TaKuM, MOxeT KaK IIOAaBaTbCR yUpaBJI5IKWIti HaIIpRxeHUe AnH ToKa. à semiconducteurs Redresseur avec des éléments a semiconducteurs tels que les diodes au silicium. senti-conductor A rectifier rectifier comprising elements made from semiconductors such as silicon Halbleitergleichrichter rectificador de semiconductores raddrizzatore a semiconduttori halfgeleidergelijkrichter prostownik polprzewodnikowy halvledarlikriktare diodes. IIOJIyI,,,OBOAH&,KOBbIti BbIIlpflMnTeJIb BbIIIpSIMUTenb, COACpXtaLIJHii nOnyIIpOBOAHUKOB, 811-28-06 redresseur TaKUX, 3neKTpOHHbIe KaK 3neMeHTb1, KpCMHUeBbIe BbIlIOnHCHHbIti 83 AuOAbI. Quecksilberdampfgleichrichter rectificador de vapor de mercurio raddrizzatore a vapore di mercurio kwikdampgelijkrichter prostownik rtqciowy kvicksilverlikriktare à vapeur de mercure Redresseur utilisant mercury-arc A rectifier des soupapes à vapeur de mercure. rectifier (equipment) using mercury-arc valves. PTyTHbIfi BbIIIpSlMllTWIb BbIIIpRMUTenb 811-28-07 (531-35-21) C UCIIOnb30BaHUCM pTyTHbIX BeHTUneii. ignitron Tube redresseur décharge à cathode en arc est amorcée liquide, à une seule anode, dans lequel chaque par un igniteur. ignitron A single-anode pool rectifier tube in which each arc discharge is initiated by an igniter. nrunrpou OAHOaHOAHbIü B KOTOP~M pTyTHbIti BbI3bIBaeTc54 BbInpRMUTenb 3axuraTeneM. C XUAKUM KaTOAOM, AyrOBOii pa3psA Ignitron ignitron ignitrone ignitron ignitron ignitron - 50(811) 0 IEC 811-28-08 (531-35-22) 117Excitron excitron Tube redresseur électrode à cathode d’entretien liquide, et un dispositif à une seule d’amorçage anode, comprenant mécanique une ou électrique. excitron A single-anode pool rectifier tube with a keep-alive anical or electrical starting device. electrode and a mech- excitron eccitrone excitron ekscytron excitron 3KClSTPOH OAHOaHOAHbIti 811-28-09 (551-04-21) pTyTHbIfi BbIIIpffMUTCJIb C 3JIeKTpOAOM pa3pRAa U MeXaHWieCKUM UJIU 3JIeKTpUWCKUM montage à simple voie (d’un convertisseur) BCIIOMOTaTeJIbHOTO nyCKOBbIM yCTpOtiCTBOM. Montage convertisseur, dans lequel chaque borne de phase courant alternatif est parcourue par un courant unidirectionnel. single-way connection du circuit à (of a convertor) A convertor connection in which the current through terminals of the a.c. circuit flows in only one direction. oAHonoaynepnoAHan each of the phase Einwegschaltung montaje de simple via (de un convertidor) connessione a una via (d’un convertitore) eenwegschakeling (van een omzetter) uklad jednokierunkowy (przeksztahnika) enviigskoppling cxeMa(npeo6pa30BaTenR) Cxe~anpeO6pa30BaTenff,B~0~0p0ii~0~~epe3Ka~AbIYiu3(pa3HbIXBbIBOAOB uenu nepeMenuor0 811-28-10 (551-04-22) montage roka nporexaer TonbKo B ~AH~M nanpasnenun. à double voie (d’un convertisseur) Montage convertisseur, dans lequel chaque borne de phase courant alternatif est parcourue par un courant bidirectionnel. double-way connection à Zweiwegschaltung montaje de doble via (de un convertidor) connessione a doppia via (d’un convertitore) (of a convector) A convertor connection in which the current through terminals of the a.c. circuit flows in both directions. AnyxnonynepnoAHan du circuit each of the phase tweewegschakefing (van een omzetter) uklad obukierunkowy (przeksztartnika) tvàvagskoppling cxeMa(npeo6pa30BaTena) CxeMa ~~~O~~~~~B~TC~~,BKOTO~~~T~K~~~~~K~~A~I~~~(P~~H~IXB~IBOAOB uenu nepeMemior0 roka nporekaer B 06oux nanpasnenuax. 811-28-11 pont (redresseur) Montage single-phase Einphasen-(Gleichrichter)Briickenschaltung puente (rectificador) monofasico raddrizzatore monofase a ponte eenfase(gelijkrichter)brug mostek (prostowniczy) jednofazowy enfasmatad likriktarbrygga monophasé à double voie alimenté en courant monophasé. bridge (rectifier) A double-way connection with single-phase input. OAHO4a3BbIti MOCT(BblIlpSlMliTeJlH) flByXnOJIynCpUOAHaH 811-28-12 pont (redresseur) Montage CXCMa BXOAOM. Drehstrom-Brückenschaltung puente (rectificador) trifasico raddrizzatore trifase a ponte driefase(gelijkrichter)brug mostek (prostowniczy) trojfazowy trefasmatad likriktarbrygga triphasé à double three-phase COAHOI#I~~H~IM voie alimenté en courant triphasé. bridge (rectifier) A double-way connection with three-phase input. TpeX,,,a3HbIii MOCT(BbIIIpS,MAT‘?JIR) AByxnonynepuoAHaR 811-28-13 cxeMa cTpexf$a3HbI~4 BXOAOM. gesteuerte pont commandé Montage à double voie dont tous les bras principaux sont des redresseurs commandés. controlled A bridge double-way connection in which a11 the principal arms are controlled rectifiers. ynpaanneMbtü MO~T ~ByxnoJIynepuoAHaff ynpaBn5leMbIMu. cxeMa, B ~0~0p0ti Bce OCHOBHbIe nnew RBJIRK)TCR Brückenschaltung puente contro’ado (raddrizzatore a) ponte controllato gestuurde brug mostek (prostowniczy) sterowany styrd likriktarbrygga 811-28-14 pont senti-commandé Montage à double de phase s’opérant, commandés. symmetric avec half-controlled cnMMerpnuubrfi de retard in which 811-28-15 y 3TuX sanepxtoi pont senti-commandé Montage à double égaux, dans le réglage tous les bras a common d.c. terminal, ..... arms are controlled the delay angle of the Mocr IIneY UMeeTCR nonoaunaocnoanbIx nne9sisnnwTcn 06muI BMBOA IIOCTORHHOTO TOKa; ynpaBnneMbrx nner 0nuHaKoBbIii. asymétrique voie, où la moitié du nombre des bras principaux, à savoir ceux qui ont une borne commune du côté alternatif, sont commandés, le réglage de phase s’opérant, avec des angles de retard égaux, dans tous les bras commandés. asymmetric half-controlled bridge A double-way connection in which half of the principal arms are controlled and are those arms having a common a.c. terminal, the delay angle of the controlled arms being acnMhrerpnrubtti 811-28-16 yron noayynpae~neMbrii 3aAepxKu pont asymétrique Mocr ~KoTopoü nonoBuHaocHoBHbIxnnes5isn~eTcff ubïeerca o6muü ynpaBnneh4bIx nner BbIBoA nepebrenuoro Taxa; npu onuHaKosbn2. bloquable Pont semi-commandé asymétrique comportant un dispositif pour interrompre la conduction du courant avant que celui-ci s’annule naturellement, en vue d’améliorer le facteur de puissance. asymmetric bridge with external commutation An asymmetric tion before factor. half-controlled interruption acnMMeTpnww$i occurs “out” including naturally, IIOnyyIIpaBnReMbIü npexpameakin npoaoAuMocru BbIKnEOYeHAe,YTO 811-28-17 bridge a device to interrupt in order to improve conduc- the power MocT C nneumnh4 nwmmeHneM ACUMMeTpUYHbIü IIOBbILUaeT MOCT, npexne, uMeloII&, YeM KO3@@iIIUeHT yCTpOüCTB0 IIpOu30üAeT Montage dans lequel deux ou plusieurs leurs tensions côté continu s’ajoutent. AJIff MOIUHOCTU. ponts sont reliés de telle façon que bridges in cascade A connection in which two or more bridges are supplied the voltages on their direct current side are additive. cxeMa coeanueunfl CXeMaCOeAUHeHHR,B COeAUHHIOTCZTTaKUM TOKa 811-28-18 KOTOpOü o6pasoM, asymmetrische, loschbare Brückenschaltung puente asimétrico bloqueable (raddrizzatore a) ponte asimmetrico a spegnimento forzato asymmetrische halfgestuurde brug met gedwongen commutatie mostek asymetryczny o komutacji wymuszonej asymmetrisk likriktarbrygga med sliickningsfunktion eCTeCTBeHHOe ponts en cascade uacuafluan asymmetrische, halbgesteuerte Brückenschaltung puente semicontrolado asimétrico (raddrizzatore a) ponte semicontrollato asimmettrico asymmetrische halfgestuurde brug mostek asymetryczny o regulacji polowicznej ..... equal. ,@yxnonynepuo~nascxeMa, ynpasnaekrok, II y ~TUX nne9 3~0~ symmetrische, halbgesteuerte Brückenschaltung puente semicontrolado simétrico (raddrizzatore a) ponte semicontrollato simmetrico symmetrische halfgestuurde brug mostek symetryczny o regulacji pdowicznej equal. nonyynpasnneivtbtu npu 3ToMyron sont commandés, half of the principal ~Byxnonynepuo~Ha~cxeMa,~~o~opoii ynpaBnffeMbIMU,u à savoir bridge connection arms being des bras principaux, du côté continu, des angles and are those arms having controlled 50(811) 0 CE1 symétrique voie, où la moitié du nombre ceux qui ont une borne commune A double-way 118 - in such a manner that Kaskadenbrückenschaltung puentes en cascada ponti in cascata bruggen in cascadeschakeling polqczenie mostkow kaskadowe kaskadkoppling ~ocron ABa UnU 6onee IIpeO6pa30BaTenbHbIX MOCTa ~TOuXHaIIp5I~eHU~HaCTOpOHe~OCTO~HHOrO CKJIaAbIBaIOTC% montage antiparallèle Combinaison de deux soupapes, dont chacune l’anode de l’autre, utilisée pour commander alternatif. anti-parallel est reliée par sa cathode les deux demi-ondes à d’un courant connection A combination of two valves, where each cathode is connected to the anode of the other valve, used to control both half waves of an alternating current. Gegenparallelschaltung montaje antiparalelo connessione in antiparallelo anti-parallelle verbinding pdaczenie ritwnolegre przeciwsobne antiparallell koppling 50(811) 0 IEC 811-28-18 ncrpeuno-napannenbuan 811-28-19 (551-05-01) AByX aaonyApyror0 BeHTunqu Transfert BeHTUneü,B KOTopokr KoTopan nepeMeHHor0 commutation KaTOA nOAKnm9aeTc~ K ToKa. Kommutierung conmutacion (en un convertidor) commutazione commutatie (in een omzetter) komutacja (w przetworniku) kommutering d’un bras à un autre. commutation (in a convertor) The transfer of current noMMyraqnn (B npeO6pa30BaTene) TOKa commutation from OT OAHOrO one arm to another. IIneYaKApyrOMy. Zwangskommutierung externe Mode de commutation une source extérieure external KaXAbIti ucnonb3yeTc5innnynpasnewïao6omni (dans un convertisseur) du courant I-kpeXOA 811-28-20 (551-05-03) cxesta coennueunn COBOKyIIHOCTb nonynepuoAaMu 119- dans lequel la tension de commutation est fournie au convertisseur ou au contacteur électronique. par commutation A method of commutation where the commutating source outside the convertor or electronic switch. voltage is supplied by a conmutacion (Fremdführung) externa commutazione esterna externe commutatie komutacja wymuszona ; komutacja zewnetrzna extern kommutering ; tvàngskommutering BHBIUHI1R KOMMYTaqNR Cnoco6 KOMMyTaUuU, noAaeTcx 3neKTpOHHOrO 811-28-21 (551-05-14) IIpu KOTOpOü KOMMyTupyEOIAee HaXOARLWiMCII UCTOYHUKOM, KOMMyTal(uOHHOrO BHe HaIIpSlXeHUe unu npeo6pa30BaTenR aIIIlapaTa. angle d’empiétement angle de commutation Durée de la commutation angulaire, entre deux bras principaux, dans le cas où les deux bras conduisent exprimée en mesure simultanément. angle of overlap commutation angle The duration of commutation, expressed in angular measure, during Uberlappungswinkel angulo de conmutaci0n angolo di sovrapposizione ; angolo di commutazione overlappingshoek ; commutatiehoek kat komutacji kommuteringsvinkel which the two arms carry current simultaneously. yron nepeupbrrnn yron uohrMyraunn BpeMR KOMMyTaIJUu, npOTuBO@a3HbIe 811-28-22 (551-05-17) B IIJIeWi yI-JIOBOM IIpOBOASITTOK u3MepeHuU, B TeYeHue KOTOpOrO OAHOBpeMeHHO. réglage de phase Anschnittsteuerung/Zündeinstellung Opération consistant à faire commence la conduction varier l’instant de courant de la période, dans une valve à partir duquel ou un bras. phase control The process of varying the instant within tion in a valve or an arm begins. +a30808 ynpaaneune npOIJeCC U3MeHeHUII unu 811-28-23 (551-05-29) nneqe B npenenax HaYanbHOTO the cycle at which MOMeHTa IIpOBOAUMOCTU current TOKa conduc- B BeIiTtine Intervalle de temps, exprimé en mesure angulaire, pendant lequel le point de départ de la conduction de courant est retardé par le réglage de phase. current delay angle The time expressed in angular measure by which the starting instant of current conduction is delayed by phase control. nuJuouenun BpeMnByrnOBOMU3MepeHUU,HaKOTOpOe3aAepXuBaeTCff npoaonuMocrki ToKa de fase regolazione di fase fasesturing ; faseaansnijding sterowanie fazowe fasvinkelstyrning quxna. angle de retard du courant yron sanepucun regu’acion B pe3ynbTaTe @a30Boro HaYanbHkMOMeHT ynpaeneaua. Verzijgerungswinkel angulo de retardo de corriente angolo di ritardo della corrente vertragingshoek kat opoinienia pradu styrvinkel 811-28-24 (551-05-31) 120- 50(811) 0 CE1 facteur de réglage de phase Rapport de la tension Aussteuerungsgrad pour un angle de retard du courant tension pour un angle de retard du courant nul, en supposant déterminé, à la nulles toutes les chutes de tension. phase control factor The ratio of the voltage zero current delay ~03~@umeisT +a3oBoro OTHOLIIeHHe 811-28-25 a11 voltage IIpl4 npa HyJIeBOM HanpnxeHlm current delay drops being angle to the voltage assumed de fase fattore di regolazione di fase fasestuurfactor wspolczynnik sterowania fazowego utstyrningsgrad at to be zero. 0npeAeneHHoM yrne paBa0 yrne npu 3aAepxKH, 3aAepxKH 3TOM BKJIIOOYeHWl npennonaran, K YTO Hymo. temps de repos (d’un bras) intervalle de repos Partie de la période d’une tension parcouru par aucun courant. non-conducting idle period hei Anschnittsteuerung de regulacion ynpasneeefl HanpsxeHua HanprrxeHmo naAemïe at the prevailing angle, factor interval (of That part of an alternating an alternative pendant laquelle le bras n’est arm) voltage Stromlose Zeit tiempo de reposo tempo di riposo (di un riposo stroomloosinterval okres nieprzewodzenia tomgangsperiod ramo) ; intervallo di cycle during which the arm is not carrying current. IlepuOa HeupOBOn&lMOCTtl xonoc~oü nepkion naeva YacTb nepaoAa nponycKaeT 811-28-26 nepeMeHHor0 HanpRxeHAn, B Te‘remie KoToporo nne90 He ToKa. temps de tension négative intervalle de blocage dans le sens inverse Partie du temps négatif de repos pendant par rapport reverse blocking inverse period NegativspannungsdauerI Rückwartssperrdauer laquelle l’anode se trouve à un potentiel à la cathode. interval That part of the idle period during which the anode has a negative tiemPo de tension negativa tempo di blocco (in senso) inverso ; intervallo di blocco (in senso) inverso blokkeertoestand okres blokady w kierunku nieprzewodzenia spiirrsp%tningsintervall potential with respect to the cathode. nepaon AeiiCTBufl 06paTHoro YaCTb IIepHOAa OTpHuaTeAbHbI8 811-28-27 HanpflxeHm HeIIpOBOAPïMOCTH, IIOTeHuPiaJI B TeYeHlle OTHOCIITeAbHO KOTOpOrO aHOA IIMeeT KaTOAa. temps de blocage intervalle de blocage dans le sens direct Partie du temps de repos pendant laquelle l’anode a un potentiel positif par rapport à la cathode, le départ de la commutation étant bloqué par le réglage de phase. off-state interval hold-off period That part of the idle period during with respect to the cathode, the start of commutation which the anode has a positive potential being blocked by phase control. ,,HTepBaJl 3aKpblTOrO COCTOflHufl YaCTb UHTepBaAa nOJIOxI4TeAbHblk KOMMyTauIIA HeIIpOBOAMMOCT&i, nOTeHUIlaA 6AOKGipyeTCX B Te'IeHlle OTHOCkiTeJIbHO aa30BbIM KOTOpOrO KaTOAa; yIlpaBJl‘?HHeM. npH aHOA 3ToM IIMeeT HaYano Sperrzeit/VonvWssperrzeit tiempo de bloqueo tempo di blocco (in senso) diretto ; intervallo di blocco (in senso) diretto vrijwaarinterval okres blokady w kierunku przewodzenia blockspGningsinterval1 - 50(811) 0 IEC 811-28-28 sens de conduction Sens normal (d’un élément du courant 121 - redresseur) utile dans un élément redresseur, de l’anode à la cathode. rectificador) conducting direction (of a rectifier The normal cathode. direction element) of load current in a rectifier element, Le. from anode to HOpManbHOe HanpaBneHPie 3JleMeHTe, T.e. OT aHOAk sens de non-conduction sens inverse Sens opposé HaTPJ’3OYHOTO TOKa B BbIIIPRMHTWIbHOM K KaTOAy. (d’un élément inverse direction (of a rectifier opposite rectificador) senso inverso (d’una valvola o di un ramo) (d’un raddrizzatore) ; senso di non conduzione (d’una valvola o di un ramo) element) to the conducting direction. (d’un nporuaonononrnoe nanpasnenmo raddrizzatore) sperricbting (van een gelijkrichtelement) kierunek nieprzewodzenia (elementu prostowniczego) backriktning 06paTHoe HanpaBneHee Hanpaanenne, raddrizzatore) doorlaatrichting van een gelijkrichtelement kierunek przewodzenia (elementu prostowniczego) ledriktning ; framrikting Sperrichtung (eines Gleichrichterelementes) sentido de no conduccion (de un elemento redresseur) au sens de conduction. The direction 811-28-30 (551-05-55) senso diretto (d’una valvola o d’un ramo) (d’un raddrizzatore) ; senso di conduzione (d’una valvola o d’un ramo) (d’un HanpaBneHee npoBoArrMocTn 811-28-29 Durchlallrichtung (eines Gleichrichterelementes) sentido de conduccion (de un elemento npoao~nMocrn. allumage amorçage Ziinden encendido Etablissement du courant, dans le sens de conduction, un bras commandé par action de commande. dans une valve ou dans firing triggering The establishment of current in the conducting valve or arm by control action. direction accensione ; innesco ontsteken zapfon ; przewodzenie tiindning in a controllable BKJllOYeHtte 0TnapaHHe YCTaHOBJIeHLie seurune 811-28-31 TOKa IIJIR nnere B HaIIpaBJIeHkIH nyreM IIpOBOAkiMOCTH B J’lIpaBJISIeMOM ynpaaneenx. Loschung extincion estinzione doven wygaszanie slackning extinction Fin de conduction du courant dans un bras. extinction The termination of current conduction in an arm. BblKJlmYeHlIe 3anapaKHe IIpekpameuue 811-28-32 harmoniques EIPOBOAHMOCTH d’ondulation TOKa B nnese. d’un redresseur Composantes sinusoïdales de l’ondulation du côté continu, dont les fréquences sont des multiples de la fréquence nominale du réseau (multiples pairs, dans le cas d’un redresseur symétrique). ripple harmonies Sinusoidal of a rectifier components on the d.c. side whose frequencies fundamental frequency symmetric rectifier). of the supply voltage (even are multiples multiples of the in the case of a rapMOHUKU BblnpnMUTeJIfl CHHJ’COHAanbHbIe KOTOPbIX COCTaBLGIIOIWie IIBJIRIOTCII HaIIpSllKKeHiin CAMMeTPAYHOTO KpaTHbIMII (KpaTHbIMII Ha WJCJIâMA BbIIIpffMtiTeJIn). CTOpOHe WiCJIaMEi IIOCTORHHOTO OCHOBHOÜ naxe B TOKa, SaCTOTbI cnyqae YaCTOTbI IDïTaEOIUeTO IICIIOJIb30BaHAR Oberschwingungen der Welligkeit eines Gleichrichters armonicos de rizado de un rectificador armoniche lato corrente continua d’un raddrizzatore hogere harmonische van de rimpelspanning harmoniczne prqdu tetnigcego overtoner 811-28-33 (551-06-28) 122- 50(811) 0 CE1 tension d’ondulation Composante Uberlagerte alternative de la tension du côté courant continu d’un convertis- on the d.c. ondulazione della tensione rimpelspanning napiecie tetnienia pulsationssptinning seur. ripple voltage The alternating convertor. nynbcauua voltage component of the voltage side of Wechselspannung tension de rizado a uanpfl~euufl IIepeMeHHaa COCTaBnSIIomaR Hanprrxemm Ha CTOpOHe IIOCTORHHOTO TOKa IIpeO6pa3OBaTeZWI. 811-28-34 (551-06-30) taux d’ondulation Rapport d’un courant continu de la demi-différence valeur moyenne Note. - d’un courant Pour les faibles approximativement maximale entre les valeurs continu valeurs égale au rapport maximale et minimale à la pulsatoire. du taux d’ondulation, cette grandeur est de la différence à la somme des valeurs Schwingungsweitenverhaltnis factor de rizado de una corriente continua tasso d’ondulazione d’una corrente continua gelijkstroomrimpelfactor wspticzynnik tgtnienia (prqdu stalego) Pulsationsfaktor et minimale. d.c. ripple factor The ratio of half the difference between the mean value direct Note. - of a pulsating With low values the maximum of the d.c. ripple imately equal to the ratio of the difference the minimum values. K03@@UW2HT 811-28-35 (551-05-53) value to factor this quantity is approx- to the sum of the maximum and IlyJlbCaUW llOCTOflHHO~O TOKB OTHOIIIeHHe IIOJIOBIIHbI 3HaYeHHIMH IIyJIbCHpyIOmerO ~@fMWWHe. - IIOCTORHHOrO TOKa pa3HOCTII and minimum current. pa3HOCTII npPI MexAy MaJIbIX 3Ta MaKCAMaflbHbIM nOCTORHHOr0 3HaYeHHRX BeJIEIYPIHa MaKCIIManbHOrO TOKa K er0 II MHHMMaJIbHbIM CpeAHeMy 3HaYeHHIO. K03I$C@IUAeHTa IIpEI6JIEI3HTenbHO M MHHHMaJIbHOrO paBHa 3HaYeHI@I IIyJIbcauHH OTHOIIleHIIIO K AX ‘GYMMe. Durchziindung raté de blocage Perte temporaire de la capacité de blocage d’un bras commandé, pendant l’intervalle perturbé, l’intervalle dans le sens direct d’une valve qui est, en fonctionnement ou non de blocage. breakthrough The temporary during loss the interval of forward which blocking ability is, in undisturbed of a controllable operation, valve the forward ~~n~~~o~~o~c~ tijdelijke doorslag opuszczenie blokowania genomtiindning ; sjfilvt&dning or arm blocking interval. BpCMeHHbli-4npo6oïr BpCMCHHan noTeps BeHTAJIR AJIW n,IeYa SBJIaeTCSI 811-28-36 (551-05-57) IIpaMOii BO BpeMa HHTepBanOM 3aIIHpaIomeiiCa FIHTepBaJIa, IIpSIMOrO cnoco6HocTa KOTOpbIil 3aKpbITOr0 yIIpaBJISIeMOr0 IIpI4 HOpManbHOti pa6oTe COCTOIIHHR. raté d’allumage raté d’amorçage Défaut pour lequel la conduction dans une valve ou dans un bras commandé ne s’établit pas pendant l’intervalle qui est, en fonctionnement non perturbé, l’intervalle de conduction. firing failure A failure to achieve conduction interval which is, in undisturbed in a controlled valve or arm during operation, the conduction interval. the IIpOnyCK BK.WOYCHI(R OTCyTCTBMe nepexona rinu B nne9a IIBJISIeTCa TeYenne PIHTepBaJIOM B npoaonflmee nerepeana, OTKpbITOrO COCTORHEIe KOTOpbIii COCTORHHR. ynpasnseïvroro IIpPI HOpManbHOti BeHTAJISI pa6ore Zündversager fallo de encendido mancata. accensione onstekmgsstoring opuszczenie tandmiss zapfonu ; mancato innesco - 50(811) 0 IEC 811-28-37 (551-05-52) 123 - raté de commutation Défaut pour lequel le courant n’est pas transféré du bras en conduction au bras suivant. commutation A failure failure to commutate the current from a conducting Kippen (Kommutierungsversager) fallo de conmutacion mancata commutazione commutatiestoring opuszczenie komutacji kommuteringsmiss arm to the succeeding arm. IIOTCPHKOMMyTaUWi OTCJ’TCTBHC KOMMYTâWH TOKa OT IIpOBOAS?IWl-0 WIWIa K CJICAyIOIWMy nneyy. SECTION 811-29 - APPAREILLAGE SECTION 811-29 - SWITCHGEAR PA3AEJI 811-29 - KOMMYTALI(HOHHAII 811-29-01 (441-14-20) AI-IIIAPATYPA disjoncteur Leistungsschalter Appareil mécanique de connexion capable d’établir, de supporter et d’inter- rompre des courants, dans les conditions normales du circuit, ainsi que d’établir, de supporter, pendant une durée spécifiée, et d’interrompre des courants dans des conditions anormales spécifiées du circuit telles que celles du court-circuit. interruptor interruttore automatico vermogenschakelaar vvJ”Wznik effekthrytare circuit-breaker A mechanical switching device, capable of making, carrying and breaking currents under normal circuit conditions and also making, carrying for a specified time and breaking currents under specified abnormal circuit conditions such as those of short-circuit. BblKJltO=KiTCJlb xoMyrnpyromee MeXaHwieCKOe IICpCAWIy Ii BbIK,IEOYCHAe BKJIIOYCHHe, TOKa 811-29-02 (441-14-28) II’ZpeAaYJ IIpH B TWeHEïe OJIpeAWIeHHbIX HaIIpPïMep, KOPOTKOe disjoncteur à huile Disjoncteur 06ecnesnsaromee yCTp0ilCT~0, TOKa IIpI, muwmeme, HOPMUbHblX JUIOBW-IX IJCOPI, a TBKXE yCTaHOBAeHHOr0 BPCMCHH II BbIKJEOYCHBC HeHOpManbHbIX )UIOBWIX IWIkï, TaKUX, KaK, 3aMbIKaHBe. dont les contacts s’ouvrent et se ferment Olschalter (Olleistungsschalter) interruptor automatico de aceite interruttore in oh0 olieschakelaar wylacznik olejowy oljebrytare dans l’huile. oil circuit-hreaker A circuit-breaker in which the contacts open and close in oil. MaCJlKHbli-4 BblK,KW,aTt?,,b BbIKJIWIaTeJIb, 811-29-03 (441-14-30) disjoncteur KOHTaKTbI pa3MblKEUOTCR II 3aMbIKaEOTCH B MaCJIe. à gaz comprimé Disjoncteur gas-blast B KOTOPOM dans lequel l’arc se développe dans un courant de gaz. circuit-breaker A circuit-breaker in which the arc develops in a blast of gas. Druckgas-Leistungsschalter interruptor automatico de gas comprimido interruttore a gas in pressione drukgasschakelaar wylqcznik przedmuchowy gazowy tryckgasbrytare BblKJIH>YaT‘?Jlb C iX3OBblM AJ’TbeM BbIKJIKNaTWIb, CTBTMM 811-29-04 B KOTOPOM disjoncteur à air comprimé Disjoncteur dans lequel air-blast l-iUl.IeHHe 3JIeKT&WiCCKOii AyrlS IIpOH3BOAHTCR I230M. l’arc se développe dans un courant circuit-breaker A circuit-breaker in which the arc develops in a blast of air. d’air. Druckluftschalter interruptor automatico de aire comprimido interruttore pneumatico drukluchtschakelaar wylacznik przedmuchowy powietrzny trycklufthrytare 811-29-04 50(811) 0 CE1 BbIKJlIOYaTCJlb C BOSAj’UIHblMAYTbBM BbIKJIWiaTeJIb, CTaTbIM 811-29-05 (441-14-29) 124- B KOTOPOM TaIUeHHe JJIeKTpIVIeCKOfi AyrH IIpOI43BOAE4TCSl B03AyXOM. disjoncteur à vide Disjoncteur dans lequel les contacts s’ouvrent et se ferment Vakuumschalter interruptor automatico interruttore a vuoto vacuümschakelaar wylqcznik proiniowy vakuumbrytare dans une enceinte où règne un vide poussé. vacuum A circuit-hreaker circuit-breaker evacuated in which the contacts open and close within a highly de vacio envelope. BaKKflMHb1i-i BblKJlIOYBTCJlb BbIKJIKFiaTeJIb, 6annoue 811-29-06 B KOTOpOM C BbICOKHM disjoncteur ultra-rapide Disjoncteur d’empêcher KOHTaKTbI 3aMbIKaEOTCII H pa3MbIKaIOTCII (à courant continu) dont la durée de coupure est particulièrement le courant de court-circuit d’atteindre sa valeur (d.c.) high-speed B BaKyyMOM. brève, en vue présumée. circuit-breaker A circuit-breaker with a very short break-time short-circuit current from attaining its prospective intended value. to prevent the Schnellschalter (Gleichstrom) interruptor automatico ultrarapido corriente continua) interruttore extrarapido (gelijkstroom)snelschakelaar wylqcznik szyhki (prqdu stakgo) hoghastighets ls-brytare 6blCTpO~CiiCTBJ’“,“,HK BbIKJ,IOW,T‘3Ib(IIOCTORHHOTO TOKB) BbIKJIWIaTeJIb C npeAHa3HaqeHHbIk 811-29-07 (441-14-33) contacteur OYeHb nepnonoM KOpOTKIIM AJISI OrpaHWIeHPI5l TOKa KOpOTKOrO BbIKJIIOYeHIIR, 3aMbIKaHWl. (mécanique) Appareil mécanique de connexion ayant une seule position de repos, commandé autrement qu’à la main, capable d’établir, de supporter et d’interrompre des courants dans les conditions normales du circuit, y compris les conditions de surcharge (mechanical) en service. Schütz contactor (mecanico) contattore (meccanico) contactor stycznik kontaktor contactor A mechanical switching device having only one position of rest, operated otherwise than by hand, capable of making, carrying and breaking currents under normal circuit conditions including operating overload conditions. (MeXaHWlCCK~ii) KOHTBKTOP MexaHmecKoe KOMMyTHpyIOIUee nonoxeHPie PYYHOTO, nOKOI1 B cnoco6aoe HOpMaJIbHbIX yCTpOiiCTB0, BKJIFYIaTb, yCJIOBHsX UeUPï, uMem4ee B AeiiCTBHe npHBOAHMOe B JIIO6bIM nponycKaTb II TOM npH wcne mm6 oAH cnoco6oM, KpOMe BbIKJIEOYaTb TOKII B 3KCIIJlyaTaUkIOHHbIX neperpysxax. 811-29-08 ...de ligne Qualifie un disjoncteur ou un contacteur employé pour séparer de la ligne, notamment en cas de surcharge, le circuit des moteurs de traction. line... Circuit-breaker or contactor used to disconnect the traction from the line, especially in the event of overload. motors circuit Uberstromschalter ... de linea .... di linea lijnschakelaar liniowy (stycznik lub wylqcznik) motorskyddshrytare I-J,aBHbItiBb,KJlK)W,T‘Sb (KOHTBKTOP) BbIKJIWiaTeJIb ABmaTenei% 811-29-09 contacteur Contacteur WI11 KOHTaKTOp,npHMeHReMbIti OT KoHTaKTHoG AJIFI OTCOeAllHeHIIR np5ï TIII-OBbIX neperpy3Ke. électromagnétique dont les contacts principaux electro-magnetic A contactor ceTqOCO6eHHO sont actionnés par un électro-aimant. contactor having main contacts operated by an electro-magnet. elektromagnetisches Schütz contactor electromagnético contattore elettromagnetico elektromagnetische schakelaar stycznik elektromagnesowy elektromagnetisk kontaktor (de - 50(811) 0 IEC 811-29-09 125 - 3JlCKTpOMZWHliTHblü KOHTaKTOp TnaBHbIe KOHTaKTOp, KOHTaKTbI KOTOpOI-0 npWBOA5ITCfI B AetiCTBHe 3nCKTpOMaTHUTOM. 811-29-10 contacteur électropneumatique Contacteur dont les contacts principaux tique commandé par une électrovalve. electro-pneumatic A contactor sont actionnés par un piston pneuma- contactor having main contacts operated by an electro-pneumatic by a pneumatic piston controlled B AeiiCTBHe elektropneumatisches Schütz contactor electroneumatico contattore elettropnenmatico elektropneumatische schakelaar stycznik elektropneumatyczny elpneumatisk kontaktor valve. 3aCKTpOKHCBMaTWrCCKrtir KOHTBKTOP KOHTaKTOp, rnaBHbIe KOHTaKTbI 3neKTpOnHeBMaTAYeCKUM 811-29-11 contacteur Nockenschütz à came Contacteur camshaft IlpEIBOA%TW KOTOpOI’O KJIaIIaHOM. dont les contacts principaux sont actionnés par un arbre à cames. contactor A contactor having main contacts operated by a camshaft. contactor de levas contattore a camme nokkenschakelaar stycznik kubkowy kamstyrd kontaktor KOHTBKTOPC paCllpCACJll4TeJlbHblM BBJlOM l-JIaBHbIe KOHTaKTOp, pacnpeAenxTenbHbIM 811-29-12 contacteur KOHTaKTbI KOTOpOrO IIpPiBOASITCR B AetiCTBHe canoë. Anzapfschütz (Stufenschütz) contactor de tomas contattore di presa aftakschakelaar stycznik zaczepowy transformatorkontaktor de prises Contacteur connecté à une prise de réglage. tapping contactor A contactor connected to a tapping point. KOHTBKTOPBblBOAa KOHTaKTOp, 811-29-13 IIOACOeAAHReMbIfi contacteur K 3aXGiMy Uberschaltschütz de passage Contacteur qui conduit le courant transformateur à la suivante. transition BbIBOAa. pendant le passage prise d’un contactor A contactor former d’une which carries current during transition to the next. from one tap of a trans- contactor contattore (Ubergangsschütz) de PasO di transizione stycznik przelqczeniowy overkopplingskontaktor llept?XOAHOfiKOHTBKTOP KOHTaKTOp, KOTOpbIii TpaHC@OpMaTOpa 811-29-14 contacteur IIpOIIyCKaeT TOK B IIepkïOA IIepeXOAa C OAHOk CTyIIeHE4 Ha ApyQ’IO. de freinage Contacteur destiné à établir les connexions d’un circuit de freinage. hraking contactor A contactor which sets up the connections of a braking circuit. Bremsschütz contactor de frenado contattore di frenatura remschakelaar stycznik hamowania bromskontaktor TOPMOSHOÜKOKTaKTOp 811-29-15 KOHTaKTOp, HCIIOnb3yeMbIÜ contacteur de mise à la terre Contacteur earthing AJIFI COCTaBneHHR CXeMbI TOpMOSHOi? Erdnngsschütz contactor de puesta a tierra contattore di messa a terra aardingsschakelaar stycznik uziemienia jordningskontaktor utilisé pour mettre à la terre un circuit. contactor A contactor used to connect a circuit to earth. 3a3CMJHKO”,~iï KOHTBKTOP KOHTaKTOp, HCIIOnb3yeMbI% AJIR IIOACOeAHHeHWI UenA UeIni. Ha “3eMnKf’. 811-29-16 50(811) 0 CE1 126- Schaltergruppe (Schützegerüst) bateria de contactores gruppo di contattori contactorrek zespti stycznikowy kontaktorstativ batterie de contacteurs Châssis ou armoire dans lesquels sont montés un certain nombre de contac- teurs. contactor A frame group or case in which a number of contactors are mounted. r,,ynna KOHTaKTOpOB Kopnyc, 811-29-17 (441-14-05) B KOTOpoM yCTaHOBneH0 HeCKOJIbKO KOHTaKTOpOB. sectionneur Appareil distance mécanique de connexion qui assure, en position d’ouverture, de sectionnement satisfaisant à des conditions spécifiées. Note. Un sectionneur - lorsqu’un courant est capable d’intensité d’ouvrir négligeable une et de fermer un circuit seulement est interrompu ou établi. Trennschalter seccionador sezionatore scheider odqcznik franskiljare disconnector isolator A (deprecated) mechanical isolating Note. switching distance - A disconnector negligible device which in accordance current is capable is broken provides, with specifîed of opening in the open position, an requirements. and closing a circuit only when or made. pa3aenanareab h'feXaHWIeCKOe KOMMyTHpyIOUee pa30MKHyTOM COCTORHMH, COOTBeTCTBHH C YCTaHOBJIeHHbIMH ~jLYMc?YaHH. - TOJIbKO 811-29-18 "pH HaXOAIICb B paCCTOirHW2 B Tpe6OBaHAnMPï. PasaeAHHPiTeJIb BKJIIOYeHIIH KOTOpOe, z43ompymuee cnoco6ea II BbIKJIIOYeHCIH pa3MbIKaTb TOKa II 3aMblKaTb He3HaWSTenbHOti UeIIb BeJIWiHHbI. court-circuiteur Appareil servant à établir élément de circuit, nement. short-circuiting un court-circuit pour le protéger to protect it against YCTPOACTBOAJIB YaCTII aux bornes dans le cas d’une d’un circuit anomalie ou d’un de fonction- device A device to make a short-circuit 811-29-19 yCTpOfiCTB0, COsAaeT of a circuit or part of a circuit malfunctioning. co3AaHm AJIR 3aIWITbI at the terminals ~0p0T~0~03aMbIKaHPïR OT HeIIpaBI'I."bHO% Ha3amiMax uem mn4ee pa6OTbI. Schalterkombination combinador combinatore schakelbatterij prze@znik grupowy ; nastawnik apparatutrustning combinateur Appareil servant à réaliser des connexions variées. switcbgroup Equipment 811-29-20 used to make various combinateur de puissance Combinateur réalisant connections. des connexions variées du circuit de puissance. power switchgroup A switchgroup cmo~ol effecting rpynnosoii rpynnOBOi? COeAHHeHWI Kurzschlieger cortocircuitador cortocircuitatore kortsluitschakelaar zwiernik kortslutningsutrustning various connections in the power circuit. nepeurmuareab IIepeKJIWiaTeJlb,OCy~eCTBJI~~IIWki B CHlIOBOti IlenH. OAHOBpeMeHHO pa3JIH'IHbIe Leistungsschalterkombination combinador de potencia combinatore di potenza vermogenschakelbatterij przelacznik obwodu trakcyjnego huvudapparatutrustning 50(811) 0 IEC 811-29-21 interrupteur d’isolement Combinateur servant permettant de moteur de traction à isoler la marche 127- un ou plusieurs en traction moteurs ou en freinage, de traction, avec les moteurs tout en restant en circuit. traction motor isolating A switchgroup switch to isolate one or more vehicle to operate in service remaining in circuit. traction in traction motors or braking while with allowing the other the Fahrmotoren-Trennschalter interruptor de aislamiento de motor de traction escluditore (dei motori) tractiemotorscheider przegqcznik separacyjny silnikow motorfranskiljare motors pa3aenuHuTeab THroabIx AnltraTeneii rpynnOBOti FICpCKnWIaTCJIb, MJIII HCCKOJIbKMX 811-29-22 I’IpCAHa3HSIeHHbIl-i TRrOBbIX IIOABUXHOrO COCTaBa OCTUIbHbIMII TIITOBbIMH ABIWZlTWICii B Anff B JKCIInyaTaIlPIH AJIII OTCOeAIIHeHAR o6ecnereHm B peXI4Me pa6OTbI TSI-II HnM OAHOl-0 eAHHPIub1 TOpMOTeHAR C ABlWaTCJIRMH. Richtungswender inversor (de marcha) inverseur (de marche) Combinateur d’inversion du sens de marche. invertitore (di marcia) rijrichtingschakelaar reverser A switchgroup for reversing the direction nawrotnik of motion. fram-backomkopplare peaepcop rpynnoeoi 811-29-23 IIpCAHa3HFIeHHbIfi nepeKnmosaTenb, HaIIpaBneHHanBIGKeHkIa Pi3MCHCHMZd Ana Ha 06paTHOe. inverseur-sectionneur Combinateur jouant moteurs de traction. disconnecting à la fois les rôles d’inverseur et de sectionneur des switch reverser A switchgroup disconnector. providing the dual function of reverser and traction motor Richtungswender-FahrmotorenTrennschalter (kombiniert) inversor-seccionador invertitore-escluditore rijrichtingsscheiderschakelaar nawrotnik od&zajqcy motorfranskiljare med fram-backomkopplare pesepcop-pa3aeneuuTenb rpynnoaoti nepeKnroraTenb, pa3aenHHHTenn 811-29-24 TaroBbIx BbInonHaIomal @YHKIIMII KaK pesepcopa, TaK R AauraTeneii. Widerstands-Stufenschaltwerk éliminateur Combinateur d’élimination des résistances eliminador combinatore d’awiamento de démarrage. aanzet(rij)weerstandschakelaarbatterij resistance switchgroup A switchgroup for cutting out starting przelqcznik rezystorow motstAndsomkopplare resistance. peOCTaTHblfi KOHTpOJlJlep rpyIIIIOBOfi nepeKnIoqaTenb, 811-29-25 combinateur AJM nepeKnm9eHm2 de transition Combinateur exemple IIpenHa3HaYeHHblti pesI4cTopa. IIyCKOBOrO Ubergangsschalter de puissance pour passer du utilisé pour modifier couplage série au le couplage couplage des moteurs, par parallèle. transition switchgroup A power switchgroup to parallel. nepexoneol CEmo~oii to change the motor combination, e.g. from series rpynnosoii nepeKnmqaTenb, COeAHHeHMR nocnenoBaTenbHor0 nakn-aTeneir npenHa3uaqeuHbIii Ha nna nepexona nwoe, HanpIIMep, l’excitation des moteurs c c Ha napannenbeoe. Feldschwachungsschalter shunteur Combinateur traction. field-weakening A power de transici6n combinatore di transizione motorgroeperingsschakelaars przelqcznik ukladu silnikow Gverkopplingsutrustning nepeKnmraTenb OAHOI-0 811-29-26 used combinador de puissance utilisé pour réduire switchgroup switchgroup used to reduce traction motor excitation. de shuntador combinatore d’indebolimento campo veldverzwakkingsschakelaars przelqcznik oslabienia wzbudzenia f%ltfGsvagningsomkopplare 811-29-26 nepeuntouaTeab CunoBoii oc~a6neunfl rpynnonoii B036y~AeHIIR 811-29-27 50(811) 0 CE1 nonn nepeKnIosaTenb, TKrOBbIX 128 - npeAHa3Ha9emIbIti mm ocna6nemn ABEIraTeJIek contrôleur Fahrschalter Combinateur faible manuel de puissance utilisé pour la conduite de véhicules de puissance. power controller A manually power operated cnaoBoü KouTpoaaep PyYHOI% CIUIOBOn rpynnoaoti ABmKeHneM used for the driving control of low IIepeKnKFIaTenb, noAnnxoior0 npeAHa3HareHHbIii CocTaBa Manon Ann ~0111u0cTn. graduateur changeur de prises en charge Combinateur sans A permettant interrompre (on-load) les Stufenschaltwerk cambiador de tomas en carga; de changer circuits de de prise de réglage du transformateur, the allowing traction regelschakelaar (onder belasting) przebfcznik zaczepow pod obciqieniem lindningskopplare traction. nepeunmraTenb rpynnOBOti transformer be changed without inter- cTyneaeA (noA uarpy3uoii) 6e3 TpaHCI$OpMaTOpa Combinateur to circuits. nepeKnIoYaTenb, combinateur tappings o6ecne~sBaIomsu pa3pbIBa TSIrOBOn nepeKnmremIe CIIJIOBOti BbInoAoB IIenn. Steuerschalter combinador de control combinatore di comando stuurstroomschakelaars przelacznik obwodu sterowniczego mantiverapparatutrustning de commande réalisant des connexions variées du circuit de commande. control switchgroup A switchgroup 811-29-30 effecting nepeuntouaTenb rpynnOBOn nepeKnmYaTenb, combinateur manual de circuit. pa3nmmbIe coeAnueHus B Handbetiitigter à la main ou au pied, soit directement, soit par renvois. switchgroup operated rpynnosoé Combinateur foot, either directly or by manoeuvré par motor-driven switchgroup switchgroup operated pyKOti ynpaBnKeMbIH hydraulic, rpynnonol nepeu8muaTenb un motorisch betatigter combinatore manuale handschakelaars nastawnik pojazdowy reczny handmanijvrerad apparatutrustning Horoti unu IIepeAaWI. moteur ou by pneumatic, a IIHeBMaTHYeCKPIM, pneumatique, électropneumatique, électrique. motor, electro-magnetic nepeKnbz+IaTenb, 3JIeKTpOMarHIITHbIM manua shafting. à moteur électromagnétique 6bITb or IUIM IIOCpeACTBOM hydraulique, rpynnOBOï4 hand Schaltwerksantrieb combinador nepeuatoraTeab HenOCpeACTBeHHO combinateur by nepeKnmYaTenb, rpynnOBOn MOxeT control ynpae~eunn 0cymecTBnnIomak manoeuvré switchgroup pyreol A in the manuel l’intermédiaire A connections ynpaBneHnn. Combinateur 811-29-31 various rpyunoeoii uerm graduador graduatore tap-changer switchgroup rupting 811-29-29 switchgroup combinatore a comando diretto (di potenza) handbediende hoofdstroomschakelwals nastawnik pojazdowy kontroller vehicles. ynpaBneHea 811-29-28 power controlador which or may be pneumatic, electro- electric. c cepaonpaeonom ynpaBnneMbIn cepBonpnBoAoM, WIeKTpOnHeBMaTWIeCKIIM, AJIII JJIeKTpWIeCKIIM. KoTopbIn rIIApaBnWIeCKIIM, combinador de motor Schaltwerksantrieb combinatore a comando indiretto servo-bediende schakelaarbatterij nastawnik o nappdzie silnikowym motormanijvrerad apparatutrustning 50(811) 0 IEC 811-29-32 combinateur à tambour Combinateur cylindre 129 - dont les contacts isolé, contre laquelle mobiles sont disposés s’appuient les contacts sur la surface Walzenschaltwerk combinador de tambor combinatore a tamburo wals nastawnik walcowy valskontroller d’un fixes. drum controller A switchgroup in which the moving contacts are arranged an insulated drum against which the fixed contacts bear. on the surface of 6apa6aHHblii I-pyIIIIOHOtiIIepeKJIKWaTeJIb rpyuuOBOti Ha 811-29-33 IIepeKnIWIaTenb, IIOBepXHOCTEI onaparorca na uero. combinateur à cames Combinateur IIOABIGXHbIe H3OnPIpOBaHHOrO constitué KOHTaKTbI uIUIIIHApa, par des contacteurs a KOTOpOrO pa3MeIIIeHbI H’.%IOABMX(HbIe ou des rupteurs KOHTaKTbI manoeuvrés par des cames. cam group A switchgroup formed uyaauuoebuÏ rpynnosou rpyuuOBOfi yIIpaBn5IIOTCFI combinateur or interrupting devices operated by cams. nepeeatouarenb I’IepeKnWIaTenb, KOTOpOrO 811-29-34 of contactors KOHTaKTOp AnI BbIKnIOYaEOmHe yCTpOtiCTBa KynaYKaMH. d’asservissement Combinateur de commande lié mécaniquement à un combinateur de puis- sance pour assurer des asservissements. interlocking switchgroup A control switchgroup interlocking purposes. 6nouupoaorubtii rpyIIuOBOti mechanically rpynnosoir I’pyIIuOBbIM connected to a power switchgroup Verriegelungsschaltwerk combinador de enclavamiento combinatore ausiliario (di bfocco) mechanisch vergrendelde schakelaars nastawnik pomocniczy blokujqcy forreglingsdon for nepeuatosarenb nepeKnIo9aTenb CHnOBbIM Nockenschaltwerk combinador de levas combinatore a camme nokkenwals nastawnik krzywkowy kamkontroller ynpaaneeaa, MexaHHqecKH uepeKnWIaTeneM AnR coeAuHeHHbIfI OCymeCTBneHHR c B3aIiMHOir 6nOKHpOBKM. 811-29-35 combinateur de commande motor-driven A control indirekt angetriebenes Steuerschaltwerk combinador piloto combinatore (con comando) a motore servo-bediende schakelaars nastawnik sterowniczy o napgdzie silnikowym motordriven kontaktor pilote Combinateur manoeuvré par un moteur. controller switchgroup driven by a motor. KOHTpOJUX?p C IlpKBOAOM OT gBKraTenfl nepeKnmo9aTenb rpyIIIIOBOÙ ynpaaneens, IIpMBOAMMbIti B AetiCTBIIe AamaTeneM. 811-29-36 manipulateur Combinateur cule moteur manuel de commande des équipements de traction d’un véhiou de plusieurs véhicules fonctionnant en unités multiples. master controller A manually traction operated equipment uourponaep one or nepeKmo9aTenb rIpeAHa3Ha’IeHHbIü UJIM pa6oraromnx used for controlling more motor vehicles the operation working in of the multiple. Mamnuncra rpyI’IuOBOii OAHOti switchgroup on An5I HeCKOnbKUX I’IO CACTeMe ynpaaneens yIIpaBneHW4 pa6oroi TIIrOBbIX MHOrIIX eAEiHH9. eALIIIHHII c pyYHbIM TIIrOBOrO IIpEIBOAOM, 060pyAOBaHHs IIOABIGKHOrO COCTaBa, Fahr-Steuerschalter manipulador manipolatore rijcontroller nastawnik pojazdowy korkontroller reczny centralny 811-29-37 commutateur commutateur 50(811) 0 CE1 de régime de tvne de courant Combinateur destiné des auxiliaires, moteur 130 Betriebsartumschalter/ Stromartumschalter à modifier lorsque les connexions le genre de courant des circuits de puissance d’alimentation d’un et véhicule change. system changeover A switchgroup de régimen combinatore d’alimentazione groeperingsschakelaars przelqcznik pojazdowy systemu systemomkopplare zasilania switch for altering the connections circuits when the type of power nepeeamrarenb conmutador supply of the power to a motor circuits and auxiliary vehicle changes. A~H neyx cncreM nnrauua rpynnoaoti nepeKnwIaTenb Ann U3MeHeHuII COeAuHeHuii CunOBbIX u BC"OMOraTCnbHbIX~C~Cii~puu3MeHeHUUTu"auCTO~HuK~"uTaHu~TR~OBO~ CAUHUUbI 811-29-38 "OABIGKHOrO commutateur COCTaBa. traction-freinage Combinateur destiné à modifier les connexions du circuit de puissance pour passer du régime de traction à celui de freinage électrique et inversement. power/brake changeover A switchgroup from motoring for altering the connections of power to electric braking and vice versa. nepeunmrarenb rpyIIIIOB0~ switch Fahr-Bremsumschalter conmutador traccion-frenado combinatore marcia-frenatura rijremgroeperingsschakelaars przestawnik trakcja-hamowanie fart-bromsomkopplare circuits when changing peacnMos rflrn n ropruoîKeunn nepeKnm4aTenb npu nepexnro9emiu Anar u3MeIiems coeAuHeHuH c pexoiïvra Taru 8 pemm4 cunoBbIx 3neKTpmecKoro ueneii TopMo~eIim 14 HaO6OpOT. 811-29-39 commande auxiliaire à main Handbetatigter Dispositif de secours manoeuvré à la main servant à actionner normalement mû par un moteur. un combinateur standby hand control A device to allow hand operation of a switchgroup normally operated contra’ auxiliar Hilfssteuerschalter manua comando manuale ausiliario noodhandbesturingsschakelaars sterowanie (nastawnika) pomocnicze manuel1 reservmamiverutrustning by a motor. ecnoh4orareabuoe pyuuoe ynpasneune Y~~p0ii~~~0,n03Bonl1~31l1eeocy~ecTBn~Tbpy~HoeynpaBneHuerpynnoBbIM nepeKnIo9aTeneM,06bI4HO 811-29-40 tableau ynpasnneMbIw 0~A~uraTem. d’enclenchement Schalttabelle Tableau ou schéma montrant l’ordre dans lequel fonctionnent coupure d’un équipement de commande. les appareils de sequence chart A table or chart showing the order in which the switches of a control system operate. ra6nnua 3aMblKaHUïi Ta6nuua Cpa6aTbIBaCT unu cxeMa, noKa3bmamwas-I KOMMyTaWiOHHan a”IIa’XlTypa B KaKoH B CACTCMC nocneAosaTenbHocTu y"paBJIeHUSI. esquema secuencial sequenza schakelvolgordetabel tablica kolejnosci Iqczel kopplingsschema qczne 00003 - 50(811) 0 IEC 131 - SECTION~~-30-ÉQUIPEMENTSDE SECTIONSll-30 COMMANDE - CONTROLEQUIPMENT PA3,?JEJI811-30-AI-II-IAPATYPAYIIPABJIEHM5I 811-30-01 équipement automatique de traction Equipement dans lequel le démarrage et, éventuellement, d’autres de l’équipement sont ou peuvent être réglés automatiquement. automatic An fonctions traction control equipment equipment equipment in which starting and, are or cari be automatically if required, other functions of the regulated. automatische Fahrzeug-Steuerungseinrichtung equipo automatico de traction equipaggiamento (di trazione) a comando automatico automatische treinbesturingsapparatuur zestaw (pojazdowy) sterowania samoczynnego trakcjq automatisk manovrerad drivutrustning o60pyBonaBneaBTOMaTareCKOrOynpaBaeHUHTHrOïI npu KOTOPOM 3alIyCK perynupymxa onepauua, O6OpyAOBaHUe, U npyrue nOKOMOTUBa, a B HeKOTOPbIX CJIYWHX perynupoaarbca MO~~T unu aBTOMaTuYCCKU. 811-30-02 équipement à contrôleur Equipement de traction, dans lequel circuit de puissance sont directement manoeuvré à la main. directly controlled Traction effected les changements de connexions du effectués au moyen d’un contrôleur equipment equipment in which changes in the power circuit connections directly by means of a manually-operated controller. are Direktsteuerung (Fahrschaltersteuerung) equipo de controlador equipaggiamento (di trazione) a comando diretto handbesturingsapparatuur zestaw sterowania bezposredniego direktmanovrerad utrustning 060pyBOBaBUe HenocpeBcTBeHHoro ynpasneeefl Taronoe 060py~or3amie, OCyIUeCTBZWICTC54 811-30-03 équipement npu ~0~0p0M He"OCpeACTBCHH0 u3MeHeHue B cxerae KOHTpOnnepOM Traction effected uenu y"paBneHUR. à contacteurs Equipement de traction, dans lequel les changements circuit de puissance sont effectués par des contacteurs. contactor canoaoü P,'YHOTO de connexions du circuit connections are equipment equipment in which the changes in the power by means of contactors. Schaltausriistung equipo de contactores equipaggiamento a contattori schakelapparatuur zestaw sterowania stycznikowego kontaktorutrustning KOHTaKTOpHOe 06opyJV3aaHHe Taroaoe 811-30-04 npu KOTOP~M 060pyAOBaHue, OCYLIleCTBnRIOTCII équipement C "OMOIIIbfO à contacteurs Equipement individuelle. nepemwiem~ B cxerae cunoeoü uenu KOHTaKTOPOB. individuels à contacteurs ne comportant que des contacteurs Einzelschiitzsteuerung equipo de contactores individuales equipaggiamento a contattori singoli separaat bediende schakelaars zestaw sterowania indywidualnego individuellt maniivrerade kontaktorer à commande individual contactor equipment unit switch equipment A contactor equipment consisting solely of independently controlled con- tactors. o60pyBOBaHUeCUH~UBU~yanbHOynpaBJlBeMblMU KOHTaKTOPHOC UHAUBUAyWIbHO 811-30-05 équipement Equipement 06OpyAOBaHUe, y"paBn5IeMbIX KOHTaKTOpaMA UCKnIOYUTCJIbHO cocronmee 113 KOHTâKTOPOB. à arbre à cames et servomoteur à contacteurs actionnés par un ou plusieurs arbres à cames mus par un servomoteur. motor-driven camshaft equipment A contactor equipment worked position-controlled motor. by one or more camshafts driven by a motorisch angetriebenes Schaltwerk equipo de arbol de levas servomotor equipaggiamento ad alhero a camme a servomotore servo-bediende nokkenwals zestaw o silnikowym wale kurakowym kampadrag 811-30-05 060py~OBaHUe 132 - 50(811) 0 CE1 KyJTa’tKOBblM BaJTOM, npklBOnUMblM c B JTeüCTBWe cepeonswraTeneM KOHTaKTOPHOe HeCKOnbKUX 811-30-06 régulation 06OpyAOBaHU.2, KynaYKOBbIX AeüCTBylOWCC2 C par variation “OMOUIbH3 OAHOTO UJIM cepeo~surareneM. Ba,IOB,ynpaBnaeMbIx de tension Procédé de régulation de la vitesse des moteurs dans lequel on fait varier la tension appliquée à ceux-ci au moyen d’une génératrice, d’un transformateur ou d’un convertisseur électronique fournissant une tension de sortie variable. variable voltage control Spannungssteuerung regulacion por variation de tension regolazione di tensione sPanntngssturtng regulacja napigciowa spanningsstyrd hastighetsreglering I A method of speed control in which the voltage applied to the motors is varied by means of a generator, transformer or electronic power convertor supplying a variable output ynpasaettue MeTOA voltage. uepeMeKubtM KanpflmeuweM y"paBneHuH CKOpOCTbIO, rianpffwtenue ABuraTenaM TpaHC@OpMaTOpa nonaromero 811-30-07 régulation unu Ilpu KOTOpOM U3Mt?HR’ZTCII C 3neKTpOHHOrO nepeMemioe abrxonnoe IIpUKnaAbIBaeMOe cunoaoro K reaeparopa, “OMOlUbIO npeo6pa30BaTens, HanpaHtemie. par la fréquence Frequenzregelung Procédé de régulation de la vitesse des moteurs permettant d’obtenir plusieurs vitesses ou une gamme continue de vitesses, en agissant sur la fréquence du courant regulacion regolazione d' frequenza frequentiesturing regulacja czqstotliwosciowa frekvensstyrd hastighetsreglering d'alimentation. frequency P°F la frecuencia control A method of controlling motor speed enabling several speeds, or a continuous range of speeds, to be obtained by varying the supply frequency. pWj’JllipOBaHUe U3MeHl?HUeMWICTOTM perynuposauua MeTOA "OJIyWITb "yTeM 811-30-08 HeCKOnbKO U3MeHeHUa régulation CKOPOCTH CKOpOCTeti YaCTOTbI par changement varier le pole-changing A method of motors 6onee 811-30-09 de d’obtenir au moins deux vitesses, avec un de moteurs fonctionnant en parallèle, en pôles. control u3MeKeKueM utuxa HJIU rpynn CKOpOCTeü régulation CKopocTu) du nombre de pôles ABuraTeneü, U3MeHCHUCM wcna nonywïTb pa6oTaIomux OT MHoro@a3Horo napannenbao, ABe UnU nonIocoB. rhéostatique Widerstandssteuerung Procédé de réglage du courant de démarrage de moteurs électriques consistant en l’emploi de résistances variables en série avec les induits des moteurs. resistance rheostatic regulacion motors by using peocTaTuoe peryaaposaswe perynupoaaaun ucnonb30aaHueM perynupyeMbrx nycKoBoro nocneAoaaTenbH0 pesucropoa. TOKa BKnwIeHHbIx 3neKTpoABuraTeneü c IIKOPRMU ABuraTeneYi reostatica regolazione reostatica weerstandssturing regulacja rezystorowa motstandsstyrd hastighetsreglering control control A method of controlling the starting current of electric variable resistors in series with the motor armatures. MeTOA Steuerung durch Polumschaltung regulacion por cambio de numero de polos regolazione per variazione del numero di poli noolomschakeling regulacja przez zmianq biegunow hastighetsreglering genom polomkoppling nomtocon no3eonffIomuü perynupoBaHu5I, ABuraTena no3BonnIomuU u3McHeHUe of obtaining two or more speeds from a polyphase motor, or group working in parallel, by changing the number of poles. peryanpoeaewe MeTOA nombre ABuraTena, HeI'IpcpbIBHOe B ‘%TU. Procédé de régulation permettant moteur polyphasé ou un groupe faisant apameaas (UnH c - 50(811) 0 IEC 811-30-10 régulation à transformateur 133 Steuerung mit Zusatztransformatoren regulacion por transformador auxiliar regolazione con trasformatore ausiliario (serie) sturing met regeltransformator regulacja transformatorem pomocniczym auxiliaire Procédé de réglage de la tension fournie aux moteurs employant un transformateur survolteur-dévolteur en série avec le transformateur principal. auxiliary transformer A method regulation of varying transformer the voltage supplied to the motors reglering med tillsatslindning using a buck-boost in series with the main transformer. peryaupoeaeue HanpmxeHufl (pelJ’JlupOBO’lliblM) JluHel%HblM TpaHC@OpMaTOpOM perynupoBaHan MeTOn peQUIApOBO9HbIti TJIaBHbIM 811-30-11 Procédé un KOTOPOM nPu BKJHOOYaeTCR JIAHeiiHbIti IIOCJIeAOBaTenbHo c TpaHC$IOpMaTOpOM. régulation par HanpmKeHm, TpaHC(,OpMaTOp par hacheur de réglage de la tension d’alimentation des moteurs à courant continu hacheur. chopper control A method of controlling the voltage supplied to d.c. motors by using Steuerung mit Gleichstromsteller regu’acion par troceado regolazione a frazionatore choppersturing regulacja przetwornikiem impulsowym copperreglering a chopper. peryneposauae Meron IIOCTORHHOTO 811-30-12 uanpmueHufl perynuposamia régulation Procédé TOKa,C nMnynbcHblM npeo6pa30nareaeM HanpaxteHan, IIOMOIJJLH) noAaBaeMor0 PiMIIyJlbCHOrO na LmnraTenn IIpeO6pa30BaTemI. de tension par réglage de phase de réglage utilise le réglage de la tension d’alimentation des moteurs, dans lequel on de phase d’un convertisseur. voltage phase control A method control of controlling ofa the voltage supplied to the motors Anschnittsteuerung regulacion de tension por control de fase regolazione di fase fasesturing ; faseaansnijding regulacja napigciowa fazowa fasspanningsreglering by using phase convertor. rba30noe peryseposaewe MeTOn perynuposamia U3MeHeHPfR 811-30-13 régulation Procédé faisant @aJbI de la tension sur le côté haute tension A method Ha ,amfraTenu, nyTeM d’alimentation des moteurs de traction se du transformateur. regulation of controlling on the high-voltage cra6u~usauua the voltage supplied to the traction motors effected BbICOKOrOHanpflxceHufl HanpsXeHua, BbICOKOTO nonaBaeMor0 Ha TmoBbre ABaraTena, HaIIp%KeHHSITpaHC@OpMaTOpa. régulation par la basse tension Procédé de réglage de la tension d’alimentation des moteurs faisant sur le côté basse tension du transformateur. low-voltage A method on the low-voltage MeTOn Ha se supplied to the traction motors effected side of the transformer. unzuoro HanpmueHnfl HanpaXeHns, HH3KOT0 Niederspannungssteuerung regulacion por la baja tension regolazione (di tensione) lato bassa tensione laagspanningsregeling regulacja niskonapigciowa IAspSnningsreglering the voltage perynupoBaHun CTOpOHe de traction regulation of controlling cra6anusaunH Hochspannungssteuerung regulacion por la alta tension regolazione (di tensione) lato alta tensione hoogspaningsregeling regulacja wysokonapieciowa hogspanningsreglering side of the transformer. perynnpoBaHna HaCTOpOHe 811-30-14 nonaBaeMor0 par la haute tension de réglage high-voltage Me-ron HanpxHtennn, npeO6pa30BaTeJUI. HaIIpS-IHteHHX nonanaeMor0 TpaH‘X,,OpMaTOpa. Ha TxroBbte ABuraTenu 811-30-15 134- 50(811) 0 CE1 kontinuierliche réglage continu Réglage fin et sans sauts d’une grandeur traction) éliminant les valeurs (tension, courant, vitesse, effort de de pointe. continuous control notchless control Fine and uninterrupted controlofa effort) eliminating notching peaks. quantity(voltage, regu’acion Steuerung continua regolazione continua continu variabele regeling regulacja ptynna steglos reglering current,speed,tractive nenpepbmuoe perynnposauae nnaanoe perynapoeauue Towoe li HeIIpepbIBHOe CKOpOCTH,TSIrOBOI-0 811-30-16 couplage BeJIAYEIHbI IICKJIKJYeHWI (HaIIpSIXeHHR, nMKOBbIX TOKa, 3HaYeHHii. Gruppenschaltung (des moteurs) Méthode ment peryJIHpOBaHHe yCIUIWI)IIyTeM de régulation ou par groupes de vitesse réalisée déjà constitués, en connectant en série, des moteurs en série séparé- parallèle ou en parallèle. der Fahrmotoren acoPlamiento (de motores) connessione o combinazione motorgroepering grupowanie silnikow motorgruppering (dei motori) (motor) combination A method permanent of speed regulation effected by connecting groups, in series, series-parallel or parallel. coeAnueuae C~OCO~ 811-30-17 motors, singly or as unnrareneii ,rnuirareneti COeAPIHeHHR IIpOH3BOAPITb HX napannenbaoe coe~mtenne unri rpynn naarareneii, noaaonnmmun IIOCJIeAOBaTeJIbHO-rIapaJIJIeJIbHOe IIOCJIeAOBaTeJIbHOe, 11xnonb3yeMbIB AJff perynnponanus II CKOPO~TII. Umschaltvorgang transition Passage d’un couplage à un autre, from one combination sans coupure totale des courants des moteurs. transition Passage motor to another without total interruption transicion transizione overgang przeraczanie silnikow Gverkoppling of the current. nepexon ffepexon C OAHOrO BblK,IRYIeHIIR 811-30-18 transition transition transition Transition TOKa COeAllHeHIIII ABPiraTeAeG K ApyrOMy 6e3 uoJIHoro ABEIraTeJIa. par dérivation par shunt par court-circuit pendant laquelle circuit un certain nombre dans les autres moteurs. une dérivation de moteurs, est utilisée pendant pour que le courant maintenir en est supprimé shunt transition short circuit transition Transition during which a shunt connection is used to maintain a number motors in circuit whilst the current to the other motors is tut off. of n‘?peXOp. M‘?TOAOM“IyHTUpOBaHUfl ,,‘Zp‘?XO,IIM‘?TOJ,OMKOpOTKOrO3aMblKaHlWï BpeM5, KOTOpOrO nepeXOA,BO CCOXpaHeHPIeM OCTaAbHbIX B3TOii ABHraTeAeti npOM3BOAATCR myHTI4pOBaHIIeCIUIOBOti ueIIEIHeCKOJIbKAXABHraTeJIerï,BTOBpeM5IKaKBIIeIIH TOK BbIKJIIOYaeTCII. IIeIIti Nebenschlugumschaltung transicion por derivacion ; transicion cortocircuito transizione in corto circuit0 ..... przelaczanie bocznikowane shuntijverkoppling por 50(811) 0 IEC 811-30-19 transition 135 - par pont Transition comportant les deux phases caractéristiques 1) Mise en parallèle, avec chaque moteur ou groupe égales, de telle façon que la ou les connexions «ponts», soient parcourues par la différence suivantes Brückenschaltung transition por puente transizione a ponte : de moteurs, de résistances entre moteurs, appelées entre le courant dans les moteurs hrugovergang prxe@xauie mostkowe brygg&erkoppling et celui des résistances. 2) Coupure du ou des ponts. bridge transition Transition comprising the two following characteristic phases : 1) Placing in parallel with each motor or motor group a resistor of equal value in such a way that the connection(s) between motors, termed “bridge connection(s)” carry the difference between the currents in the motors and in the resistors. 2) Opening the bridge connection(s). no MOCTOBO~cxeMe nepexon flepexon, coc~onm~~ii 143cnenyronmx AB~X @as: f. IloncoeAmeme napannenbao K KaxnoMy ImmaTenm mm rpynne ABHTaTeJIefi OAnHaKOBbIX pe3uCTOpOB TaKHM o6pa3oM, YTO COeAFlHeHHeAJIH coennHeHm4 nsnraTeneii no TaK na3bIBaeMoB “MOCTOBOEI cxeMe (cxeMaM)” 06TeKaIOTG-I pa3uocTbm T~K~B B uenax ,Iuun-a-renen u pe3ncTopon. 2. Pa3MbIKaHne 811-30-20 transition MOCTOBOIO COeAAHeHIISI (COeAIIHeHIIn). par pont équilibré Transition par pont, dans laquelle et dans les résistances est réduite balanced Bridge la différence des courants dans les moteurs au minimum avant la coupure des ponts. bridge transition transition in which the difference between and in the resistors is reduced connections. to a minimum c6anancaposauubrk no MOCTOBO~cxeme nepexoa the currents in the motors before the opening Brückenschaltung im abgeglichenen Zustand transicion por puente equilibrado transizione a ponte equilibrato gebalanceerde brugovergang przefqczanie mostkowe zrownowaione ~verkoppllng medelst halanserad hrygga of the bridge flepexon no MOCTOBOÜ cxeMe, B K~TOPOM pa3HocTb TOKOB B nenax ABPIï-aTeneii A pe3IICTOpOB nepen pa3MbIKaHneM MOCTOBMX COeJIIIHeHIIti CHIGKaeTCII AO MMHnMyMa. 811-30-21 affaiblissement de champ par dérivation Système d’affaiblissement de champ, dans lequel le nombre de spires de bobines inductrices restant inchangé, le réglage du champ est obtenu par dérivation d’une partie du courant total. field shunting Feldschwtichung durch Parellelwiderstand debilitamiento de campo por derivacion indebolimento di campo con derivatore veldverzwakking door stroomverlaging bocznikowanie wzbudzenia ftiltfijrsvagning genom shuntning A method of field weakening in which lïeld regulation is effected by diverting a portion of the total tïeld current without making any change in the number of field turns. ocra6sreuee MeTOn nonfl nyTeM UlYHTWPOBBHAR 06MOTKW BO36yXCAeHtlfl ocna6neaus nons, B KOT~P~M perynnpoeaune IIyTeM OTBOAa YaCTII o6mero BO36yXAeHUK. 811-30-22 affaiblissement de champ par variation Système d’affaiblissement ment inchangé, le réglage nom TOKa 6e3 A3MeHeHEnI WIcna npou3BofiuTcK BHTKOB 06MOTKu du nombre de spires de champ, dans lequel le courant restant sensibledu champ est obtenu par variation du nombre de spires utilisées. field (weakening A method by varying current. by) tapping of field-weakening the number in which regulation of turns in circuit of field strength without appreciably is effected varying the Feldschwachung durch Anzapfung debilitamiento de campo por variacion del nhmero de espiras indebolimento di campo con variazione (del numero) _ di srire _ veldverzwakking door minder windingen osfabianie wzbudzenia zaczepowe faltfersvaguiug genom lindningsomkoppling 811-30-22 ocaabaeene nona CeHunoHHpoBaHtreM O~MOTICU B036yîHAeHIm ocna6nennfl MeTOn u3MeHeHUB sement 06MOTKU nom npon3aonuTCa 6e3 BO36yxAeHUH 3aMeTHOr0 de champ mixte dans lequel de champ combined on utilise successivement par dérivation ou simultanément et par variation du nombre l’affaiblis- de spires. field-weakening A field-weakening ively perynaposanne B ~0~0p0M BIITKOB TOKa. affaiblissement Système nom, sicna u3MeHeHueM 811-30-23 50(811) 0 CE1 136 - system in which shunting and tapping are used success- gemischte Feldschwachung debilitamiento de campo mixto indebolimento di campo misto (gecombineerde) veldverzwakking osfabienie wzbudzenia mieszane kombinerad faltforsvagning or simultaneously. cMemaHHafl cncTeMa ocna6neHafl ocna6nemia CUCTeMa 06MOTKU IIOnR,B nonn KOTOpOI? UlyHTupOBaHUeU CeKllUOHUpOBaHUe IIOCJIeAOBaTeJIbHO OCyIIleCTBnReTC5I B036yXAeHUSI unu OAHOBpeMeHHO. 811-30-24 shuntage des pôles auxiliaires Système de shuntage destiné à donner champ de commutation. auxiliary et la phase convenables UlyHTHpOHaHHC CUCTeMa a suitable 06MoTKli value and phase to the commutating ,!JOllOJlHliTCJlbHblX ".,yHTUpOBaHUR COOTBeTCTByIOIJJeii 06MOTKH, BenUYuHbI U @a3 field. C KOMMyTUpyIOLUerO UenbEO C03AaHuR IIOJIR. finesse de réglage notching that existing CTClleHb d’un ratio The ratio of the tractive effort immediately produced before immediately after taking a notch to Ungleichfihmigkeit finura de regulacion finezza di regolazione aanzetkoppelsprong bij schakelen stopieh pfynnosci regulacji dragkraftskvot vid uppkoppling it was taken. IlJTaBHOCTU petyJTWpOBaHHa OTHOIHeHUe MeXAy perynupoaaaurr CUnOk u cunoti TRru Tmuno Haqana HeIIOCpeACTBeHHO IIOCne HaYana perynupoBamvi. progression de l’équipement avance de l’équipement Sens de fonctionnement progression The Wendepolbeschaltung (Nebenwiderstand) shuntado de polos auxiliares derivazione dei poli ausiliari hulppoolveldverzwakking bocznikowanie biegunow komutacyjnych shuntning av kommuteringslindning IIOJIIOCOB IIpUMeHffeMafl Rapport de l’effort de traction exercé immédiatement après le passage cran à celui qui s’exerçait immédiatement avant ce passage. 811-30-26 au pole shunting A shunt system giving 811-30-25 la grandeur correspondant à la progression du manipulateur. of equipment direction of operation corresponding to the notching up of the master Auf-Steuerung der Schaltausriistung progresion del equipo sequenza diretta (dell’equipaggiamento) het opschakelen kierunek przehtczen nastawnika do przodu uppkoppling controller. upfl~oir XOA annapaTa HaIIpaBneHue KoHTponnepa 811-30-27 nekcrsus annapara, orae9atomee nnuaenmo snepen MamïwicTa. régression de l’équipement recul de l’équipement Sens de fonctionnement run-back correspondant à la régression du manipulateur. of equipment The direction controller. of operation corresponding to the notching back of the master 06paTHbtü XOA annapaTa HaIIpaBneHue AeilCTBuX KoHTponnepaMamuuucTa. annapara, 0TaeYammee ~au~emno Hasan Ab-Steuerung der Schaltausrüstung regresion del equipo sequenza inversa (dell’equipaggiamento) het terugschakelen kierunek przelqczen nastawnika wstecz nedkoppling 50(811) 0 IEC 811-30-28 - 137 - cran de marche Une Fahrstufe des différentes marche positions (manipulateur, où peut se trouver combinateur, un système de réglage de etc.). notch step One of the different positions a traction switchgroup, etc.) cari take up. nosuuan OAHO system (master posizione di marcia stap pozycja jazdy kopplingsliige controller, uourpojrnepa U3 MHO~eCTBaIIOnO~eHuu Mamumicra, 811-30-29 control muesca rpynnoaoir CuCTeMbIyIIpaBneHUnTnrOii(KOHTpOnnep nepeKnwIaTenb u T.n.). relais d’accélération Beschleunigungsrelais Relais ajustable contrôlant le courant de démarrage en vue de régler l’accélération du véhicule. des moteurs de traction, accelerating relay notching relay An adjustable regulate relay controlling the acceleration the starting current of the traction motors relé de aceleracion relè d’accelerazione begrenzingsrelais przekainik samoczynnego rozruchu accelerationsrehi ; kopplingsrelii to of the vehicle. pene ycuopeuufl pene pyunoro nycua Pene c perynnpyeMon IIyCKOBOrO TOKa IIOABIGKHOrO 811-30-30 pa6oreü B IIeIIRX ucnonbsyeMon TOYKO~, TSI-OBbIX ABUI-aTeneii nnn perynuposaeua B IIepUOA pa3rOHa eAuHuIIb1 COCTaBa. asservissement(s) elektrische électrique(s) Contacts auxiliaires actionnés par les appareils commandés et réagissant sur le circuit de commande, afin que ceux-ci fonctionnent correctement, de la façon et dans l’ordre electrical prévus. interlocks Auxiliary contacts operated by the controlled apparatus and reacting upon the control circuit to ensure the equipment operates safely and in the required Verriegelung enclaviamento eléctrico asservimento (i) elettrico (i) ; blocco(blocchi) elettrico(i) elektrische vergrendeling blokady elektryczne uzaleiniajqce elektriska forreglingar mannerorsequence. sneurpauecuae 6~10unp0~uu BCIIOMOraTenbHbIe ynpanneaurr HaAexHOti 811-30-31 u KOHTaKTbI, IIpUBOAUMbIe BosAeticTByIomue pa6OTbI Ha 060pyAOBaHWI B IIenb AeuCTBue ynpaaneeun B Tpe6yeMOii Ana aIIIIapaTaMu 06ecneseuun IIOCneAOBaTenbHOCTu. (contact de) verrouillage Contact certaines électrique destiné Verriegelung à empêcher le fonctionnement d’un appareil dans conditions. locking contact An electrical contact for preventing under certain conditions. the operation of a piece of apparatus contacto (Verriegelungskontakt) de bloqueo (contatto di) blocco vergrendelcontact zes&k blokujqcy blockeringskontakt 6JIOK-XOHTafCT 3neKTpuYeCKUfi 0TAenbHbIx 811-30-32 KOHTaKT, y3noB UCIIOnbJyeMbIii annapaTypbI Ann B 0npeAeneaabIx IIpeAOTBpameHIGI pa6OTbI ycnosuax. organe de commande Steuerausrüstung Organe intervenant dans le circuit de commande : combinateur de commande ou manipulateur, interrupteur et bouton-poussoir, sectionneur, combinateur pilote, asservissement, relais de commande, électrovalve, etc. control equipmeut Items used in the control switches and locks, control circuit : control switchgroup or master controllers, push-buttons, disconnectors, motor-driven relays, electro-pneumatic valves, etc. controllers, inter- organe de control organo di comando regelapparatuur aparatura sterownicza utrustning for man6versystem 811-30-32 138 - 50(811) 0 CE1 annapaTypa ynpaaneuufl Ucnonb3yeMbIe YCTpOiiCTBa, nepeKnmUaTenu B BbIKnIoYaTeJIU U KHOnOYHbIe C IIpUBOAOM OT ABUraTeJISI ynpaaneeun uensx unu ynpaanesss BbIKJIIOYaTeJIU ; pa3beAUHUTeAU ; 6JIOKUpOBOYHbIe yCTpOUCTBa ; 3neKTponHeBMaTUSecKUe KnananbI ; ; PeAe YnpaBAeUUa U TU. SECTION 811-31 - AUXILIARY 811-31-01 rpynnoBbIe ; KoUTpoAAepbI SECTION 811-31 - APPAREILS AUXILIAIRES PA3AEJI Sll-31- : MaIIIUHUCTa KOHTpOAAepbI BCIIOMOrATEJIbHOE ET APPAREILS AND PROTECTIVE OBOPYAOBAHHE EQUIPMENT Id 3AqHTHAII lampe ou AIII-IAPATYPA Stellungsrückmelder organe de répétition Contact, DE PROTECTION appareil servant à indiquer, à distance, la d’un position appareil. organe de repeticion (organo) ripetitore afstandssignalering powtarzacz repeater fjarrindikering A contact, lamp equipment. KoUTaKT, nakma yKa3aUua 811-31-02 or equipment unu used for OAHOrO indication npeAHa3HaUeHHbIe annapaT, nonOXeHUa remote 113 BUAOB of AJUI the position of AUCTaHIIUOHHOrO 060pyAOBaUUs. Meldeeinrichtung organe de signalisation Voyant servant trouve ou non automatiques à indiquer, dans ou à distance, la position lampe si chacun ou l’état signalant de des organes prévu, façon considérés par ex. signal générale une se de portes situation anormale. - . .r Organe de sena”zac’on segna’atore storingsmelder wskainik (zgodnoSci poloienia) fjarrindikeringstabla annunciator An indicator showing remotely position state not, or indicating or any of several e.g. whether door each of several items is in the required signal abnormal with automatic doors or lamp conditions. cBrHanbHoe yc~poÀcTn0 YKa3aTeAb, npeAHa3Ha’IeHHbIU HaXOAUTCSI AU KaXAbIU nonoXeUuu Una COCTOIH~~U PaCCMaTpUBaeMbIX UnU UeT, aBTOMaTUYeCKUX yCTpOIkTB0 CUrHaJIU3UpyIomaz4 811-31-03 (441-15-12) AJIR UH$OpMUpOBaHUs U3 0 mo6oii KaK Ha paCCTO5IHUU annapaTOB UanpUMep, pa3ABUXHbIX B Aeepeoe 0 TOM, 3aAaHHOM caraanbaoe UJIU AsepeU naMna, HeUCnpaBHOCTU. SchlieBerkontakt contact à fermeture Contact de principaux lorsque commande de l’appareil ces contacts ou auxiliaire, mécanique qui est fermé de connexion sont lorsque fermés les contacts et qui est ouvert sont ouverts. contacto p” cierre contatto ....< make contact normally open A control or auxiliary mechanical contact switching (deprecated) contact which device is closed are closed when the main contacts and open of the when they are open. 3aMblKalOmltii KOHTaKT HOpManbHO pa30MKHyTbIfi KOHTaKT YIIpaB,UIIOmUii UAU BCnOMOraTeJIbHbIU rnasHbIe KOHTaKTbI KOMMyTUpyIOmerO 3aMKHyTb1, U pa3MbIKaIomUiiCs, KOrAa KOHTaKT, 3aMbIKaIoII&IC~, Mexammecxoro OHM pa30MKHyTbI. KOrAa yc-rpoiicrsa In accordo maakcontact zestyk zwierny 50(811) 0 IEC 811-31-04 (441-15-13) - 139 - contact à ouverture Contact de commande principaux lorsque ou auxiliaire, de l’appareil ces contacts mécanique qui est ouvert de connexion lorsque les contacts sont fermés et qui est fermé sont ouverts. break contact normally closed contact Offnerkontakt contacto de apertura contatto in disaccordo verbreekcontact zestyk rozwierny ..... (deprecated) A control or auxiliary contact which is open when the main contacts of a mechanical switching device are closed and closed when they are open. pa3MbIlWOIUW~ HOPMBJIbHO KOHTBKT 3aMKHYTblü YnpaBJEIKNLWiii rJIaBHbIe BCnOMOTaTeJIbHbIfi KOHTaKTM MeXaHAYeCKOrO 3aMKHyTb1,A 811-31-05 KOHTBKT IUIH KOHTBKT, pa3MbIKWXIWüCII, KOMMyTApylOLUeTO 3aMbIKaIOLWiiCR,KOI-Aa OHII KOrna yCTpOI?CTBa pa30MKHyTbI. Schauzeichen indicador indicatore signalering wskainik optyczny indikeringsdon voyant Palette, cocarde, ou repère quelconque lié au fonctionnement dont il indique la position ou le comportement. d’un appareil indicator A flag, pointer or visual sign of any kind indicating of its associated apparatus. the state or performance yua3aTenb Q>JIaXOK, CTpeJIKa pa6oyee 811-31-06 lUIPi COCTORHBe nro6oii ApyrOti BEïAkIMbIfi 3HaK, yKa3bIBLUOII@i Ha annapaTa. voyant lumineux Lampe jouant indicator Signallampe indicador luminoso indicatore luminoso signaallamp wskainik swietlny indikeringslampa le rôle de voyant. light A lamp used as an indicator. cnrnanbuan naMnouua JIaMnosxa, 811-31-07 ncnonb3yeMafl B KaYecTBe yKa3aTem. lampe témoin Voyant lumineux d’information de fonctionnement Kontrollampe lampara piloto lampada spia lamp normaal bedrijf lampka kontrolna overvakningslampa ; kontrollampa normal. pilot lamp pilot light An indicator light signalling normal operation. KOHTpOJtbHaflJlaMnOYKa CHrHaJIbHaSl 811-31-08 (dispositif JIaMnO9Ka,kiH~OpMHpyEOLIIa5lO HOpMaJIbHOk pa6oTe. d’)homme-mort Sicherheitsfahrschaltung (Totmannknopf) (dispositivo de) hombre-muerto dispositivo di sicurezza (tipo uomo morto) dode-mens bedieningsorgaan czuwak (pasywny) sakerhetsdon Dispositif de sécurité qui doit être actionné de façon continue par le conducteur et qui en cas de défaillance de celui-ci provoque l’arrêt du train. driver% safety device dead-mari’‘’ handle A device which must be used continuously by the driver the train in the event of indisposition on his part. npe6op and which Will stop 6AuTeJlbHOCTU YCTPO~TBO, KOTOpOe CnOCObHOCTA KOTOpMM BbI3bIBaeT AOJIXeH OCTaHOBKy K ynpaBneHmo. nOCTORHH0 noe3na nOJIb30BaTbCX nPn norepe MaIIIEIHHCT MXIIIIHHCTOM II 811-31-09 (604-03-51) 50(811) 0 CE1 140- parafoudre Appareil destiné transitoires à protéger élevées le matériel et à limiter électrique la durée et souvent contre les surtensions l’amplitude du courant de suite. lightning arrester surge diverter surge arrester A device intended overvoltages follow-on to protect apparatus from and frequently high transient the amplitude of the current. 3SlllWTHblé pa3pSIflHMK YCT~O~~CTBO, npeAHa3HaYeHHOe BbICOKHX nepexoAHbIx IIpOAOJI~I(ATeflbHOCTA 811-31-10 the electrical and to limit the duration Uberspannungsableiter pararrayos scaricatore overspanningsafleider odgromnik avledare AJUI 3auWiTbI 3neKTpOO60pyAoBaHHa nepeHanp5oxenkiü H,3a9aCTyFO,aMIIJIHTyAbI TOKa Pi OT 0rpauareHm II0CJleACTBW-I. Uberspannungsschutz parasobretension scaricatore overspanningsbeveiliging ochronnik przepicciowy Gverspanningsskydd parasurtension Condensateur, résistance des surtensions overvoltage non linéaire ou autre dispositif destiné à absorber internes. protector A capacitor, non-linear resistor or other device intended to absorb interna1 overvoltages. YCTPOiiCTBO 3a”,MTbl KOHAeHCaTOp, OT IIepeHanpflxeHAti HelWHeiiHbIti npeAHa3Ha9eHHoeAm 811-31-11 fusible Fusible pe3HcTop cHmKeHm rmu BHyTpeHHHx npyroe yCTpOhCTB0, nepeHanpmHati. Hochspannungssicherung fusible de alta tension fusibile ad alta tensione hoogspanningssmeltveiligheid bezpiecznik wysokiego napiecia hogspiinningss$ikring haute tension destiné à couper un circuit haute tension. high voltage fuse A fuse designed to interrupt BblCOKOBOJTbTHb1i-i a high voltage circuit. np‘?,.,OXpaHFfT‘?JTb npeAoXpaHHTe,Ib, IIpeAHa3Ha9eHHbIti AJIR pa3MbIKaHW7 BbICOKOBOJIbTHOti uem. 811-31-12 relais à maximum Relais de mesure valeur du réglage. overcurrent de courant qui fonctionne relay which setting (operating ~3MepATeJIbHOe npeBbuuaeT operates value) pene Mawwwanbuoro du courant la when the value of the current exceeds the ToKa peJIe, AeiiCTByEOIUee, ycTaBKy(pa6oree KOrAa 3HaYeHlle TOKa 3HaWiTeflbHO 3HaqeHYie)pene. de tension Relais de mesure qui fonctionne valeur de réglage. lorsque la valeur de la tension dépasse la relay A measuring relay which operates when the value of the voltage setting (operating value) of the relay. pene MawuManbHoro 113MepnTenbHoe 3HawïTenbHo dépasse of the relay. relais à maximum overvoltage la valeur relay A measuring 811-31-13 lorsque Uberstromrelais relé de maxima intensidad relè di massima (corrente) overstroomrelais ; maximaal przekainik nadprqdowy Sverstrijmsrela Hanpmxeaufl pene, npenbuuaer exceeds AeticTBymnee, ycTaBKy(pa609ee KorAa 3HaseHne 3HaseHPie)pene. HanpmeHm the Uberspannungsschutz relé de maxima tension relè di massima tensione maximaal spanningsrelais przekainik nadnapiqciowy Sverspiinningsrelii stroomrelais 50(811) 0 IEC 811-31-14 - 141 - relais à tension nulle Relais qui fonctionne lorsque la tension d’un circuit électrique Nullspannungsrelais relé de tension nula relè di tensione nulla nulspanningsrelais przekainik napiecia zerowego nollsp%ningrelii fait défaut. no-volt relay A relay which operates when the voltage of an electric circuit is lost. pene HyJresoro HanpflweHan Pene, neiicTaymmee, 811-31-15 corna nanpaxtemie B 3neKTpwIecKoti qem paaao ~ymo. relais de mise à la terre Relais qui fonctionne dans l’équipement Erdstromrelais lorsqu’un défaut d’isolement vers la terre se produit relé de Puesta a tierra ou les circuits protégés. earth fault relay A relay which equipment operates when a failure of insulation to earth is detected in the relè di terra aardfoutrelais przekainik ziemnozwarciowy jordfelsrela or circuits protected. peae 383eMnentrfl Pene, AeticTBymmee, 06HapymïBaeTc~ 811-31-16 corna npo6o8 B 06opynoBaam lim 3auunuaeMbIx uennx II~O~I&~H. relais différentiel Differentialrelais Relais de mesure comportant deux enroulements connectés dans des parties différentes d’un circuit, de telle façon que le relais fonctionne si la différence entre les courants des deux circuits dépasse une valeur spécifiée. relé diferencia’ relè differenziale differential relay differentiaalrelais przekainik r&nicowy differentialrela A measuring relay having two windings SO connected in different parts of a circuit that the relay Will operate if the difference between the currents in the two circuits exceeds a specitïed value. nu#+epeHuuaabHoe M3MepHTenbHOe YaCTRX UenA 3HaseHPIti peae pe,Ie TaKIIM TOKa C HByMR o6pa3oM, BAByXTOYKaX OGMOTKaMII, YTO peJIe UenEi BK,IEOYeHHbIMH AetiCTByeT, JIHIlIb B pa3JIMYHbIX KOrAa npeBbIIUaeTyCTaHOBJIeHHyKJ SECTION 811-32 - CAPTAGE pa3HOCTb BeJIHWIHy. DU COURANT SECTION 811-32 - CURRENT COLLECTION PA3AEJI 811-32 - TOKOC%ËM 811-32-01 appareil de prise de courant Appareil porté par le véhicule le rail de contact. et destiné à capter le courant sur le fil ou sur current collecter Equipment fitted to the vehicle wire or conductor and intended to collect current from a contact Stromabnehmer aparato de toma de corriente presa di corrente stroomafnemer odbierak pqdu strijmvtagare rail. ToKonpaeMkluK YCT~O~~CTBO, ycTaHaBmBaeMoe npenua3uaYaeMoe KOHTaKTHOTO 811-32-02 nnff Ha c-behla eABHEïUe ToKa C nOABIl?KHOrO KOHTBKTHOTO COCTaBa npOBOAa a rani peJlbCa. pantographe Appareil de prise système articulé de pantographe. de courant sur le ou les fils de contact, prévu pour permettre une translation constitué verticale par un de la semelle pantograph Apparatus for collecting a hinged device designed current from one or more contact wires, formed of to allow vertical movement of the pantograph head. Scheren- oder Einholmstromabnehmer pantografo (presa di corrente a) pantografo pantograaf pantograf ; odbierak noiycowy stromavtagare for kontaktledning 811-32-02 naaTorpa<P YcT~o~~cTBo,~I~~~FI~~H~~~HH~~LuIsI KOHTaKTHbIX npOBOAOB c5eMa II BblnOnHeHHOe seprnxanbuoe 06ecnewBaIoutero 811-32-03 50(811) 0 CE1 142- ToKa B BHAe nepeMemeane c onHor0 um HecKonbKnx LIIapHHpHoro MeXaHA3Ma, nonosa. Bügelstromabnehmer arc0 (1) archetto boveuwip glowica pantografu archet (1) Ensemble de la semelle et ressorts. d’un pantographe avec, s’il y a lieu, les articulations ..... A pantograph pan, with pivots %wbygel and Springs, if necessary. ..... nOnO3 naHTOrpa@a, 06OpyJlOBaHHbIii npH HeO6XOLWIMOCTH UlapHPipaMH Ii npywIHaMH. 811-32-04 archet (2) Dans le cas des tramways, ensemble de l’appareil de prise de courant sur ligne aérienne articulé autour d’un axe transversal à la voie. bow In tramways, an overhead sely to the track. current collecter hinged Biigelstromabnehmer arc0 (2) presa (di corrente) ad archetto sleepbeugel kabfqk kontaktbygel on an axis placed transver- wra mapmipaMn 811-32-05 TpaMBafiHbIX yCTpOtiCTB0 TOKOCE.eMHOe Ha OCII nepneHmKynnpH0 BarOHOB, 3aKpenneHHoe nyTM. semelle de pantographe Ensemble constitué dans un pantographe par les pièces frottantes et leur monture. pantograph pantograph head pan Pantograph no103 equipment comprising the wearing Stromabnehmerwippe cabeza de pantografo ; mesilla (de pantografo) portastriscianti (dell’archetto) schuitje Slizgacz listwowy toppstycke till strtimavtagare strips and their mountings. naeTorpa*a YCTPO~~CTBO, cocTomuee 113 KoHTaKTHbIx HaKnanoK Ii neTanel ma IIX KpenneHua. 811-32-06 bandes de frottement bandes d’usure Parties remplaçables contact. de la semelle de pantographe, en contact avec le fil de contact strips wearing strips The replaceable KOHTaKTHbIe CMeHHbIe parts of the pantograph Schleifstiicke bandas de frotamiento ; platinas frotamiento strisciante slijtstrip van pantograaf nakfadki stykowe slitskenor head in contact with the contact wire. HaKKWKH neTank nono3a naHTorpa@a, conpYiKacaIoImecs3 c KoHTaKTHbIM IIPOBOAOM. 811-32-07 corne Extrémité de la semelle de pantographe recourbée horn The down-turned end of the pantograph par %rHyTbIii BH113 KOHeII nonosa naHTorpa@a. head. vers le bas. Auflaufhorn cuerno corno oploopstuk ; hoorn wt\s 3lizgacza Gdhorn de - 50(811) 0 IEC 811-32-08 143 Stangenstromabnehemer trolley Appareil de prise de courant par une cuillère de contact sur un fil de contact par une roulette montée sur une perche mobile à gorge ou en tous sens. trolley trole presa (di corrente) ad asta trolley odbierak drqikowy stromavtagare fi5r tràdbuss Apparatus for collecting current from a contact wire by means of a grooved wheel or contact slipper mounted on a pole which is movable in any direction. IJITZIHI-OBbIfi TOKOIIPHeMHHK YCTPO~~CTBO, npemia3HareHHoe nOCpeACTBOM ~eno69aToro CMOHTApOBaHHbIX 811-32-09 nna ToKocbeMa pOJII4Ka AJIA Ha "ITaHre,nOABH~HOii C KOHTaKTHOrO CKOJIb3RIUeh BJlIO60M nposona KOHTaKTHOfi BCTaBKII, HanpaBJIeHHH. Stangenstromabnehmer-Kontaktrolle polea de trole rotella (a gola) trolleywiel rolka kontakttrissa roulette de trolley Roulette à gorge appuyée sous le fil de contact. bearing against the contact trolley-wheel A grooved wheel POJlHK “ITaHI-OBOTO ~eJIO6raTbIti 811-32-10 TOKOn,,H‘?MHHKa pOJUiK,o6pa3yIOLUHti KOHTaKTC KOHTaKTHbIM npOBOAOM. Rollengabel armadura de trole supporto della rotella trolleywielvork uchwyt rolki rullhàllare chape de trolley Support de l’axe de la roulette. trolley-shield globe trolley-wheel harp The support for the spindle BHJIKB UlTBH~OBO~O OIIOpa 811-32-11 wire. of the trolley-wheel. TOKOIlpHCMHHKa AJlrr OCEi pOJIHKa IIITaHrOBOrO TOKOnpAeMHAKa. Schleifschuh (Stangenstromabnehmer) frotador de trole ; zapata de contacto cuillère de contact frotteur (de trolley) Appareil en forme de gouttière permettant la prise de courant par glissement sur un fil de contact. contact slipper contact shoe A grooved wire. fïtting KOHT%KTHBR YCTPOI~CTBO CKO,IbJ,TLIJEIii 811-32-12 enabling current to be collected by sliding pattino a goia trolleyschoen Slizgacz lyikowy slapsko against a contact BCTBBKB B BliAe KOHTaKT AeTana II TOKOCbeM c EeJIO6KOM, n03BOnRIoLuee C KOHTaKTHOTO 06ecnewTb npOBOAa. tête de trolley Stromabnehmerkopf Ensemble de pièces comprenant en particulier, soit la chape et la roulette, soit la cuillère et son support, et permettant les déplacements nécessaires de la cabeza de trole testa (di contatto) cuillère ou de la roulette. trolley-head curre& collecter Equipment comprising either the trolley-shield support and allowing the necessary movement rOJïOBKa UITBHI-OBOrO YCTPO~TBO, o6ecnewnamwix BCTaBKM. and wheel or the slipper of the slipper or wheel. and TOKOIlpHt?MHHKa cocTo~~een~6o~3~~~~~~ponuKa,n~6o~3BcTaBK~~onopbI, HCO6XOAHMOe nepehfeuemïe pomKa r4m KoHTaKTHoti trolley-stroomafnemerkop glowica odbieraka (drpikowego) kontakthuvud 811-32-13 144- 50(811) 0 CE1 Stromabnehmerstange perche de trolley Perche légèrement flexible portant la tête du trolley et transmettant roulette ou à la cuillère la pression produite par des ressorts. à la trolley-pole boom A tube or rod transmitting having limited flexibility to the trolley-wheel supporting or slipper the trolley-head the pressure produced @iiga de trole trolley-stroomstang drqiek odbieraka strGmavtagar&ng and by the Springs. UITaHra TOKO,,,,HeMHHKa Tpy6ka unu m-rama, o6nanammne OrpaHwieHHoh ru6KOCTbm, Hecywie rOnOBKy~TaHrOBOrOTOKO~p~eMH~Ka~~epeAaIo~HeHapOn~K~n~BCTaBKy npyxomaMu. AaBneHMe,cosAaBaeMoe 811-32-14 base de trolley Stromabnehmerbock Ensemble des pièces servant ressorts sur le véhicule. au montage de la perche de trolley et de ses trolley-base Equipment OUOpa used to mount the trolley-pole UlTaHl-H WZIIOnbJyeMbIX AeTaJleti, TOKOIIpAeMHHKaC IIpyXGiHaMH Anfl HaeAHHHUe yCTaHOBKM IIOABWKHOrO IIITaHrOBOrO CoCTaBa. Drehachse des Stangenstromabnehmers pivote de trole perno (della presa ad asta) boomvoetlager czop odbieraka drqikowego vridtapp pivot de trolley Axe vertical autour duquel peut tourner la base du trolley. trolley-pivot A vertical axis on which UlKBOpCHb IUTBHrOBOTO BepTHKaJIbHaR IIITâHrOBOTO 811-32-16 enrouleur OCb, the trolley-base may turn. TOKOUpHl?MHHKa BOKpyr KOTOpOti IIOBOpaWBaTbCH MOXeT OnOpa TOKOIIpAeMHHKa. Seilaufzug enrollador de cuerda tenditore (della corda) koordtrommel bqben Sciagacza linstriickare de corde Dispositif absorbant le mou de la corde de trolley. ropewinder A device for taking HBTRXHOB base (della presa ad asta) trollevvoetstuk podstawa odbieraka dqikowego fotplatta for strtimavtagare TOKOIlpHeMHHKa COBOKyIIHOCTb 811-32-15 and its Springs on the vehicle. base de trole up slack in the trolley YCT,,OkCTBO YCT~OJ~CTBO, AJT,, BepeBKU perympymuee rope. U,TBH,-OBOrO HaTmKeHPIe TOKOUpHCMHUKa IIITaHrOBOrO BepeBKU TOKOIIpAeMHAKa. 811-32-17 Stromabnehmerfangeinrichtung rattrapeur de perche Dispositif qui, en cas de déraillement du trolley, rabat automatiquement la perche. pole retriever A device lowers which, in the event of the dewirement of the trolley, automatically recuPerador de la Pértiga dispositivo antiscarrucolamento trolleyvanger Sciqgacz drqika samoczynnego neddragare the pole. UlTaH~Oy~aBJlHBaT‘?Jlb YCT~O~TBO, KOHTaKTHOrO 811-32-18 aBTOMaTAYeCKH OIIyCKaEOIIJee IIITaHry IIpPI OTpbIBe repos de perche Crochet maintenant la perche abaissée quand elle n’est pas en service. pole hook A hook which 01 IIpOBOAa. retains the pole in the lowered position when not in use. Stangenhalter gancho de sujecion (de la pértiga en reposo) gancio di fissaggio (dell’asta) vanghaak uchwyt spoczynkowy drpika lasdon for WGmavtagarstang 50(811) 0 IEC 811-32-18 3aXBaT AJlfl IUTaHrH TOuOupHeMHHKa KpIOK, yAepZHBaroU.IHii 811-32-19 145- frotteur Onymeaaym mTaHry B Hepa60YeM nonoH(eHm. Schleifschuhtriiger (de rail de contact) Ensemble de pièces permettant le captage du courant sur le rail de contact. shoegear third rail collecter An assembly of parts for collecting current from a conductor rail. (für Schienenstromabnehmer) frotador (de rail de contacto) presa (di corrente) a pattino stroomafnemer voor 3e rail odbierak lyiwowy strijmavtagare f6r striimskena 6amMaw TOKOnpHeMHuBa yCTpOèCTB0 AJTHTOKOCbeMaC KOHTaKTHOrO peJlbCa COBOKynHOCTb AeTaJIeii, C IIOMOmbBJ KOTOpbIX OCymeCTBJUIeTC5TTOKOCbeM C KOHTaKTHOrO peJIbC& 811-32-20 Schleifschuh (Schienenstromabnehmer) zapata pattino di contatto stroomafnemerschoen Slizgacz lyiwowy kontaktsko sabot Pièce du frotteur collecter appuyant sur le rail de contact. shoe The part of the shoegear making contact with the contact rail. TOKOCHHMalOmaRBCTaBKa AeTaJIb TOKOIIpMeMHHKa, 6aIIIMaKa COnp~KaCaIOLIJaSXX C KOHTaKTHbIM penbcoM. 811-32-21 mécanisme de commande Cylindre complété du pantographe hydraulique ou à air comprimé, ou dispositif électromagnétique, par un système de leviers et de ressorts convenablement conjugués pour soulever pantograph pantograph et abaisser le pantographe. cylinder control mechanism A hydraulic or compressed a system of levers air cylinder or an electromechanical and Springs, for raising and lowering device with Bettitigungsmechanismus Einholmstromabnehmer fiir Scheren- oder (Hub- und Senkantrieb) mecanismo de control del pantografo meccanismo di comando del uantografo bedieningsmechanisme van de pan&graaf mechanizm sterowniczy pantografu man6verutrustning f6r stromavtagare the pantograph. uu~ra~up naHTorpa#a MeXaHH3MynpaBJleHHB UaHTOrpa<pOM hApaBnHYeCK&Iti YCTpOlkTBO HJIH C CHCTeMOti II 0nycKaHna 811-32-22 dispositif B03AymHbIti pbIYWOB UHnIIHHp H npyxHH, IlJIH d’abaissement dropping A device damaged. AnSI nOA%eMa naHTorpa@a. automatique du pantographe Dispositif destiné à abaisser automatiquement d’être endommagé. pantograph 3neKTpOMeXaHWZeCKoe npeAHa3HaYeHHOe intended le pantographe lorsqu’il risque automatically if it should device to lower the pantograph ~CT~O~CTBOBafl 0nycBaHufl naHTorpa<pa npeBHa3naBenHoe YCTPOI~CTBO, naHTorpa@a 811-32-23 B cnyrae nna aBTOMaTAYfXKOT0 OnycKaHm ero noBpeaneHm4. hauteur de travail Plage de hauteurs dans laquelle le pantographe fonctionne correctement. working height The range of heights pa6oraB BbICOTbI, over which the pantograph operates BbICOTa Ha KOTOpbIX be Senkautomatik des Scheren- oder Einholmstromabnehmers dispositivo de bajada automatica del pantografo dispositivo automatico di abbassamento del pantografo neerlaatmechanisme van de pantograaf urzqdzenie automatycznego opuszczania pantografu fallmekanism for str6mavtagare HOpManbHO pZi6OTaeT naHTOrpa@ correctly. Arbeitsbereich altura de trabajo campo di lavoro (del pantografo) werkgebied zasieg roboczy arbetshojd fi5r str6mavtagare 811-32-24 décollement pantograph entre le pantographe between OTPbIB IlaHTOrpa@ HOTepR KOHTaKTa amortisseur the pantograph OT KOHTBKTHO~O MeXAy and contact wire. IIpOBOAa naHTOrpaC$OM u KOHTaKTHbIM agissant Schwingungsdampfer pantograph sur le système articulé controlling the movement p‘3~JlflTOp ~BHXCEeHHR IIaHTOrpa@a AMOpTu3aTOp,perynupyKWu~ of the pantograph nBuxeHue rnaBaoii naHTorpa@a. AnpreBdruckkraft pression de contact (du pantographe) pression d’application (du pantographe) Force avec laquelle pantograph pantograph The force le pantographe (ScherenEinholmstromabnehmers) est appliqué contre KOHTPKTHOe by the pantograph AaBJleHHe AaBJIeHue, to the contact wire. IIaHTOrpa+3 naHTOrpa+OM IIpOH3BOAHMOe Ha KOHTaKTHbIfi IIPOBOA. Schlingern (des Scheren- oder ..... Déplacement latéral de la semelle de pantographe, engendré véhicule et la déformation de la base du pantographe. pantograph of the pantograph and flexing of the pantograph nonepequoe KofieBaaae nonepeqaoe enuHuubI par la marche du sway The lateral movement of the vehicle strümavtagarsvaj frame. nanrorpaga cMeIqeHue no~mxHor0 head due to the motion Einholmstromabnehmers) inclinacibn del pantografo spostamento laterale dell’archetto &zwaai van de pantograaf przesuw poprzeczny Slizgacza nono3a cocTaBa nauTorpa@a, BbI3bIBaeMOe A nepeMemeHueh4 KapeTKu ,ItBuXeHueM naHTorpa@a. SECTION 811-33 - LIGNES AÉRIENNES DE CONTACT SECTION 811-33 - OVERHEAD CONTACT PA3AEJI 811-33 - OEOPYAOBAHME 811-33-01 LINE EQUIPMENT B03AYlIIHOfi KOHTAICTHOj3 électrique l’intermédiaire destinée d’organes à alimenter des véhicules en énergie électrique, par de prise de courant. contact line A conductor collecting KOHTBKTHaR COCTBBâ system for supplying electric energy to vehicles through current- equipment. 3neKTpusecKax CETH Fahrleitung ligne de contact Ligne oder presion de contacto ; presion de aplicacion (del pant&rafo) foiza di con&to (del pantografo) pantograafcontactdruk nacisk stykowy pantografu uppkraft le fil de contact. contact pressure adherence pressure applied CBTb nuHu2, 3neKTpurecKoi npema3HaYeHHaR 3Heprueii 9epes nn5i naTaaun TOKOnpUeMHUK. oder amortiguador de pantbgrafo ammo&zzatore del paitografo pantograafdemper tlumik pantografu strijmavtagardampare main frame. paMbI (für Scheren- Einholmabnehmers) du pantographe. damper A damper ; IIPOBOAOM. de pantographe Amortisseur 811-32-27 et le fil de contact. bounce Loss of contact 811-32-26 Abspringen des Scheren- oder Einholmstromabnehmers salto de pantografo distacco del pantografo contactonderbreking van de pantograaf springing odskok pantografu str6mavtagarstuds du pantographe Perte de contact 811-32-25 50(811) 0 CE1 146- nomuxHor0 linea de contacto linea di contatto contactleiding sie& trakcyjna stri5mf6r&jningsn%t - 50(811) 0 IEC 811-33-02 147Oberleitung linea aérea de contacto ligne aérienne de contact caténaire Ligne (déconseillé) électrique destinée à alimenter des véhicules en énergie électrique . . lInea d’ contatto par l’intermédiaire d’organes de prise de courant et constituée par des conducteurs placés au-dessus (ou à côté) de la limite supérieure du gabarit des véhicules. bovengrondse . , . ‘s’ec Jezdna aerea contactleiding gorna kontaktledning overhead contact line catenary (deprecated) A contact line placed above and supplying vehicles collection equipment. 603~yIUHafl KOHTBKTHBR KOHTaKTHaR KOTOPOki CAllHIIQbI 3HeprOCHa6wtCHPDJ electric the Upper Emit of the vehicle energy through roof-mounted gauge current CeTb CCTb, ,IpOBOAa ra6apura ,IllHH&, (or beside) with pa3MeIIJCHbI IIOABWKHOI-0 IIOABPDKHOrO BMIIIC COCTaBa, COCTBBa %PC3 (HnH C60Ky) BepxHeYi lIpeAHa3HaYeHHan J’CTaHOBJIeHHbIe AAS Ha KpbIme TOKOII,,HCMHMKII. 811-33-03 Ligne constituée par un seul fil de contact. single tramway-type trolley wire An overhead “poCTan equipment contact line consisting IEOHTâKTHBR BO3ApIax 811-33-04 Einfachfahrleitung mit einem Fahrdraht linea de contacto simple linea di contatto semplice contactleiding, bestaande uit één rijdraad stadsophanging siec jednoprzewodowa enkelledning ligne de contact simple IlOABWKa KOHTaKTHâR of a single C OAHUM contact KOHTBKTHLIM CCTb, COCTORLLWR R3 OAHOrO wire. IIPOBOAOM KOHTaKTHOTO npOBOAa. Einfachfahrleitung mit Doppelfahrdraht linea de contacto doble linea di contatto doppia contactleiding, bestaande uit twee rijdraden siec dwuprzewodowa dubbelledning ligne de contact double Ligne composée par deux fils de contact voisins, maintenus au même potentiel. double tramway An overhead equipment contact line consisting of two contact wires close to one another and at the same potential. ABO‘kOfi KOHTaKTHblti paC”O,IO~KeHHbIX 811-33-05 IIPOBOA KouTaKTHaR CeTb, BO3AyllIHas ,,SIAOM COCTOIIIrJaR M HMeIOIIUïX ligne (aérienne de contact) à suspension ligne (aérienne de contact) à suspension ligne caténaire Ligne aérienne de contact dans laquelle dus à un ou plusieurs I13 AByX OAHHaKOBblil câbles porteurs KOHTaKTHbIX IIpOBOAOB, IIOTeHWafl. caténaire longitudinale le ou les fils de contact sont suspen- longitudinaux. overhead contact line with catenary suspension overhead contact line with longitudinal suspension An overhead contact line where the contact wire or wires are suspended one or more longitudinal KOHTBKTHBR CBTb C UenHOti BO3Ay”IHaB KOHTBKTHBR CCTb C IlpOAOJlbHOti BO3AymHas KOHTaKTHaR CCTb, IIPOBOA OAHOMY 811-33-06 HJIH HCCKOJIbKIIM from IIpOAOJIbHbIM IlOABWKOfi IlOABCCKOii IIJIM IIpOBOAa HeCYIIPïM KOTOpOti IIOABCLUCHbI K TpOCaM. câble porteur longitudinal Câble longitudinal fils de contact. catenary messenger supportant soit directement, soit indirectement, le ou les wire (USA) A longitudinal indirectly. table Kettenoherleitung linea (con suspension) catenaria linea (di contatto) a catenaria o longitudinale ; catenaria contactleiding, bestaande uit draagkabel(s) en rijdraad (rijdraden) ; kettinglijn sief laticuchowa ; siec podwieszona barlineupphangd kontaktledning catenaries. BO3AJ’I”HaH supporting the contact ; wire or wires either directly or Liingstragseil table portador longitudinal corda portante draagkabel linka nolna podluina barlina ; catenaria 811-33-06 IlpOnOJTbHblir 50(811) 0 CE1 Hl?CJ’lUtlii TPOC nPOAOnbHbIti IIPOBOA, “pOMt2KKyTOVHb,e 811-33-07 148 - IlOAAepxMBaIOLUHb 3JIeMeHTbI OAIIH HCIIOCpeACTBCHHO MJIII HeCKOJIbKO KOHTBKTHbIX IlJIEi 9CpC3 npOBOAOB. câble porteur principal porteur principal Câble porteur longitudinal pendules. supportant le câble porteur auxiliaire à l’aide de main catenary principal carrier A catenary supporting rJlaBHblii HcX!ylllliii &,OAOJlbHbIfi 811-33-08 an auxiliary catenary by means of droppers. TPOC HCCyLL& BCIIOMOE-iTeJIbHbIti Haupttragseil table portador principal ; portador principal corda (portante) principale hoofddraagkabel linka nosna gfowna huvudbarlina TPOC, HeCJ’IIJEïii nOAAeplKHBaloWïii IIOCPCACTBOM CTPJ’H TPOC. câble porteur auxiliaire porteur auxiliaire Câble ou fil longitudinal suspendu au porteur principal tement, à l’aide de pendules, le ou les fils de contact. et supportant direc- auxiliary catenary auxiliary carrier Hilfstragseil (Hilfstragdraht) table portador auxiliar ; portador auxiliar corda (portante) ausiliaria hulpdraagkabel linka nosna pomocnicza hjalpbiirlina A catenary suspended from the main catenary and supporting the contact wire or wires directly by means of droppers. BCnOMOraT‘3JTbHbli-, npOAOAbHbIti H‘?Cy,l,Hé HeCY~Hk C “OMOWbIO CTPYH TPOC TPOC, IIOABCWSHHbIti IIOAAepLVKBtUOIIIPïfi K rJIaBHOMJ’ OAAH TPOCY II HeCyueMy HJIM HCCKOJIbKO KOHTaKTHbIX IIPOBOAOB. 811-33-09 caténaire à un fil de contact Ligne caténaire comprenant porteur longitudinal. un fil de contact suspendu directement à un câble simple (catenary) equipment with single contact wire An overhead contact line consisting of a contact wire suspended a catenary. OA,,HapHafl UeflHafl Bo3AyUIHas IIOABeIUCHHOrO 811-33-10 llO~BWKa KOHTâKTHZ-4 C OnHUM CeTb, KOHTaKTHbIM COCTOIILLWl HeIIOCpCACTBeHHO IIPOBO~OM 113 OAHOI-0 K OAHOMY directly from KOHTaKTHOTO HeC,‘IWMy IIpOBOAa, TPOCY. caténaire à deux fils de contact Ligne caténaire comprenant câble porteur longitudinal. deux fils de contact suspendus directement à un simple (catenary) equipment with twin contact wires An overhead contact line consisting of two contact wires suspended from a catenary. onuuapuaa uenuaa noLmectcac ABYMR Bo~A~IIIHWI COCTORLWR IIOABCUleHHbIX 811-33-11 KOHTBKTHâR CCTb, HCnOCPeACTBCHHO tcoHTaxTHbwn4 K OAHOMY B3 AB,‘X Kettenoberleitung mit einem Fahrdraht catenaria con un hilo de contacto catenaria semplice a un fil0 kettinglijn met een enkele rijdraad (contactleiding) siec rancuchowa prosta jednoprzewodowa enkelledning med biirlina directly Kettenoberleitung mit Doppelfahrdraht catenaria con dos hilos de contacto catenaria semplice a doppio filo kettinglijn met dubbele rijdraden siec lahcuchowa prosta dwuprzewodowa dubbelledning med btirlina nposonahlw KOHTaKTHbIX IIpOAOAbHOMy I’IPOBOAOB, HCCyIIWM) TPOCY. suspension caténaire double Ligne caténaire dans laquelle les fils de contact sont suspendus à deux câbles porteurs longitudinaux présentant la même flèche et placés à la même hauteur au-dessus des rails de roulement. double catenary equipment An overhead contact line in which the contact wires are suspended from two catenaries having the same sag and placed at the same height above the running rails. Doppeloherleitung suspension catenaria doble catenaria a doppia corda contactleiding, bestaande uit twee draagkabels en rijdraad ; kettinglijn siec lancuchowa podwojna koutaktledning med tv& biirlinor - 50(811) 0 IEC 811-33-11 flnoüuae uenuan nonsecra Bosnymnan 811-33-12 149- KOHTaKTHaSI K ABYM npOAOJIbHbIM nOABWa II 3aKpenneHHbIM CeTb, B KOTOpOfl HeCyIWIM KOHTaKTHbIe TpOCaM, npOBOna IIMeIOIUIIM Ha O,QI4HaKOBOii BbICOTe nOLlBeIIIeHb1 OLWïHaKOByIO HaA XOAOBLIMH CTpeJIy PeJIbCaMH. suspension caténaire composée Ligne caténaire comportant un ou deux fils de contact suspendus auxiliaire, cet ensemble étant supporté par le porteur principal. au porteur compound catenary equipment An overhead contact line with one or two contact wires suspended auxiliary catenary which is suspended from the main catenary. from an Verhundoherleitung suspension catenaria compuesta catenaria composta contactleiding met hulpdraagkabel sied:lancuchowa zloiona ..... cnoxuafl uenuafl noflnecaa BO3AyLUHax KOHTaKTHaR npOBOAOB, nOAnepN4BaeMOMy 811-33-13 CeTb, nOABeLLlaH”bIX COCTOIILUQII K TJIaBHbIM E13 OAHOI-0 BJIA ABYX BCnOMOTaTWIbHOMy HeCyIIViM KOHTaKTHbIX HecylIleMy TPOCY, TPOCOM. caténaire inclinée windschiefe Oberleitung Ligne caténaire dans laquelle le ou les fils de contact sont suspendus au porteur par des pendules inclinés, de façon que le ou les fils de contact conservent cependant un tracé correspondant sensiblement à celui de l’axe de la voie équipée. catenaria inclinada catenaria inclinata ; catenaria obliqua ..... siec pochyla ..... inclined catenary skew catenary curvilinear catenary An overhead contact line in which one or more contact wires are suspended from the catenary by inclined droppers SOthat the contact wire or wires follow a path corresponding approximately to the centre line of the track. HaKJlOHHaR IlOABWKa uocaa no,qaecua upuaonnneünaa noaeecua BosnymHan KOHTaKTHaI nI?ABeLLIeHbI K HeCyIUeMy KOHTaKTHbIe npOBOAa npH6JIH3~TeJIbHO 811-33-14 ocsi CeTb, KOHTaKTHbIk TPOCY npOBOA HaKJIOHHbIMA PaCnOnaraJIHCb II0 AJIA CTpyHaMA KPIIBOÜ, npOBOAa AJIR KOTOPOÜ TOTO, qTO6bI COOTBeTCTByEOllIeI? nyTH. caténaire polygonale polygonale Oberleitung Dans une courbe, disposition d’une ligne caténaire formant entre supports adjacents une série de lignes droites constituant en plan un polygone, les pendules de chaque portée étant disposés dans un même plan vertical. catenaria pohgonal catenaria poligonale polygonale bovenleiding sied: fjezdna) lancuchowa wielokqtowa ..... polygonal equipment An overhead contact line arrangement which in curves forms a series of straight lines between adjacent supports, forming in plan a polygon, the droppers in each span all lying in the same vertical plane. eepruuaJtbuafl uenuafl nofiaecua BO3AyLUHa% 811-33-15 KOHTaKTHaB CeTb, nOBTOpaX o6pasymT OnOpaMH Ha Ka)KAOM npOJIeTe paCnOJIaraKlTC5l npOBOAa KOTOpOfi MHOTOyTOJlbHHK B BepTRKaJIbHOfi MexAy ; npWieM CMexHbIMA CTpyHbI fil de contact Fahrdraht Conducteur électrique d’une ligne aérienne l’organe de prise de courant. de contact sur lequel appuie The electric conductor of an overhead collectors make contact. contact line with which the current IlpOBOn 3,IeKTpAYeCKHH TOKOIIpkïeMHHKH. npOBOA BO3~yLIIHOk KOHTaKTHOti “~~c~nntoo rijdraad przewod jezdny kontakttrad contact wire trolley wire (USA) KOHTaKTHblii B IIJIOCKOCTII. CeTH, KOTOporo KaCamTCH 811-33-16 150 - 50(811) 0 CE1 ligne de pontage Ligne permettant d’assurer la continuité électrique des lignes de contact des sections de voies situées de part et d’autre d’une gare et d’isoler les lignes de contacts de la gare elle-même. by-pass feeder A conductor providing electrical continuity between the contact line on the sections of track on either side of a station when the contact line in the station itself is isolated. 06BOAHall JlAHllR o6ecnesnsaromrib IIPOB~A, KOHTaKTHOti o6pasoM 811-33-17 Bahnhofsumgehungsleitung Iinea de puenteo scarto doorverbindingsleiding (weerszijden van station) przewod obejsciowy forbigangsledning CeTII ABYX HCIIpCpbIBHOCTb YYILCTKOB ~OIIyCKEiIOIIJEiii IIyTPi A3OJIRIUïEO C o6eux KOHTBKTHOti uenn 3.lICKTpWSCCKOti CTOpOH CTâHIlIIA CeTPi CaMOti H TaKHM CTâHUHH. suspension en Y Suspension caténaire, dans laquelle le fil de contact est suspendu à l’aide d’un ou plusieurs pendules à un tronçon de câble auxiliaire, fixé au câble porteur principal en un point, de chaque côté du support du câble porteur principal. stitched catenary suspension Y-Ausfiihrung suspension en Y sospensione a Y bovenleiding met Y-draad podwieszenie pomocnicze Y Y-upphangning A catenary suspension in which the contact wire is suspended by one or more droppers from a short continuous auxiliary wire which is attached to the main catenary at one point one each side of the main catenary support. uenuaa noneecea c peccopnou c~pyuofi qUI”aR IIOnBCCKa, PUIll HCCKOJIbKHMH IIpZiKpeILWeTCSI KOHTaKTHblil CTpYHâMPI K F’JIaBHOMy npOBOn BflOJIb KOTOpOti ITOAACpXWiBaeTC54 BCIIOMOElTWIbHOrO TPOCY B OAHOti HCCJ’IQCMY IIpOBOAa, TOYK’Z II0 o6e OAHoti KOTOpbIii CTOpOHbI OT OIIOpbI. 811-33-18 câble à Y Câble auxiliaire destiné à la réalisation d’une suspension en Y. stitch wire The auxiliary wire used in stitched suspension. peccopean CTplHa ,h,OMOI-aTWIb”bIi? 811-33-19 TpOC, EICIIOJIb3,‘eMbIfi Eléments destinés à supporter l’ensemble d’une ligne aérienne de contact. supports (in electric traction) structures Those parts which support the conductors overhead contact line. qaCTYi c6opaa 811-33-20 AJIR IWIHOti IIODBCCKPL supports (en traction électrique) OllOpbl Y-Seil table en Y corda ausiliaria Y-draad linka pomocnicza (do podwieszania Y) Y-lina (KOHTâKTHOti B03AYmHOe 113 IIpoBo~oB des conducteurs and the associated et des isolateurs insufators of an Triiger ; Stütze apoyos (en traccion eléctrica) ; estructura (en traction eléctrica) sostegno bovenleidingdraagconstructie wsporniki barande konstruktioner CeTII) KOHTBKTHOii CeTII, C IIOMOIUbm KOTOpbIX nOmep)l(ABaeTCfl II RSOJIRTO~OB. poteau (en traction électrique) Support vertical, constitué d’une seule pièce en bois, béton, acier, etc. ou ayant une structure en treillis métallique, implanté à côté de la voie, dans le sol, directement ou par l’intermédiaire d’une embase distincte. pole (in electric traction) mast A main vertical support in solid wood, concrete or steel, or of steel lattice construction, with one end planted in the ground at the side of the track, either directly or through a separate base or foundation. Mast poste (en traccion eléctrica) pal0 paal ; mast sfttP stolpe 50(811) 0 IEC 811-33-20 CTOJl6(B 3JIeKTpHVeCKOfi OCHOBHaSl 6eTOHHOil 151 - TRTe) BepTHKaJIbHaR OIIOpa, WIPiCTaJIbHOfi BbInOJIHeHHa~ KOJlOHHbI KOHeUKOTOpOirJIHBOBpbITHenOCpeACTBeHHO nyT&i, 811-33-21 nn60 YCTaHOBJIeH B BMAe AepeBRHHOit, 5UIHCTaJIbHOtipWIeTYaTOti MaYTbI,OAPiH B3eMJHOC60KyOTpeJIbCOBOTO Ha@'HAaMeHTe. désaxement Zick-Zack (der Oberleitung) Disposition en zigzag horizontal prévue au montage des fils de contact, pour éviter une usure localisée sur les bandes de frottement des pantographes. escalonado poligonazione zigzagverschuiving van de rijdraad zygzakowanie saxning stagger Displacement of the contact wire to opposite sides of the track centre at successive supports, to avoid localised wear of the pantograph wearing strips. 3W3W(KOHTaKTHOTO PacnonoHteHue OTHOIIEHIIIO K KOHTaKTHbIX 811-33-22 IIpOBOAa) npoeona Ha onopax KOHTaKTHOTO OCII BCTaBOK IIYTU AJIR B BHAe o6ecnesewiff JIOMaHOti JrAHHIIno paBHOMepHOr0 H3HOCa naHTOrpa@a. pendule (de ligne caténaire) HSnger Organe assurant la suspension d’un transversal d’équilibre, d’un porteur auxiliaire ou d’un fil de contact à un transversal porteur ou à un câble porteur longitudinal. péndola (de linea catenaria) pendin hangdraad wieszak biirtr&d dropper hanger (USA) A component used to suspend a registration span-wire, an auxiliary catenary or a contact wire from a headspan or a longitudinal catenary. cTPYHa ncnonb3yeMan Ann BcnoMoraTenbnoro Hecymero AeTanb, nonepeYHoMy 811-33-23 IlnII IIpOAOnbHOMy @ixcnpyromero nOABeLLlHBa"AR unu Tpoca HeCyIJJeMy KOHTBKTHOTO Tpoca, npOBOAa K TpOCy. griffe Fahrdrahtstogklemme Pièce de jonction utilisée pour relier mécaniquement tronçons de fil de contact. et électriquement deux contact wire splice A tïtting for joining two lengths of contact wire mechanically CTbIKOBbIfi 3B1KUM AeTanb, ncnonb3yeMas COeAAHeHUII 811-33-24 ABYX OTpe3KOB AAs h4exaHnSecxoro KOHTaKTHOrO mn4 and electrically. 3nezTpmreczoro Hangerklemme Pièce assurant une liaison mécanique suspension. entre le fil de contact et les organes de suspension clamp A tïtting providing mechanical connection wire and the supporting assembly. 811-33-25 between the catenary or contact grapa de suspension morsetto di sospensione ophangklem uchwyt linhallare 3ZWtWM AeTanb, o6ecne=tnsatomaa KOHTaKTHOTO riidraadlasklem z&zka skarvklfimma npOBOAa. griffe de suspension llO~BeCHOÏ-4 co~~~~to hi’o+nta npoaona MexaHnSecxoe CoennHeHne Hecymero Tpoca M noAAepxtaeaIoorrreii mn coopaa. pièce de jonction Pièce assurant une liaison mécanique entre deux conducteurs électriques. connecter A tïtting providing mechanical connection between two electrical conductors. Verbindungsklemme conector dispositivo di collegamento verbindingsklem zfacze (przewodu) kontakthylsa 811-33-25 COC~EïHiïTCJIbHblli Aeranb, 50(811) 0 CE1 152- 38XUM o6ecneYnBaromaR MeXaHHYeCKOe COeAPiHeHBe AByX 3JIeKTpEiWZCKHX IIpOBOAOB. 811-33-26 Endklemme uièce d’extrémité . Piéce à installer l’ancrage. à l’extrémité d’un câble ou d’un fil, pour en effectuer termination fitting pieza termina1 terminale afspanklem uctbyt kotwowy iindklamma A fitting attached to the end of a wire or table in order to anchor it. KOHQeBOfi ,@Tanb, 811-33-27 38XWM YCTaHaBJIuBaeMaR Ha KOHUe IIpOBOAa IlJIll TpOCa AJIR er0 aHKepOBKH. Stützisolator aislador rigido (en traction isolatore rigido (a perno) steunisolator izolator trzonowy stodisolator av pinntyp isolateur rigide (à tige) (en traction électrique) Isolateur fixé rigidement sur une ligne. pin iusulator (in electric traction) An insulator rigidly lïxed on a Stern. 811-33-28 ,“TblpeBOïi W3OJlflTOP (B WI‘2KTpEI’IeCKOti TRre) II3onRTop, Xecrxo 3aKpenneunbrn na ruTbIpe. isolateur de suspension (en traction électrique) Elément traction. d’une chaîne d’isolateurs pouvant être soumis à des efforts de suspension insulator (in electric traction) disc insulator A component nO~BeCHOi-4 ,I,,,CKOBblfi Hhgeisolator aislador de suspensih (en traction eléctrica) isolatore di sospensione kettingisolator izolator wiszqcy kedjeisolator capable of being loaded in tension. 830JlflTOP l#3OJlflTOp 3neMeHT 811-33-29 of a string of insulators B&ïCWi&i (B 3neKTpEIYeCKOii rHpJIFIHAb1 TIIre) PIJOn~TOpOB, pa6oratomati Ha paCTSDKe”He. noix (en traction électrique) Isolateur à cannelures longitudinales, percé de deux ouvertures perpendiculaires entre elles, de façon que la matière isolante ne soit soumise qu’à des efforts de compression. strain insulator (in electric traction) NuB- oder Eiisolator aislador tensor ; (aislador) nuez iso’atore a noce ..... izolator jajowy aggisolator An insulator with longitudinal grooves, pierced with two mutually perpendicular holes, SO that the insulating material is loaded in compression. HBTR1KHOfi M3OnHTOp (B 3AeKTpWieCKOti IIJOJlflTOP C IlpOAOnbHbIMEI IIepIIC!H~PIKyJI5lpHbIMH 811-33-30 TIIre) KaHaBKaMH OTBepCTURMA, Ii ABYMR pa6oratomati CKBODHbIMH B3aAMHO Ha GKaTHe. console (en traction électrique) Ausleger Support constitué par un ou plusieurs bras transversaux fixés à un poteau. cantilever (in electric traction) A support consisting mast. KOHCORb OIIOpa, eléctrica) of one or more transverse (B JneKTpHrecKoii COCTOIIIIJQII 3aKpenneHHbIx from a utliggare Twe) 113 OAHOrO OAHHM members projecting KOHUOM MnII HeCKOnbKAX Ha cTon6e. IIOIIepeVHbIX conso1a mensola ..... wysiqgnik KpOHIIITetiHOB, 50(811) 0 IEC 811-33-31 - 153 Schwenkausleger console articulée Console fixée à son support de façon à permettre un déplacement et un certain déplacement vertical du fil de contact. longitudinal hinged cantilever A cantilever fixed to the mast in such a way as to allow movement of the overhead contact line longitudinally and, to a limited extent, vertically. IlOBOpOTHafl KOHCOJlb KOHCOJIb, 3aKpenneHHaa IIpOAOJIbHOrO 811-33-32 Ha II HeKOTOpOrO onope n o6ecne~ntiaK)uIasI BepTnKanbHOrO B03Mo)1(HocTb CMemeHnR IIeIIHOn IIOABeCKn. . fixation rigide starre Fahrdrahtaufhangung Mode d’attache d’une ligne aérienne de contact, dans lequel le fil ou câble est fixé rigidement à ses supports. rigid support A method of attaching xemcoe an overhead contact line rigidly to its support. fijacion rigida fissaggio rigido ..... zawieszenie sztywne stum upphangning upenfieuue Cnoco6 811-33-33 conso’a articu’ada mensola articolata ..... wysiggnik ruchomy r6rlig utliggare @IKCnpOBaHHOrO KpeIUIeHnfl BO3AymHOii KOHTaKTHOti CeTn K OnOpe. fixation flexible elastische Fahrdrahtaufhangung Mode d’attache d’une ligne aérienne de contact, dans lequel le fil ou câble est fixé à ses supports par l’intermédiaire d’un ou plusieurs câbles transversaux fijacion f1exib1e sospensione elastica flexible bovenleidingophanging zawieszenie elastyczne elastisk upphangning ou autres dispositifs flexibles. flexible support A method one or of attaching more an intermediate overhead contact transverse wires line or to its other supports flexible by means of devices. ru6uoe upenneuue Cnoco6 811-33-34 KpeIIJIeHIEI BO3~ymHOïI OAHOrO EIJII, HeCKOJIbKnX rn6xux ~CT~O~ICTB. KOHTaKTHOn IIpOMe~yTO=IHbIX CeTA Ha OnOpaX IIOnepe’IHbIX npn TPOCOB nOMOIII&I AJIn ApyrnX Querdrabt (Querseil) transversal Fil ou câble normalement isolé électriquement, rapport aux voies et destiné : - soit à supporter une ou plusieurs lignes disposé transversalement aériennes de contact par linka (((transversal porteur ») ; - soit transversa’ filo (di sostegno) trasversale spandraad poprzeczna tviirspann à équilibrer les efforts radiaux (G transversal d’équilibre D). cross-span span wire A wire used or table, normally insulated, placed across the track - either to support one or more overhead contact lines (headspan) - or (cross-span to carry the nonepeuubtii npOBOJI lateral and OnHOii IIJIII Hecymnii registration forces ; registration). T~OC IUIII TPOC, pacnonoaeaabre 06bIYHO nonepea HeCKOJIbKMHX TPOC), (~IIKCHpyIOmnil 811-33-35 electrically : na60 BbInOJIHeHHbIe ny-reii II B03AyIIIHbIX AIJIII C ncnonb3yeMbIe KOHTaKTHbIX BOCIIpnflTnH 3JIeKTpOn3OJIauIIeü, nn6o Anar CeTeti nonnepmrz (nOnepe~HbIn nonepe9nbIx Harpy30K TPOC). rappel Abzug (Bogenabzug) Dispositif utilisé dans les courbes ou au-dessus maintenir les conducteurs dans une position des appareils de voie, pour assignée. pull-off A device used on curves, or at track turn-outs, to keep the conductors correct position. in their tirante ; dispositivo di poligonazione bochtaftrek odcigg sieciouy avhall 811-33-35 +nccnpymurafl 50(811) 0 CE1 orrmirna YCTPO~ICTBO, ncnonb3yeMoe @IKCnpOBaHAR 811-33-36 154- na npOBOAOB KpnBbIx nnn B 3aAaHHOM Ha cTpeno9HbIx nepeeonax ~A54 nO.IIOTeHHn. antibalançant Stiitzrohr Organe rigide, isolé électriquement et souvent pivotant afin de de son support, portant le bras de rappel permettre le déplacement vertical et longitudinal bracclo registration arm stiff arm component, and often d1 p”ligonazione pijp voor zijwaartse bevestiging ramie ustalajqce izolowane utliggararm de fils de contact. A antiba’ancin electrically hinged to insulated allow from along-track its support, or vertical carrying the steady movement. @lKCaTOp ~KeCTKEIii 3AeMeHT, H30AApOBaHHbI~ OT nOAAepWIBaIOII&I KOHCTpyKnnU, nnrr 6oKoBoro Kpennenns pa6oqero nponona 3ayaCTyEO yCTaHaBAnBaeMbIn IIIapHnpHO AJIK o6ecnesenns npOAOAbHOr0 nonepe9aoro cMememra. uMeIomnti 811-33-37 n ~CT~OI%CTBO II bras de rappel Seitenhalter Bras pivotant destiné à maintenir le fil de contact en position transversale et brazo de Grante normalement fixé à I’antibalançant, de façon à être toujours sollicité en tirante di poligonazione richtstang ; zijwaartse bevestiging tension. ramie odciqgowe styv arm steady arm A hinged arm used to hold the contact wire in its correct across-track position and normally fixed to the registration arm SO that the steady arm is always loaded in tension. ana 6ouoaoro upennenua pa6ouero npono~a YCTPOI~CTBO l”apHApHbIti 811-33-38 3AeMeHT, npOBOAa B 3aAaHHOM 06pa30M, YTO6bI IIpeAHa3HaVeHHbIà nOJIOTeHHII 3JIeMeHT IIpn AJISI IIOAAep~aHIGI II npIIKpenJIeHHbII% paCTSOKe”IIII KOHTaKTHOrO K (PAKCaTOpy Harpy~aJICrr TaKnM HOpMaAbHO. portique (en traction électrique) Support constitué par une poutre transversale part et d’autre des voies. et des poteaux implantés de porta1 structure (in electric traction) A support consisting of the tracks. of a transverse beam and masts situated on either side mecruaa noneperuua (B 3neKTpnYecKoti Onopa, ~3 cocToamaa yCTaHOBAeH”aa 811-33-39 n0 o6e nonepeqaoti CTOpOHbI Querjochtragwerk portico (en traction portale (rigido) portaal bramka ledningsbrygga Tare) 6anKn, peAbCOBbIX pa3MemeHnoM Ha cTon6ax, nyTeIï. suspension transversale par câble suspension transversale souple portique souple Querseilaufhiingung suspension transversal por table portale elastico Portique dans lequel la poutre est remplacée par un ensemble de transversaux porteurs et d’équilibre. draadjuk zawieszenie poprzeczne elastyczne linbrygga head-span suspension A porta1 arrangement cross-span in which the beam 6anKa 3aMeHeHa is replaced by an arrangement of wires. rki6uaa nonepeuuea fIonepe9nna, B K0~0p0n cncTeMoii nonepe9HbIx Hecymnx TpOCOB. 811-33-40 eléctrica) portée Spannweite Partie de la ligne aérienne de contact située entre deux supports ou points de vano campata veld przpsfo suspension successifs. span The overhead contact line from one support or suspension point to the next. spann - 50(811) 0 IEC 811-33-40 155- nponeT ~~cTbB03AyUIHO~KOHTâKTHO~CeT~Me~AyABYM~cMeH(HbIM~onopaM~~n~ TOYKBMII IIOABeIlIABaHAR. 811-33-41 Fahrdrahtkreuzung croisement aérien Dispositif utilisé au croisement des fils de contact et permettant l’organe de prise de courant le long de chacun des fils. le passage de overhead crossing cruzamiento aéreo incrocio dei fili (vrijlopend) rijdraadkruising krzyiownica ledningsgrening An arrangement employed where contact wires cross at an angle, permitting the current collecter to travel along either of the wires. no3nymHoe nepecesenue YCTPO~TBO, npnMemteMoe npn nepeceqennn Konraxrnbtx npoaonoa non npoxoxoreaae roxonpneMnwKa no KaXKnoMyI13 yrnoM, 06ecne~naaromee 3TAX npOBOAOB. 811-33-42 aiguillage aérien (pour tramway ou trolleybus) Dispositif utilisé, à la bifurcation de deux lignes de contact, pour permettre le passage de l’organe de prise de courant. frog (for tramway or trolleybus) A device used at the junction of two overhead passage of the current collecter. contact lines to permit the Fahrdrahtweiche mit angenaherten Oberleitungen (für Stragenbahn oder Obus) aguja aérea (para tranvias y trolebuses) scambio aereo (per tram e filobus) rijdraadaftakking ; luchtwissel (niet vrijlopend) zwrotnica ledningsviixel BO3AymHaflCTpeJlua(AJTaTpaMBaeBHJluTpOnJIeir6yCou) YCT~O~CTBO,~~~M~H~~MO~H~~~~B~TB~~H~~AB~XBO~A~~H~IXKOHT~KTH~IX ceren nnrr o6ecne~enws 811-33-43 npoxona ToKonpneMnnxa. aiguillage croisé (pour tramway ou trolleybus) Aiguillage aérien dans lequel les fils de contact de la voie déviée croisent ceux de la voie directe. cross-over junction (for tramway or trolleybus) A type of overhead junction in which the contact wires of a branch line cross over those of the main line. no3nymuafl cTpenua c nepeceueuueM (Ann rpakmaes BO3AyUIHlU-I CTpeJIKa, B KOTOpOti KOHTaKTHbIe ny-rn nepecersamr 811-33-44 npoaona npnkroro nyrn. tangential junction (for tramway or trolleybus) A type of overhead junction in which the contact wires of a branch line run side-by-side with those of the main line after convergence. Bo3AymBafl cTpeaua 6es nepeceueuun (Ans rpah4saeu BO3AyIIIHas CTpeJIKa, B KOTOpOti KOHTaKTHbIe Mm permettant Tponneti6ycoB) C IIpOBOAaMPI IIpsMOrO nyTPi. de régler la tension mécanique Spannvorrichtung/Nachspannvorrichtung tensor ; equipo tensor tenditore naspaninrichting napreinik spanndon des conducteurs. tensioning equipment tensioning device tensioner An arrangement adjusted. Fahrdrahtweiche mit Parallelfiihrung der kreuzenden Oberleitungen (für Stragenbahn oder Obus) aguja tangencial scambio aereo tangenziale (bij wissel) meelopende rijdraad rozjazd (przewodow rtwnoleglych) ..... IIpOBOAa OTKJIOHSIIOUlerOCSl équipement tendeur tendeur Dispositif ..... sm4 TpOnJIeti6yCOB) Aiguillage aérien dans lequel les fils de contact de la voie déviée viennent se placer à côté de ceux de la voie directe après avoir été rappelés. 811-33-45 rozjazd IIpOBOAa OTKnOHRIOLIlerOC~ aiguillage tangentiel (pour tramway ou trolleybus) IIyTH npOXOAsTpRAOM Fahrdrahtweiche mit kreuzenden Oberleitungen (für StraBenbahn oder Obus) aguja cruzada (para tranvias y trolebuses) scambio aereo incrociato rijdraadkruising krzyiowy enabling the mechanical tension of the conductors to be 811-33-45 156- 50(811) 0 CE1 HBTflXCHOe yCTpOàCTB0 YCT~O~TBO, Mexanmtecxoe perynupoBaTb no3BonmorUee HaTBXeHHe npOBOAOB. 811-33-46 tendeur automatique selbsttiitige Nachspannvorrichtung Dispositif utilisé dans un équipement tendeur pour maintenir automatiquement constante, dans certaines limites de température, la tension mécanique des conducteurs. :~~~~o~rtou&~a~ico automatische afspanner, naspanner naprqinik samoczynny automatiskt spanndon automatic tensioner A device used in tensioning equipment to maintain automatically, within certain temperature limits, constant mechanical tension in the conductors. YCT~OUCTBO, mnonb3yeMoe nonnepXaHuB aBTOMaTWieCKOT0 Ann nocTOIIHHO~Be~HYAHbIHaTR~eH~RnpOBOAOBBO3Ay~HO~KOHTaKTHOiiceT~ npenenax B 0npeAeneHHbIx 811-33-47 TeMnepaTyp. hauban (en traction électrique) Barre, fil ou câble d’ancrage destiné à assurer, par traction tendeur, la stabilité d’un poteau ou d’une console. stay tie (in electric traction) A rod, wire or table, with a tensioner, ov-rflîxua pacrflzcua (B 3neKTpmecKoü CTepXeHb, IIpOBOA eléctrica) to anchor a mast or cantilever. TpOC aHKepOBKl4 BMeCTe cTon6a C PUIl HaTRXHbIM yCTpOIkTBOM, KOHCOJIH. tendeur à contrepoids Equipement tendeur automatique, fixé à un poteau et assurant une tension mécanique constante des câbles ou des fils de contact par des contrepoids. balance weight tensioner An automatic tensioner attached to a mast, and ensuring constant tension in the conductors by means of balance weights. HaT~~HOeyCTPO&kTBOC ABTOMaTkWeCKOe Verankerung table tensor ; viento (en traction controvento schoor ; tui odciqg kotwowy stag Tme) HJIH IIpeAHa3HaYeHHbIeAJIX 811-33-48 à l’aide d’un Nachspannvorrichtung mit Stellgewichten tensor Con contrapesos tend’tore a contrappeso afspanner (met gewichten) napreinik cieiarowy viktspanndon IlpOTlSBOBeCOM HaTIITHOe 06ecneYmamuee yCTpOIkTB0, nOCTOXHHOe npUKpenJle"HOe HaTRXeHlle K npOBOAOB C OIIOpe II IIOMOIAbIO IlpOTHBOBeCOB. 811-33-49 fil à tension réglée câble à tension réglée Fil de contact ou câble porteur, dont la tension mécanique tendeur automatique. est réglée par un auto-tensioned conductor A contact tensioner. wire or catenary KOHTaKTHblii KOHTaKTHbIti peryJIHpyeTCR 811-33-50 IIPOBOA whose tension is regulated by an automatic C CaMOHaTBXeHHeM npOBOA H,IH C nOMOlUbI0 HeCyLIWii aBTOMaTHYeCKOt'0 TpOC, HaTXTeHAe HaTRTHOTO KOTOpOrO yCTpOiiCTBa. câble porteur (à tension) non réglé(e) Câble porteur automatique. dont la tension mécanique festes Tragseil n’est pas réglée par un tendeur fixed termination conductor fixed equipment A conductor automatisch gespannter Draht (gespanntes Seil) .I hi’o ‘Ou tens’on regulada filo contrappesato ; corda (portante) contrappesata nagespannen rijdraad en/of draagkabel przewod o regulowanym naprqieniu ..... whose tension is not regulated by an automatic tensioner. cable portador no regu’ado corda portante non contrappesata niet nagespannen draagkabel linka nosna o nieregulowanym napreieniu ..... 50(811) 0 IEC 811-33-50 HeKOMlleHCtlpOBaHHblb I@~BoA, aBTOMaTWI‘XKOr0 811-33-51 tK?CylWfi HaT5oKeHlle TPOC ne KOTOpOrO HaTR~HO~O 157- perynnpyexz c nohlombro yCTpOfiCTBa. point dur Point une de harter Punkt la ligne élasticité de contact verticale au trés droit des griffes d’antibalançant qui présente punto faible. hard spot A point in the overhead contact line, in the region of the registration which has a low vertical resilience. arm, duro punto rigido hard punt punkt sztywny fast punkt zcecruafl roqua 811-33-52 TosKa B BO3AyLUHOti Manoii ynpyrocTbE0 KOHTaKTHOk CeTM B 30He o6nanaromair @HKCaTOpa, nanpasnerina. B BepTHKaAbHOM encombrement (de la ligne de contact) Systemhohe Distance verticale entre le câble porteur principal et le fil de contact au droit d’un point de suspension. encumbramiento ingombro verticale (della linea di contatto) systeemhoogte odstep przewodu jezdnego (od linki nosnej) systemhojd system height encumbrance The vertical distance between main catenary and contact wire measured support point. at a BbICOT% CACTBMLI PaCCTOXHue II0 KOHTaKTHbIM 811-33-53 BepTuKaJIu npOBOAOM, MeXAy I43MepReMOe rJIaB”bIM B TOYKe TPOCOM HeCyIIUIM Pi OIIOpbI. élasticité horizontale flexibilité horizontale horizontale Elastizitiit elasticidad horizontal Déplacement du fil de contact, dans le sens horizontal de force appliquée. transversal, par unité lateral elasticity lateral resilience The displacement of the contact wire horizontally per unit of applied force. in the across-track elasticità trasversale horizontale verplaatsing in transversale richting elastycznosc poprzeczna sidoelasticitet direction nonepereafl ru6uoc’rb Cbfemenkte IIJIOCKOCTM 811-33-54 konraKrnor0 OTHOCHTeAbHO npoaona ‘ZACIHIIUbI no ropa30nrann IIpHK,IaAbIBaeMOrO a nonepe9nol yCH,IEISX élasticité verticale flexibilité verticale vertikale Elastizitat elasticidad vertical Déplacement appliquée. elasticità vertica1e verplaatsing in verticale richting elastycznosc pionowa hojdelasticitet de la ligne de contact dans le plan vertical par unité de force vertical elasticity vertical resilience The displacement force. BepTWGUlbHafl Cbfememe OTHOCEITWIbHO 811-33-55 of the contact wire in the vertical plane per unit of applied ITI6KOCTb KOHTaKTHOrO eAuHHUb1 npOBOAa IIpIJKJIaAbIBaeMOrO B BepTHKaJIbHOii nnOCKOCTI1 yCuJI&i% flèche du câble porteur Différence de hauteur entre les points de suspension point le plus bas. Durchhang des Tragseiles de la caténaire et son catenary sag The difference lowest point. in height between the support points of the catenary and its flecha de1 cable portador freccia della corda (portante) doorhang van de draagkabel zwis linki nosnej nedhang av barlina 811-33-55 50(811) 0 CE1 158 - nponucauue uecymero rpoca Pa3HOCTb BMCOT MeXAy TOYKaMII OnOpbI HeCymerO TpOCa A HnTHeii er0 TOYKOti. 811-33-56 Durchhang des Fahrdrahtes flecha del hilo de contacto freccia del filo di contatto doorhang van de rijdraad zwis przewodu jezdnego nedhiing av kontakttrad flèche du fil de contact Différence de hauteur du fil de contact au droit de la suspension de la portée. et au milieu contact wire sag The difference in height of the contact wire at the support points and at the middle of the span. UpOBUCaHUe Pa3HOCTb KOHTBKTHOTO BbICOT npOBOAa KOHTaKTHOrO npOBOAa MeXAy TOYKaMII OnopbI n CepeAnHoki nponeTa. 811-33-57 Vordurchhang des Fahrdrahtes flecha initial del plano de contacto freccia iniziale (del filo) voordoorhang zwis przewodu jezdnego wstepny initialnedhang flèche initiale du plan de contact Valeur initiale imposée à la flèche du fil de contact au cours de son montage. contact wire pre-sag The initial value of sag deliberately npeABapeTeJlbHoe 811-33-58 npoaUcaHUe HauanbHas BenwmHa KOHTaKTHOrO IIpOBOAa given to the contact wire during erection. KOHTBKTHOI-0 nposeca, npn er0 npoeona cneunanbH0 ycTaHaBnnBaeMafl Blitzschutzseil (bzw. Erdseil) table de tierra (en traction eléctrica) ; table pararrayos (en traction eléctrica) Câble ou fil métallique mis à la terre, monté au-dessus de la ligne aérienne de fune di guardia contact, pour la protéger contre les surtensions atmosphériques. bliksembeneiligingslign (bij elektrische câble de garde (en câble parafoudre traction lightning protection table électrique) (in electric tractie) traction) linka odgromowa contact line to protect it àskskyddsledning An earthed metal wire fitted above the overhead against lightning. npOBOA A.MI 3aIUUTbl 3a3eMAeHnbIn (B JJIeKTpnYecKoti OT rp03bI MeTannnrecKnïI KoHTaKTHOn CeTbm npoBoA, AJIX 3amPITbI Tare) yCTaHaB.AnBaeMbIn CnCTeMbI OT yAapOB HaA BOJAymHon MoAHnn. SECTION 811-34 - RAILS DE CONTACT SECTION 811-34 - CONDUCTOR PA3AEJlSll-34 811-34-01 Anff yCTaHOBKe. - KOHTAKTHbIE RAILS PEJIbCbI rail de contact troisième rail Profilé ou contact rail métallique aérienne ou fixé placée sur à un des supports niveau isolés, voisin de celui constituant des rails une de ligne de roulement. stroomrail trzecia szyna stromskena conductor rail third rail A rigid metallic section or rail mounted on insulators overhead conductor or located near the running rails. KOHTaKTHblfi TpeTUii an peJlbC peJlbC XecTKnti n3onaTopax, mm and forming MeTannwIecKnM o6pa3ymmnZi pacnonaraeMbIb paAoM npo&nb KOHTaKTHbIn C xoAoabIMn IUIII pe,IbC, IIpOBOA, penbcaMn. yCTa”aBAIIBaeMbIfi npIIIIOAHaTbIti HaA Stromschiene rail de contacto ; tercer rail rotaia di contatto ; terza rotaia na 3eMAen 50(811) 0 IEC 811-34-02 - 159Mittelstromschiene rail central de contacto rotaia di contatto centrale stroomrail tussen beide benen trzecia szyna Lrodkowa centra1 stromskena rail central de contact Rail de contact placé entre les deux rails de roulement. centre conductor rail A conductor rail placed between the two running rails. ,,f3,T,W,bHbIfi KOHTaKTHblti KOHTaKTHbIü 811-34-03 PCJIbC, p‘%bC paCIIOnaraCMbIii MWKAY AByMSl XOAOBbIMII PCJIbCaMH. seitliche Stromschiene rail lateral de contacto rotaia di contatto laterale stroomrail naast het spoor trzecia szyna boczna sidostrijmskena rail latéral de contact Rail de contact placé d’un côté ou de l’autre de la voie ferrée. side conductor rail A conductor 6OKOBOk rail placed on one or other side of the running rails. KOHT2IKTHbI~ KOHTaKTHbIti XOAOBbIX 811-34-04 PCJlbC PtSIbC, pWIOJIaraCMbIfi C OAHOti Il.JIA LQY~yr0ii CTOPOHbI PUIbCOB. rail de contact en caniveau Rail de contact central ou latéral placé dans un caniveau situé au-dessous niveau des rails de roulement. du conduit conductor rail A side or centre conductor IlWJleB0I-i KOHTaKTHblii 6OKOBOti M,Ill IIOA 811-34-05 XOAOBMMH rail located in a trough below running rail level. KOHTaKTHbIti PeJIbC, pWIOJIaI%MbI~ B WeJII, PeJIbCaMEi. rail aérien de contact HZngestromschiene rail aéreo de contacto linea aerea (di contatto) rigida stroomrail boven het spoor trzecia szyna gorna Gverliggande stromskena la ligne aérienne de contact. overhead conductor rail A rigid rolled section forming an overhead BOJJQ’UIHbIti KOHTaKTHbIfi PWlbC Ros~ymnaa Meranna. KOHTaKTHâfl CeTb, contact line. BbIIIOnHCHHaR 113 )l(CCTKOI’O rIpOKaTaHHOF’0 sectionnement de rail de contact Intervalle laissé entre deux éléments successifs de rails de contacts. conductor rail gap A space left between two successive lengths of conductor pa3pblB KOHTBKTHOI’O r@OMClKYTOK, KOHTaKTHOI’O 811-34-07 ..... trzecia szyna kanalowa inbyggd strijmskena PWlbC UCHTpaJlbHbIYi Profilé rigide constituant 811-34-06 Schlitzkanalstromschiene rail de contacto en conducto rotaia di contatto incassata rail. Stromschienentrennung seccionamiento de rail de contacto sezionamento della rotaia di contatto stroomrailonderbrekingsafstand odstep sekcyjny trzeciej szyny strijmskenegap PeJlbCa OCTaBJIS4CMbIti MeHcA)’ ABYMR IIOCJICJlOBaTeJIbHbIMPï YWCTKaMki PWIbCa. plan incliné (d’engagement ou de dégagement) Auflauf oder Auslauf Déviation du rail de contact, à chaque extrémité d’une section pour faciliter l’engagement ou le dégagement de l’organe de prise de courant. plan0 inc’inado raccordo helling van oploopstuk (van stroomrail) wslizg i zeslizg trzeciej szyny stromskeneramp ramp Deviation of the conductor rail at each end of a section to facilitate the running on (leading ramp) and running off (trailing ramp) of the collecter shoe. OTBOA Marn6 y KOHTBKTHOTO PWIbCa H.JIPi c6eramis TOKOIIPACMHAKa. II0 KOHIWM CBKUHU AIISl o6ner4enkïa Ha6eIYiHm 811-34-08 50(811) 0 CE1 160 - ancre de rail conducteur Dispositif tudinal. d’ancrage d’un rail conducteur pour éviter tout mouvement longi- conductor rail anchor A device for anchoring npacnoco6neerte YCT~OHCTBO AA,, aHKCpOBKl4 rail to prevent longitudinal KOHTBKTHOl.0 er0 IIpOAOJTbHOrO movement. PeJlbCa penbca KOHTaKTHOTO 3aKpenneHax AJIR IIpeAOTBpaIIJeHHR 811-34-09 a conductor Stromschienenverankerung ancla de rail conductor dispositivo di ancoraggio (della rotaia di contatto) stroomrail-verankering kotew trzeciej szyny str6mskenefGrankring c ueJIbH.7 CABura. câble de pontage Câble isolé employé pour assurer la continuité électrique d’un rail de contact à un sectionnement. (track) jumper table An insulated table used for maintaining conductor rail at a gap. the electrical continuity Uberbriickungskabel table de puenteo cava di continuità doorverbindingskabel (van de stroomrail) kabel Qcznikowy sekcyjny striimskenef6rbindning of the CTblKOBOi-4 COeAHHlcTeJlb n30,IApOBaHHbIti "pOBOA, WIeKTpWIeCKOii 811-34-10 ue"H IIp,,MeH~eMbIti KOHTaKTHOrO A-WI pe."bca o6ecnereHm HeIIpepbIBHofi Ha pa3pbIBaX. rail de retour de courant Rail de contact utilisé pour le retour de courant, en lieu et place des rails de roulement. return conductor rail return current rail A conductor peJlbC rail used instead of the running rail for the return currents. 06paTHorO KOHTaKTHbIti TOK% peJIbC, IIpOXO~AeHHR WZOJIb3yeMbIti 06paTHbIX SECTION BMeCTO XOAOBbIX peJIbCOB AJISI TOKOB. 811-35 - CIRCUITS SECTION DE RETOUR 811-35 - RETURN PA3AEJI 811-35 - OEPATHbIE 811-35-01 Stromriickleitungsschiene rail de retorno de corriente rotaia di contatto di ritorno retourstroomgeleiderrail szyna 3izgowa powrotna Atergangsral DE COURANT CURRENT CIRCUITS 3JIEMTPkïYECKkïE circuit de retour Ensemble du circuit électrique constitué par les rails de roulement ou par un rail de retour de courant, leurs connexions électriques et les câbles de retour, jusqu’à leur raccordement à la sous-station d’alimentation. return circuit IIEIII4 Fahrstromrückleitung circuito de retorno circuito di ritorno retourstroomcircuit sieC powrotna Aterledning The electric circuit comprising the running rails or a return current rail, their electrical connections and the return tables to the substation. 06paTHaH uenb 3neKTpwecKax o6paTHOro Ka6ensMA 811-35-02 uenb, ToKa, o6pasyeMaa IIX 3,IeKTpHYeCKAMA AJISI BO3BpaTaTOKa XOAOBMMII peJIbCaMH COeAHHATeJIRMA H.JIH peJIbCOM II OTCaCbIBaH3JJWMA Ha IIOACTaHLWEO. système à retour par la voie Système dans lequel les rails de roulement du circuit de retour du courant de traction. de la voie constituent une partie track return system A system in which the running rails of the track form a part of the return for the traction current. circuit Schienenrückleitung sistema de retorno por la via ritorno attraverso le rotaie systeem waarin de spoorstaven deel uitmaken van het retourstroomcircuit obwod powrotny szynowy system med Cilaterledning 50(811) 0 IEC 811-35-02 CilCTt?MB BO3BpaTa CPïCTeMa, TRTOBOTO 811-35-03 TOKB ‘lepe3 B KOTOpOti XOAOBble XOAOBbIe penbCb1 161 - pt?JlbCbl o6paayro-r YaCTb 06paTHOti IIeIIki TOKa. système à retour isolé Système dans lequel les conducteurs sont isolés par rapport à la voie. constituant isolierte Stromrückleitung sistema de retorno aislado ritorno isolato systeem waarbij het retourstroomcircuit geïsoleerd is van de spoorstaven obwod powrotny izolowany system med separat aterledning le circuit de retour de courant insulated return system A system in which the conductors forming the return circuit are insulated from the track. CBCTCMa C H3OJI,,pOBaHHOfi CIKTeMa, B KOTOpOti 06paTHOè WHblO o6pasyromne IIpOBOAa, 06paTHyIO UeFIb, kï30JIHpOBaHbI OT IIYTU. 811-35-04 câble de retour Conducteur branché sur les rails de roulement ou sur le rail de retour de courant et raccordé à la sous-station d’alimentation. return table track negative table A conductor station. o6paTHblÏi connecting the running rails or return current rail to the sub- IIPOBOA OTpllUaTeJTbHblk IIp0~0n, Stromrückleitungskabel table de retorno cava di ritorno retourstroomkabel przewod powrotny aterledningskabel PWlbCOBblfi coenaHmouwïH IIPOBOA xoAoBbIe penbCb1 kïm penbc 06paTHOr0 ToKa c IIOACTaHUHeii. 811-35-05 courants vagabonds StreustrGme ; vagabundierende Str6me corrientes vagabundas Parties des courants de retour qui, sur une partie au moins de leur parcours, empruntent des itinéraires autres que le circuit de retour (par exemple : correnti vaganti zwerfstromen canalisations d’eau, câbles téléphoniques). prady Madzqce vagabonderande strommar stray currents Portions of the return current which, over at least part of their travel, follow paths other than the return circuit (for example water pipes or telephone tables). 6~ym~atomne YaCTb nyTH He II0 BOAOBOAbIHJIH 811-35-06 TOKA 06paTHOrO TOKa, 06paTHOfi TeJIeaOHHbIe KOTOpaR qenki, IIpOXOAHT, a Il0 ApyTIIM KaK MIIHHMYM, HaIlpaBneHHRM YaCTb CBOerO (HalIpHMep, xa6enn). transformateur suceur Transformateur de rapport un dont l’un des enroulements est monté en série avec la ligne de contact, et l’autre enroulement en série avec un conducteur spécial de retour isolé. Note. - Les transformateurs suceurs sont répartis le long de la voie pour drainer le courant des rails et de la terre dans le conducteur de retour, afin de réduire les courants vagabonds. booster transformer A transformer with a ratio of unity having one of its windings connected in series with the contact line and the other in series with an insulated return conductor. Note.-Booster transformers are positioned at intervals along the track to force current out of the rails and earth into the return conductor with the abject of reducing stray currents. Saugtransformator transformador auxiliar de retorno trasformatore succhiatore serietransformator transformator ssacy sugtransformator - 811-35-06 OTCaCblilalOUllié 50(811) 0 CE1 TpaHC+OpMaTOp TpaHC@OpMaTOp OAHa 162 - C 113 06MOTOK K03~@IUUCHTOM KOTOpOrO TpaHC@OpMaUHH, UOCneAOBaTenbHO paBHbIM COeAHHeHa eAxHHUe, C KOHTaKTHOti CeTb~,aApyra~nOC~eAOBaTenbHOCEI30n~pOBaHHbIMO6paTHbIMIIpOBOAOM. npm4euarfEie - Orcacbmaromne rpanc@opMaropbt pacnonoxeHbI c AHTepBa~aMLIBAO~bUyT~An~OTBOAaTOKa~3penbCOB~3eMn~BO6paTHbI~ IIpOBOAC 811-35-07 UenbH) YMeHbIIIeHHR 6nyxAafowix TOKOB. connexion électrique de rails Schienenverbinder Conducteur d’un joint. conexih ayant pour but d’assurer la continuité électrique des rails au droit rail joint bond A conductor CTbIKOBOe ensuring the electrical continuity MeXpeAbCOBOe of rails at a joint. eléctrica de railes connessione (elettrica) di rotaia retourstroomverbinding ; elektrische railverbinder Iqcznik szynowy podluuiny rlilforbindning COeAI(HeHBe ~p0~0A,o6ecUe~~Balo~H~HenpepbInHocTbpenbcoBo~3~eKTpH9ecKoiiUe~~ Ha CTbIKe. 811-35-08 connexion soudée Connexion électrique dont les deux extrémités sont soudées sur les abouts des rails d’un joint. welded bond An electrical connection at a joint. whose two ends are welded to the ends of the rails geschweigter Schienenverbinder conexion soldada connessione saldata gelaste langsverbinding ; gelaste railverbinder Iqcznik szynowy przyspawany svetsad ralfiirbindning csapeoe coeAnnenne 3JIeKTpmecKAti penbCOBbIii IIpABapEIBaIOTCZ4 811-35-09 K KOHUaM COeAHHIITeJlb, penbCOB ABa KOHUa KOTOpOrO HaCTbIKe. connexion goupillée Connexion électrique dont les deux extrémités sont fixées par frottement les abouts des rails d’un joint. dans pin type bond An electrical connection of the rails at a joint. whose two ends are attached by friction to the ends eingeprellter Schienenverbinder conexion acuiiada connessione a perno geperste railverbinder lqcznik kolkowy pluggad rtilforbindning coeflsnnrerb mrencenbuoro rena 3neKTpwIecKuü penbCOBbIii yAepXOSBaIOTC5, 811-35-10 TpeHPïCM COeAPïHHTenb, Ha KOHUaX penbCOB KOHUa A= KoToporo Ha CTbIKe. éclisse électrique Joint mécanique retour. des rails assurant aussi la continuité électrique du circuit de electrical rail joint bonded rail joint A mechanical circuit. rail joint which also ensures electrical continuity 3nelcTpavecroe peJlbCOBblii 811-35-11 cTbwonoe penbcoaoe 3JIeKTpHYeCKOti 06paTHOfI CTbIKOBbIM coeAMHemïe, COeA~HeHkleM o6ecnewiBamUee des rails les séparant galvaniquement. insulated rail joint A mechanical a30aepoBaHHoe rail joint which separates the rails electrically. CTblKOBOe HenpepbIBHocTb UeIIA. éclisse isolante Joint mécanique of the return coeAHHeHse CTblK C IlpliBapeHHblM MeXaHmeCKOe elektrische Schienenlasche plaqueta eléctrica giunto conduttore lasplaat zlqcze (szynowe) elektryczne skenskarvfcrbindning coemHeHae ~eXaH~~CCKOepenbcoBoeCOeAYlHeH~e,~pepbIBaIo~ee3neKTpIIYeCKyH)Ue~b. Isolierschienenlasche plaqueta aislante giunto isolante isolatielas zlqcze (szynowe) izolacyjne isolerad skenskarv 50(811) 0 IEC 811-35-12 - 163 - câble de terre Erdungsseil Câble ou fil métallique reliant des supports à la terre ou au rail pour assurer la protection des personnes et des installations, en cas de défaut d’isolement et pouvant en outre servir de câble de retour. cable 0” tierra cava d’ terra aardverbinding przewbd uziemiajacy jordledare earth wire ground wire (USA) A metal wire connecting supports to earth or to rail to protect people and installations in case of an insulation fault and which may also be used as a return table. 3a3eMmt0uwfi UPOBOA MeTaJIJIHYeCKHfi IIpOBOA, o6ecnerkïsaIomkïfi ~3onsIumi, COeAHH~IOIWIfi 6e30IIaCHOCTb KoTopbIti MoxeT Ann 6bITb OnopbI JIIoAeii TaKxe c seïmeii m4 II YCTaHOBOK IIpHMeHeH npH penbcoM H noBpexAeHaH B KaYecTBe o6paTHoro IIpOBOAa. SECTION SECTION 81 l-36 - ALIMENTATION 811-36 - ELECTRICITY PASJJEJI 811-36 - CHCTEMA 811-36-01 SUPPLY SYSTEM 3HEPTOCHAFXEHklR système d’alimentation Stromversorgungssystem .I Système d’alimentation défini par les caractéristiques nominales de l’énergie ~~~:s~~ if $~~~~~~~~~e et de la puissance électrique fournies à la ligne de contact, tels que la tension, le nombre de phases et la fréquence en courant alternatif ou simplement la voedingssysteem system zasilania tension en courant continu. matningssystem feeding system The feeding system is defined by the nominal characteristics of the electrical energy and power supplied to the contact line such as the voltage, number of phases and frequency of alternating current, or voltage alone of direct current. cwTeMa nUTaHm CncTeMa mï-rau~a 3neKTpWieCKOfi TOM 811-36-02 (605-01-06) Hanpxxemïn, rucne TO,IbKO onpeflenaexa 3HeprW HaIIpSl~eHHSl HOMHHanbHbIMH R MOIUHOCTB, YHcna IIOCTORHHOrO @as XapaKTepPiCTHKaMH IIOAaBaeMOii II YacToTbI B KOHTaKTH,‘H) nepeMeHHor0 CeTb, TOKa B mm TOKa. sous-station (de traction) Poste dont la fonction principale (Bahn-) Unterwerk ., .I subestac’on (de tracc’on) sottostazione onderstation podstacja (elektryczna) omformarstation consiste à alimenter un réseau de traction. (traction) substation A substation (TRI-OBaR) UOACTaHUUB mACTaHuHx, CIGTeMy 811-36-03 the main function of which is to supply a traction system. OCHOBHMM Ha3HaYeHPIeM KOTOpOfi flBnxeTcx noAaqa 3Hepraa B TRrH. sous-station de transformation Transformator-Unterwerk à la subestaci6n de transformation sottostazione di trasformazione transformatorstation podstacja transformatorowa transformatorstation system is Sous-station où l’énergie électrique d’un réseau primaire est transformée tension d’alimentation de la ligne de contact. transformer substation A substation at which the electric energy of a primary transformed to the voltage of the contact line. TpaHC+OpMaTOpHafl nOACTaHIJWI, npeo6paxyexir UOACTaHUUR Ha KOTOpOir B supply 3JIeKTp03HeprMfl HanpaxeuHe KOHTaKTHOii IIepBWIHOii nElTaIOlUeir CPiCTeMbI CeTA. , 811-36-04 50(811) 0 CE1 164- sous-station de redressement Sous-station où un courant alternatif généralement courant continu pour alimenter la ligne de contact. triphasé est converti en rectifier substation A substation at which alternating current, generally three-phase, to direct current to supply the contact line. BbUlp~MHTeJlbHa~ nOACTaHLWl, 811-36-05 is converted IlOACTaHUWR Ha npeo6pasyexn Gleichrichterunterwerk subestacion de rectification sottostazione di conversione gelijkrichterstation podstacja prostownikowa likriktarstation KOTOpOti "epeMeHHbI8 B "OCTORHHbItiAJE7 TOK, "OAa?u B OCHOBHOM B KOHTaKTHyIO TpeX@a3HbIti, CeTb. sous-station mobile fahrbares Untenverk Sous-station montée sur un véhicule pouvant être déplacé sur une voie de chemin de fer ou sur route, pour alimenter la ligne de contact dans des sites aménagés pour le raccordement au réseau primaire. subestacion movi’ sottostazione mobile gelijkrichtenvagen podstacja przewoina mobil omformarstation mobile substation movable substation A substation mounted on a vehicle capable of being moved on a railway or road, to supply the contact line at sites where connection to a main supply system is provided. nOACTaHIJWf, CMOHTupOBaHHa5l cnoco6HaR nepeAmiraTbcn no MeCTaX, "UTaTbKOHTaKTHyIOCeTbBTeX c rnaaaoti 811-36-06 nmamueii Ha “OABEDKHOl-0 eAuHaqe penbcoaoMy unu 6e3penbCOBOMy COCTaBa, nym u rAe"peAyCMaT'puBaeTc~coeAUHeHUe cacreMoii. Netzrückspeisungsunterwerk sous-station à récupération Sous-station dans laquelle l’énergie électrique récupérée en freinage par les subestacion de recuperacion sottostazione reversibile trains peut être renvoyée dans le réseau primaire d’alimentation. onderstation met recuperatiemogelijkheden podstacja odzyskowa receptive substation ..... A substation at which the energy recovered from regenerative braking of trains cari be returned to the main supply system. npntmMalomaa lloAcraauua,Ha ~0~0p0ti BO3BpaIQae'rCR 811-36-07 HOACTaHUlSH B rllaBHyI0 nony9emaR B pe3ynb-raTe nUTaIOUIyK7 CuCTeMy. peKynepawu 3Heprufl Speisepunkt (Stromversorgungsstelle) point d’alimentation Poste dans lequel les artéres d’alimentation contact. sont raccordées à la ligne de feeder station A substation IIj’HKT 811-36-08 at which the supply lines are connected puut de alimentacion posto di alimentazione voedingspunt ; voedingsstation punkt zasilania matarstation to the contact line. IIHTBHHR fil artère câble d’alimentation Raccordement électrique reliant la ligne de contact à une sous-station. between the contact line and a substation. nnrammafi Ka6eflb %eKTpuYeCKOeCOeAuHeHUC sottostazionel voedingskabel ’ przewod zasilajpcy matarledning feeder table feeder An electrical connection Speiseleitung table de alimentaci6n ; arteria conduttore d’alimentazione (di sottostazione) ; alimentatore (di KOHTBKTHOI? CeTH H "OACTaHUUH. - 50(811) 0 IEC 811-36-09 165Verstarkungsleitung linea de alimentaci& ligne d’alimentation feeder de ligne (déconseillé) Conducteur aérien monté parallèlement ou en parallèle avec la ligne de a’imentatore (di linea) contact, soit pour assurer des réalimentations successives, soit pour en versterkingsleiding przewod wzmacniajqcy augmenter la section utile. fiWt%rkningsledning line feeder An overhead conductor mounted parallel to or in parallel with the contact line either to supply successive feeding points or to increase the useful crosssectional area. d”‘AeP BOSAyUIHbIfi "pOBO& yCTaHaBJIUBaeMbIii nu60 Ana oneprocna6xeuua noabnnenua none3Hoti nnowaAu 811-36-10 "apaJIneJIbH0 noc.rIeAymruux nyHKTOB nonepewioro KOHTaKTHOil nuTaHuR, CeTU nu60 AJIR CeYeHm. sectionnement Fahrleitungsgruppe oder -abschnitt Disposition assurant la division d’une ligne de contact en sections, chacune d’entre elles pouvant être isolée électriquement des sections adjacentes, par exemple au moyen d’interrupteurs. sec~ionamiento sezlonamento sectie ; sectionering sekcjonowanie sektionering sectioning The division of the contact line into electrical sections, each of which may be isolated from the adjacent sections e.g. by means of switches. CeKUH0HHPOBaHHe ~a3AC~CHUeKOHTaKTHO~CeTuHa3~eKTpH~eCKUeCeK~HU,KaXAa~U3KOTOpbIX MOxeT 6bITb H30JIHpOBaH OT HanpuMep, npyroü, c "OMOIIlbIO BbIKJIIoYaTeJIek 811-36-11 Trennstelle point de sectionnement Disposition de la ligne de contact assurant une isolation adjacentes de celle-ci, tout en permettant une captation courant. entre des sections ininterrompue de sectioning point punto de sec.cionamiento purno d1 sez’onamento sectieschakelaar punkt sekcjonowania sektionspunkt An arrangement of the contact line equipment to provide insulation between adjacent sections of contact line and yet allow continuous current collection. TOYKaCeKUH0HHPOBaHliR YaCTb 060pyAOBaHuR CMeXHbIX 811-36-12 yYaCTKOB KOHTaKTHOii KOHTaKTHOfi CeTH, CeTU o6ecne~usaromaa U He"pepbIBHbIti u3onffImo TOKOC%eM. Spartransformator-Unterwerk subestacion de inyeccion ; subestacion con autotransformador (en traccion eléctrica) sottostazione ausiliaria (di alimentazione) Note. - Ce poste peut en outre être conçu pour assurer tout ou partie des ..... fonctions de sectionnement et de mise en parallèle des lignes de contact et podstacja autotransformatorowa feeders convergeant vers lui. ..... poste d’injection (en traction électrique) Poste équipé d’un autotransformateur, alimenté par une ligne d’alimentation à une tension double de celle de la ligne de contact, permettant l’injection d’énergie dans cette dernière. auto-transformer substation (in electric traction) A substation equipped with an auto-transformer supplied at twice contact line voltage from a line feeder, allowing energy to be injected into the contact line. Note.-This station may in addition provide some or all of the functions a track sectioning or track paralleling cabin. aBTOT&KiHC~OpMaTOpHaB IlOACT-dHUHfl 06OpyAOBaHHaH nOACTaHUUH, (B JJIeKTpH9eCKOfi of TRI%) aBTOTpaHC@OpMaTOpOM, IIUTaeMbIM OT ~aAepa~anpnxeHueM,~ABapasanpeebIruaIo~uMHanpaxe~ueKoHTaKT~oB CeTH,YTO n03BOJISleT njhYMC?YJ?H% - "pOH3BOAUTb AaHHaSI "0A"UTKy "OACTaHUHR MOXeT KOHTaKTHOti AO"OJIHUTeJIbH0 ~e~o~opbIeunuBce~y~~~uuce~~uo~upoBa~~u~unapannenbaoronuraaaa KOHTaKTHOii CCTH. CeTu. BbI"OnHIITb 811-36-13 50(811) 0 CE1 166 - poste de sectionnement (en traction électrique) poste de mise en parallèle (en traction électrique) Poste équipé d’un jeu de barres et d’appareils de coupure permettant d’assurer tout ou partie des fonctions de sectionnement et de mise en parallèle des lignes de contact, et éventuellement des feeders qui convergent vers lui. track sectioning cabin (in electric traction) track paralleling cabin (in electric traction) Streckentrennungs- (bzw. Streckenparallelschaltungswerk) centra de seccionamiento ; centra de puesta en paralelo (en traction eléctrica) posto di sezionamento ; posto di parallelo schakelstation kabina sekcyjna skenskarvfijrbindning A substation equipped with busbars and circuit breakers providing some or a11 of the functions of sectioning and of connecting the contact lines in parallel, including possibly any line feeders converging on it. BKJIH>Y‘WIIfl BOCT ,lapaJIJle~bHOrO ~OACTaHIUGI, 060pyAOBaHHaR II~~I nce HCKOTOpbIC BKJIEOYeHEIR 811-36-14 (B WICKTpHYeCKOti IUIIHBMII ceKu~on~ponamn4 @YHKQE~A KOHTaKTHbIX CCTCii, TSIITC) R BbIKJlKNaTCJIRMA, B TOM YWZJIe +iACpOB, BbInOAHIIlOLUaR II napannenbaoro nkITaK>W~X e& sectionnement à lame d’air Point de sectionnement réalisé en disposant côte à côte, sur une certaine longueur et à une distance suffisante pour assurer leur isolation, les deux extrémités des caténaires de part et d’autre de l’axe de sectionnement. insulated overlap Streckentrennung seccionamiento por lamina de aire sezionamento a spazio d'aria overnameveld van een openspaninrichting punkt sekcjonowania izolowany (zakladkowy) ..... A sectioning point formed by overlapping the ends of adjacent sections of contact line, allowing parallel running, insulation being provided by a suitable air gap between the two sets of equipment. CeK,,E,OHApOBaHHe ToWa CMCaHbIX YWCTKOB pa6oTy, II~E~ B03A,‘UIHbIM 811-36-15 BOSflYmHbIM IlpOMeXQ'TKOM o6pa3yeMaa CCKWOHHpOBaHHn, KOHTaKTHOti 3~0M I130JIRUiFI 3a30POM MexAj’ nOCpeACTBOM COCAAHCHAII o6ecnesasamma~ CCTII, 06CCIICYHBaCTCR ABJ’MII KOMIUICKTaMA KOHUOB UX IIapaJIACnbHyW COOTBCTCTBYH3IIPiM 060pyAOBaHIUl. isolateur de section Point de sectionnement comportant un isolateur inséré dans la ligne de contact et un dispositif assurant une captation ininterrompue du courant. section insulator A sectioning point formed by insulators inserted in a continuous contact line, with skids or similar devices to maintain continuous collection. CeKI,I,OHHblii ToYKa II0 run of current B30JlRTOp CCKWIOHIIPOBaHHR, AJIHHC KOHTâKTHOTO ,‘CTPOtiCTBaMA 811-36-16 AJIR 06pa30BaHHaR IIpOBOAa o6ecne9eHua A30JIRTOPaMA, C CaAa3KaMA HCIIpCpbIBHOI’O yCT?lHOBnCHHbIMH EUIll aHWIOTAYHb1MA TOKOC-bCMa. section de séparation section neutre Partie de ligne de contact pourvue à chaque extrémité d’un point de sectionnement, de façon à éviter l’interconnexion par les organes de prise de courant, de deux caténaires successives pouvant présenter des différences de tension ou de phase. neutral section A section of a contact line provided with a sectioning point at each end, to prevent successive electrical sections differing in voltage or phase being connected together by the passage of current collectors. YYaCTOK Streckentrenner aislador de section isolatore di sezione leidingonderbreker izolator sekcyjny sektionsisolator KOHTâKTHOil CeTU, OrpaHWk!HHbIii Ki6eXaHHe CCKUIIOHIIPOBBHMR BO IIOCJICAOBaTCJIbHbIX YYBCTKOB, IICpCKpbITFlH nHTaCMbIX o6enx C CTOPOH TOKOIIPHCMHBKaMA OT pa3HOrO HanpsxCHUx IIOCTOM ABYX IUIEI @as. Schutzstrecke section de separacion ; section neutra sezione neutra neutrale sectie wstawka neutralna skyddssektion - 50(811) 0 IEC 811-36-17 167unabhiingig gespeiste Gleise indépendance des voies Disposition générale d’équipement réalisant une indépendance mécanique et independencia de vias électrique des voies, les unes par rapport aux autres, de telle façon qu’un indipendenza dei binari onafhankelijke ophanging en voeding van incident sur l’une d’elles n’affecte pas les autres. naast elkaar gelegen sporen niezaleino.& torow independence of tracks ....I A general arrangement of equipment providing mechanical and electrical independence of the tracks from one another, SO that a failure on one track does not affect the others. HC3aBACAMOCTb Pacnonosenne nyT& 06opy~oaaaus, Pi 3JICKTpHWCKaR YTO 811-36-18 IIOBpCaACHHC npn HC3aBHCHMOCTb Ha OAHOM K0~0p0M OAHOI-0 06CCIICWBaCTCz IIYTU OT ApyrOrO H3 HIIX HC OTpaHtaCTCR Mexanmiecxaa o6pasoM, TâKIIM Ha ApyI-OM. Stromklemme griffe d’alimentation Pièce conductrice assurant la connexion électrique d’une ligne de contact et un câble d’alimentation. entre les conducteurs feeder clamp A conducting fitting providing electrical connection of a contact system and a feeder table. neTalomnÏ4 3axm TOKOIIpOBOA~LUaR IIPOBOAOB 811-36-19 between the conductors grifa de alimentacion (connessione) equipotenziale aansluitklem voor elektrische verhinding ; voedingsklem zacisk zasilania ..... ACTaJIb, KOHTaKTHOii o6ecneWisaromaa co6oii HJIA CCTki M’%A)’ 3JICKTpWiCCKOC C IIHTFUOIIWM COCAIIHCHllC IIPOBOAOM. voie commutable Gleisabschnitt fiir Systemwechsel Voie dont la ligne de contact peut être alimentée par un réseau d’alimentation ou par un autre. via conmutab’e binario commutabile spoor met omschakelbaar voedingssysteem tor dwusystemowy ..... dual system track Track on which the contact line cari be fed with one or another electric energy. system of nepeKnmsaeMbu? nyTb flYTb, CIICTeMbI Ha KOTOPOM KOHTaKTHâII JJICKTpOJHCprIW. CCTb IIHTaCTCH OT OAHOii HAI4 ApyrOii